Protein / Label:sp|P02654|APOC1_HUMAN
Description:Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1
Decoy:false
Note: 
File:APOC1_20151224_2016-02-08_08-58-02.sky.zip
01020304050607080
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
1 1 1
DescriptionApolipoprotein C-I
Gene name(s)APOC1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005258912.1
NP_001636.1
none loaded Q6IB97
P02654
APOC1_HUMAN
ENST00000588802
ENST00000588750
ENST00000252491
none loaded GO:0060228
GO:0051005
GO:0048261
GO:0045717
GO:0042627
GO:0042157
GO:0034447
GO:0034382
GO:0034379
GO:0034375
GO:0034364
GO:0034361
GO:0033700
GO:0033344
GO:0032375
GO:0031210
GO:0010916
GO:0010900
GO:0010873
GO:0008203
GO:0006641
GO:0006629
GO:0005783
GO:0005504
GO:0004859

Peak Areas

Retention Times