14 Dec 2023 23:56:51,266 INFO : Copying experiment "Modeling the simultaneous dynamics of proteins in blood plasma and the cerebrospinal fluid in human in vivo" from folder /IRMB - PPC/SILK2/SILK_P017 to /Panorama Public/2023/IRMB PPC - SILK_P017
14 Dec 2023 23:56:51,266 INFO : =======================================
14 Dec 2023 23:56:51,283 DEBUG: Resetting Job ID: 38a1db0b-7d4d-103c-b5a4-fea6ddf52354
14 Dec 2023 23:56:51,307 INFO : Starting to run task 'org.labkey.panoramapublic.pipeline.ExperimentExportTask' at location 'webserver-high-priority'
14 Dec 2023 23:56:51,307 INFO :
14 Dec 2023 23:56:51,307 INFO : Exporting experiment.
15 Dec 2023 00:23:10,633 INFO : Exporting files metadata.
15 Dec 2023 00:23:10,633 DEBUG: [/IRMB - PPC/SILK2/SILK_P017] Writing files metadata to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/export
15 Dec 2023 00:23:10,837 INFO :
15 Dec 2023 00:23:10,837 INFO : Experiment export completed successfully.
15 Dec 2023 00:23:10,837 INFO : Successfully completed task 'org.labkey.panoramapublic.pipeline.ExperimentExportTask'
15 Dec 2023 00:32:29,086 INFO : Starting to run task 'org.labkey.panoramapublic.pipeline.ExperimentImportTask' at location 'webserver-high-priority'
15 Dec 2023 00:32:29,086 INFO :
15 Dec 2023 00:32:29,086 INFO : Importing experiment.
15 Dec 2023 00:32:29,090 DEBUG: [/Panorama Public/2023/IRMB PPC - SILK_P017] Importing folder properties from: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/export
15 Dec 2023 00:32:29,091 INFO : Loading folder properties (folder type, settings and active modules)
15 Dec 2023 00:32:29,091 DEBUG: [/Panorama Public/2023/IRMB PPC - SILK_P017] Folder type: Targeted MS
15 Dec 2023 00:32:29,091 DEBUG: [/Panorama Public/2023/IRMB PPC - SILK_P017] Active modules: Announcements, Query, Assay, PanoramaPublic, Issues, FileContent, Core, TargetedMS, Pipeline, Experiment, Search, MS2, Wiki, API
