Protein / Label:sp|P02765|FETUA_HUMAN
Description:Alpha-2-HS-glycoprotein OS=Homo sapiens GN=AHSG PE=1 SV=1
Decoy:false
Note: 
File:Heavy-FetuinA_20151224_2016-02-08_08-59-07.sky.zip
0102030405060708090
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC
1
100110120130140150160170180190
SVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVE
1 1 1 1 1 1 >>
200210220230240250260270280290
FTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
> 1 1
300310320330340350360
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
1 1
DescriptionAlpha-2-HS-glycoprotein
Gene name(s)AHSG
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001613.2
none loaded Q9P152
P02765
O14962
O14961
B2R7G1
A8K9N6
FETUA_HUMAN
ENST00000411641
none loaded GO:0050766
GO:0050727
GO:0046627
GO:0030502
GO:0019210
GO:0010951
GO:0006953
GO:0006907
GO:0005615
GO:0004869
GO:0001503
GO:0001501

Peak Areas

Retention Times