Protein / Label:sp|P01860|IGHG3_HUMAN
Description:Ig gamma-3 chain C region OS=Homo sapiens GN=IGHG3 PE=1 SV=2
Decoy:false
Note: 
File:IgG_20151216_2016-02-08_08-48-47.sky.zip
0102030405060708090
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL
100110120130140150160170180190
KTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED
1 1 1 1 1 1 >>
200210220230240250260270280290
PEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
> 1 1
300310320330340350360370
GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
1
DescriptionIg gamma-3 chain C region
Gene name(s)IGHG3
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P01860
A2NU35
IGHG3_HUMAN
none loaded none loaded GO:0045087
GO:0038096
GO:0016020
GO:0006958
GO:0005576
GO:0003823

Peak Areas

Retention Times