15 Dec 2023 00:32:29,162 INFO : Done importing folder properties (folder type, settings and active modules)
15 Dec 2023 00:32:29,163 INFO : Loading container specific module properties
15 Dec 2023 00:32:29,166 INFO : Done importing container specific module properties
15 Dec 2023 00:32:29,168 INFO : Loading etl definitions
15 Dec 2023 00:32:29,169 INFO : Loading wikis
15 Dec 2023 00:32:29,172 INFO : 0 wikis imported
15 Dec 2023 00:32:29,172 INFO : Done importing wikis
15 Dec 2023 00:32:29,174 INFO : Starting Data Class Importer
15 Dec 2023 00:32:29,174 INFO : No types XAR file to process.
15 Dec 2023 00:32:29,174 INFO : Finished Data Class Importer
15 Dec 2023 00:32:29,174 INFO : Starting to copy files
15 Dec 2023 00:32:29,174 INFO : Copied 0 files
15 Dec 2023 00:32:29,174 INFO : Ensuring exp.data rows exist for imported files
15 Dec 2023 00:32:29,238 INFO : Starting Sample Type Importer
15 Dec 2023 00:32:29,238 INFO : No types XAR file to process.
15 Dec 2023 00:32:29,238 INFO : Finished Sample Type Importer
15 Dec 2023 00:32:29,239 INFO : Loading xar
15 Dec 2023 00:39:41,603 DEBUG: Finished loading Protocol with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,605 DEBUG: Finished loading Protocol with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,608 DEBUG: Finished loading Protocol with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,608 DEBUG: Protocol import complete
15 Dec 2023 00:39:41,609 DEBUG: Finished loading Experiment with LSID 'urn:lsid:uw.edu:Experiment.Folder-12403:Modeling+the+simultaneous+dynamics+of+proteins+in+blood+plasma+and+the+cerebrospinal+fluid+in+human+in+vivo'
15 Dec 2023 00:39:41,609 DEBUG: Experiment/Run group import complete
15 Dec 2023 00:39:41,618 DEBUG: Protocol action set import complete
15 Dec 2023 00:39:41,628 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,636 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:617a0666-7586-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,641 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:6179fde0-7586-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,642 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,644 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,645 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:3f385e02-7587-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,652 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,658 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:4a87e5fb-758a-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,664 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:ac84d635-7589-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,664 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,666 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,667 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:90bb216e-758b-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,675 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,681 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:9647625f-758e-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,686 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:3e9277a5-758e-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,686 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,688 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,689 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:1312ba11-7590-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,695 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,701 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:5cba3759-7594-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,705 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:a73e8258-7593-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,705 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,707 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,708 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:9f2df051-7595-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,714 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,719 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:ac73f20d-75a1-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,725 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:ac73ee6c-75a1-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,725 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,727 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,727 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:5e204152-75a2-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,734 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,739 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:4221a5fb-75a5-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,743 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:cb2d679e-75a4-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,743 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,745 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,746 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:2092376d-75a6-103c-bc68-fea6ddf5ace0'
15 Dec 2023 00:39:41,751 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,758 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:c1d0656f-7a1c-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,763 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:6bfb45ed-7a1c-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,763 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,765 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,765 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:95d2952e-7a1e-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,773 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip'
15 Dec 2023 00:39:41,781 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:skyd.Folder-12403:7c1da91c-7a20-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,785 DEBUG: Finished loading Data with LSID 'urn:lsid:uw.edu:UploadedFile.Folder-12403:e39f0b71-7a1f-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,785 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Core'
15 Dec 2023 00:39:41,786 DEBUG: Finished loading ProtocolApplication with LSID 'urn:lsid:uw.edu:Protocol.Folder-12403:TargetedMS.ImportSkyZip.Output'
15 Dec 2023 00:39:41,787 DEBUG: Finished loading ExperimentRun with LSID 'urn:lsid:uw.edu:Run.Folder-12403:da051bed-7a21-103c-b5a4-fea6ddf52354'
15 Dec 2023 00:39:41,812 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179045/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd into the system
15 Dec 2023 00:39:41,812 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179045/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd into the system
15 Dec 2023 00:39:41,812 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179045/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip into the system
15 Dec 2023 00:39:41,813 INFO : Starting import from SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 00:39:41,817 INFO : Starting to import Skyline document from SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 00:39:41,915 INFO : Expanding human.protdb
15 Dec 2023 00:39:44,655 INFO : Expanding CSF_P017_F1.imsdb
15 Dec 2023 00:39:44,680 INFO : Expanding SILK_P017_CSF_F1_a.blib
15 Dec 2023 00:39:44,965 INFO : Expanding SILK_P017_CSF_F1_a.redundant.blib
15 Dec 2023 00:39:46,459 INFO : Expanding SILK_P017_CSF_F1_a.skyd
15 Dec 2023 00:39:51,729 INFO : Expanding SILK_P017_CSF_F1_a.sky.view
15 Dec 2023 00:39:51,877 INFO : Expanding SILK_P017_CSF_F1_a.sky
15 Dec 2023 00:39:52,508 INFO : Expanding SILK_P017_CSF_F1_a.skyl
15 Dec 2023 00:40:09,872 DEBUG: Starting to load chromatogram headers
15 Dec 2023 00:40:10,160 DEBUG: Done loading chromatogram headers
15 Dec 2023 00:40:10,345 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 00:40:10,358 WARN : 'SILK_P017_CSF_F1_precursor' library was not found in settings.
