Protein / Label:sp|P81172|HEPC_HUMAN
Description:Hepcidin OS=Homo sapiens GN=HAMP PE=1 SV=2
Decoy:false
Note: 
File:HAMP_20151120_2015-12-03_21-19-57.sky.zip
01020304050607080
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
1 1
DescriptionHepcidin
Gene name(s)HAMP
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_066998.1
none loaded Q9BY68
Q1HE14
P81172
HEPC_HUMAN
ENST00000598398
ENST00000222304
none loaded GO:0050832
GO:0045179
GO:0042742
GO:0031640
GO:0006955
GO:0006879
GO:0005576

Peak Areas

Retention Times