Protein / Label:sp|P01861|IGHG4_HUMAN
Description:Ig gamma-4 chain C region OS=Homo sapiens GN=IGHG4 PE=1 SV=1
Decoy:false
Note: 
File:IgG_20151216_2016-02-08_08-48-47.sky.zip
0102030405060708090
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
1
100110120130140150160170180190
KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK
1
200210220230240250260270280290
CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
1 1 1 <
300310320
NVFSCSVMHEALHNHYTQKSLSLSLGK
<< 1 1
DescriptionIg gamma-4 chain C region
Gene name(s)IGHG4
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P01861
IGHG4_HUMAN
ENST00000605075
ENST00000390543
none loaded GO:0045087
GO:0038096
GO:0016020
GO:0006958
GO:0005576
GO:0003823

Peak Areas

Retention Times