15 Dec 2023 00:40:10,369 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:10,369 INFO : Inserting sp|A0MZ66|SHOT1_HUMAN
15 Dec 2023 00:40:10,543 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:10,543 INFO : Inserting sp|A6NC98|CC88B_HUMAN
15 Dec 2023 00:40:10,759 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:10,759 INFO : Inserting sp|A6NHR9|SMHD1_HUMAN
15 Dec 2023 00:40:10,828 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:10,828 INFO : Inserting sp|O00161|SNP23_HUMAN
15 Dec 2023 00:40:10,835 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.3_F2_S1-A4_1_3064.d
15 Dec 2023 00:40:10,835 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.3_F2_S1-A7_1_2819.d
15 Dec 2023 00:40:10,835 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.9_F2_S1-B7_1_2827.d
15 Dec 2023 00:40:10,835 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.15_F2_S1-C7_1_2835.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.22_F2_S1-D7_1_2844.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.28_F2_S1-E7_1_2852.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.35_F2_S1-F7_1_2860.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.41_F2_S1-G7_1_2871.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6653.47_F2_S1-H7_1_2879.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6666.3_F2_S1-A8_1_2887.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6666.7_F2_S1-B8_1_2895.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6666.11_F2_S1-C8_1_2903.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6666.17_F2_S1-D8_1_2911.d
15 Dec 2023 00:40:10,836 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F2\CSF_6666.24_F2_S1-E8_1_2919.d
15 Dec 2023 00:40:10,889 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:10,889 INFO : Inserting sp|O00168|PLM_HUMAN
15 Dec 2023 00:40:10,910 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:10,911 INFO : Inserting sp|O00231|PSD11_HUMAN
15 Dec 2023 00:40:10,973 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:10,973 INFO : Inserting sp|O00241|SIRB1_HUMAN
15 Dec 2023 00:40:11,050 INFO : 1% Done
15 Dec 2023 00:40:11,080 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:11,080 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 00:40:11,140 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,140 INFO : Inserting sp|O00339|MATN2_HUMAN
15 Dec 2023 00:40:11,158 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,158 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 00:40:11,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:11,213 INFO : Inserting sp|O00410|IPO5_HUMAN
15 Dec 2023 00:40:11,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,292 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 00:40:11,393 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:11,393 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 00:40:11,513 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:11,513 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 00:40:11,584 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:11,584 INFO : Inserting sp|O00555|CAC1A_HUMAN
15 Dec 2023 00:40:11,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,604 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 00:40:11,687 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:11,688 INFO : Inserting sp|O00629|IMA3_HUMAN
15 Dec 2023 00:40:11,707 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,707 INFO : Inserting sp|O14579|COPE_HUMAN
15 Dec 2023 00:40:11,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,744 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 00:40:11,794 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:11,794 INFO : Inserting sp|O14618|CCS_HUMAN
15 Dec 2023 00:40:11,848 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,848 INFO : Inserting sp|O14657|TOR1B_HUMAN
15 Dec 2023 00:40:11,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:11,865 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 00:40:11,915 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:11,915 INFO : Inserting sp|O14727|APAF_HUMAN
15 Dec 2023 00:40:12,019 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:12,019 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 00:40:12,145 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:12,145 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 00:40:12,310 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:12,310 INFO : Inserting sp|O14793|GDF8_HUMAN
15 Dec 2023 00:40:12,320 INFO : 2% Done
15 Dec 2023 00:40:12,356 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:12,356 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 00:40:12,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:12,401 INFO : Inserting sp|O14879|IFIT3_HUMAN
15 Dec 2023 00:40:12,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,435 INFO : Inserting sp|O14929|HAT1_HUMAN
15 Dec 2023 00:40:12,452 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,452 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 00:40:12,547 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:12,548 INFO : Inserting sp|O14974|MYPT1_HUMAN
15 Dec 2023 00:40:12,592 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:12,592 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 00:40:12,649 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:12,649 INFO : Inserting sp|O15041|SEM3E_HUMAN
15 Dec 2023 00:40:12,687 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:12,687 INFO : Inserting sp|O15047|SET1A_HUMAN
15 Dec 2023 00:40:12,718 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,718 INFO : Inserting sp|O15078|CE290_HUMAN
15 Dec 2023 00:40:12,745 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:12,745 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 00:40:12,777 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,777 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 00:40:12,860 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:12,860 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 00:40:12,875 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,875 INFO : Inserting sp|O15162|PLS1_HUMAN
15 Dec 2023 00:40:12,909 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:12,909 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 00:40:12,958 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:12,958 INFO : Inserting sp|O15240|VGF_HUMAN
15 Dec 2023 00:40:13,015 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:13,016 INFO : Inserting sp|O15305|PMM2_HUMAN
15 Dec 2023 00:40:13,049 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:13,049 INFO : Inserting sp|O15354|GPR37_HUMAN
15 Dec 2023 00:40:13,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:13,080 INFO : Inserting sp|O15372|EIF3H_HUMAN
