Protein / Label:sp|P01588|EPO_HUMAN
Description:Erythropoietin OS=Homo sapiens GN=EPO PE=1 SV=1
Decoy:false
Note: 
File:EPO_20151120_2015-12-03_21-14-18.sky.zip
0102030405060708090
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEA
1 1 1 >>
100110120130140150160170180190
VLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
> 1 1 1 1 1 1
DescriptionErythropoietin
Gene name(s)EPO
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000790.2
none loaded Q9UHA0
Q9UEZ5
Q9UDZ0
Q549U2
Q2M2L6
P01588
EPO_HUMAN
ENST00000252723
none loaded GO:2001258
GO:1902251
GO:1902219
GO:0071474
GO:0070555
GO:0061418
GO:0055093
GO:0051602
GO:0048678
GO:0046579
GO:0045893
GO:0045740
GO:0045666
GO:0043627
GO:0043249
GO:0042541
GO:0042523
GO:0033574
GO:0033189
GO:0032496
GO:0030295
GO:0018105
GO:0010523
GO:0009986
GO:0009651
GO:0008284
GO:0008015
GO:0007568
GO:0007566
GO:0007165
GO:0006915
GO:0005615

Peak Areas

Retention Times