Protein / Label:sp|P00568|KAD1_HUMAN
Description:Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3
Decoy:false
Note: 
File:AK1_20151216_2016-02-05_17-05-54.sky.zip
0102030405060708090
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQ
1 1 1 1 1 1 <
100110120130140150160170180190
QGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
<< 1 1 1 1 1
DescriptionAdenylate kinase isoenzyme 1 (short name: AK 1)
Gene name(s)AK1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000467.1
XP_005251844.1
none loaded Q9UQC7
Q9BVK9
P00568
KAD1_HUMAN
ENST00000373176
ENST00000373156
none loaded GO:0046034
GO:0036126
GO:0015949
GO:0009142
GO:0007050
GO:0005886
GO:0005829
GO:0005524
GO:0004550
GO:0004017
GO:0001520

Peak Areas

Retention Times