Protein / Label:sp|P02741|CRP_HUMAN
Description:C-reactive protein OS=Homo sapiens GN=CRP PE=1 SV=1
Decoy:false
Note: 
File:CRP_20151216_2016-02-08_08-47-56.sky.zip
0102030405060708090
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEI
1 1 1 1 1 1
100110120130140150160170180190
LFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
200210220
NVLNWRALKYEVQGEVFTKPQLWP
1
DescriptionC-reactive protein
Gene name(s)CRP
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005244961.1
NP_000558.2
none loaded Q8WW75
Q08AK3
P02741
D3DVE0
D3DVD9
A8K078
CRP_HUMAN
ENST00000368112
ENST00000255030
none loaded GO:1900006
GO:0071277
GO:0051258
GO:0050830
GO:0046872
GO:0045471
GO:0042060
GO:0033265
GO:0030426
GO:0030175
GO:0030169
GO:0015485
GO:0010888
GO:0010745
GO:0010288
GO:0008228
GO:0007568
GO:0006958
GO:0006953
GO:0005615
GO:0005576
GO:0001666

Peak Areas

Retention Times