Protein / Label:sp|Q13790|APOF_HUMAN
Description:Apolipoprotein F OS=Homo sapiens GN=APOF PE=1 SV=2
Decoy:false
Note: 
File:Heavy-APOF_20151224_2016-02-08_09-39-49.sky.zip
0102030405060708090
MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFLVSLALRNALEEAGC
1 1 1 1 <
100110120130140150160170180190
QADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNLGTALY
<< 1 1 1 1 1
200210220230240250260270280290
YATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTTLASFISEV
1 1
300310320
VSSAPYWGWAIIKSYDLDPGAGSLEI
1
DescriptionApolipoprotein F (short name: Apo-F)
Gene name(s)APOF
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001629.1
none loaded Q8TC13
Q13790
APOF_HUMAN
ENST00000398189
none loaded GO:0034364
GO:0034362
GO:0033344
GO:0015485
GO:0008203
GO:0006641
GO:0005576
GO:0005319
GO:0005102

Peak Areas

Retention Times