15 Dec 2023 00:40:13,147 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:13,147 INFO : Inserting sp|O15389|SIGL5_HUMAN
15 Dec 2023 00:40:13,176 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:13,176 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 00:40:13,402 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:13,402 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 00:40:13,486 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:13,486 INFO : Inserting sp|O15540|FABP7_HUMAN
15 Dec 2023 00:40:13,525 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:13,525 INFO : Inserting sp|O43143|DHX15_HUMAN
15 Dec 2023 00:40:13,676 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:13,677 INFO : Inserting sp|O43242|PSMD3_HUMAN
15 Dec 2023 00:40:13,784 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:13,784 INFO : Inserting sp|O43278|SPIT1_HUMAN
15 Dec 2023 00:40:13,872 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:13,872 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 00:40:13,925 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:13,925 INFO : Inserting sp|O43399|TPD54_HUMAN
15 Dec 2023 00:40:13,964 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:13,964 INFO : Inserting sp|O43493|TGON2_HUMAN
15 Dec 2023 00:40:14,021 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:14,021 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 00:40:14,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,039 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 00:40:14,076 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,076 INFO : Inserting sp|O43586|PPIP1_HUMAN
15 Dec 2023 00:40:14,125 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:14,126 INFO : Inserting sp|O43617|TPPC3_HUMAN
15 Dec 2023 00:40:14,165 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,165 INFO : Inserting sp|O43633|CHM2A_HUMAN
15 Dec 2023 00:40:14,227 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,227 INFO : Inserting sp|O43704|ST1B1_HUMAN
15 Dec 2023 00:40:14,318 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:14,318 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 00:40:14,642 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:14,642 INFO : Inserting sp|O43747|AP1G1_HUMAN
15 Dec 2023 00:40:14,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,679 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 00:40:14,715 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,716 INFO : Inserting sp|O60216|RAD21_HUMAN
15 Dec 2023 00:40:14,733 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,733 INFO : Inserting sp|O60264|SMCA5_HUMAN
15 Dec 2023 00:40:14,826 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:14,826 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 00:40:14,835 INFO : 3% Done
15 Dec 2023 00:40:14,907 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:14,907 INFO : Inserting sp|O60486|PLXC1_HUMAN
15 Dec 2023 00:40:14,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,942 INFO : Inserting sp|O60493|SNX3_HUMAN
15 Dec 2023 00:40:14,959 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,959 INFO : Inserting sp|O60502|OGA_HUMAN
15 Dec 2023 00:40:14,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:14,975 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 00:40:15,009 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,009 INFO : Inserting sp|O60613|SEP15_HUMAN
15 Dec 2023 00:40:15,025 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,025 INFO : Inserting sp|O60763|USO1_HUMAN
15 Dec 2023 00:40:15,127 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,127 INFO : Inserting sp|O60812|HNRC1_HUMAN
15 Dec 2023 00:40:15,171 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,171 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 00:40:15,223 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:15,223 INFO : Inserting sp|O60826|CCD22_HUMAN
15 Dec 2023 00:40:15,277 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,277 INFO : Inserting sp|O60841|IF2P_HUMAN
15 Dec 2023 00:40:15,339 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,339 INFO : Inserting sp|O60890|OPHN1_HUMAN
15 Dec 2023 00:40:15,390 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,390 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 00:40:15,425 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,425 INFO : Inserting sp|O75022|LIRB3_HUMAN
15 Dec 2023 00:40:15,477 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,477 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 00:40:15,507 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,507 INFO : Inserting sp|O75165|DJC13_HUMAN
15 Dec 2023 00:40:15,671 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:15,671 INFO : Inserting sp|O75173|ATS4_HUMAN
15 Dec 2023 00:40:15,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,686 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 00:40:15,737 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,737 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 00:40:15,793 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:15,793 INFO : Inserting sp|O75347|TBCA_HUMAN
15 Dec 2023 00:40:15,945 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:15,945 INFO : Inserting sp|O75348|VATG1_HUMAN
15 Dec 2023 00:40:15,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:15,960 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 00:40:16,069 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:16,069 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 00:40:16,083 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,083 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 00:40:16,111 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:16,111 INFO : Inserting sp|O75396|SC22B_HUMAN
15 Dec 2023 00:40:16,120 INFO : 4% Done
15 Dec 2023 00:40:16,166 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,166 INFO : Inserting sp|O75436|VP26A_HUMAN
15 Dec 2023 00:40:16,188 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,188 INFO : Inserting sp|O75477|ERLN1_HUMAN
15 Dec 2023 00:40:16,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,223 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 00:40:16,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,264 INFO : Inserting sp|O75558|STX11_HUMAN
15 Dec 2023 00:40:16,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:16,320 INFO : Inserting sp|O75608|LYPA1_HUMAN
15 Dec 2023 00:40:16,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,356 INFO : Inserting sp|O75787|RENR_HUMAN
15 Dec 2023 00:40:16,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,372 INFO : Inserting sp|O75821|EIF3G_HUMAN
15 Dec 2023 00:40:16,407 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,408 INFO : Inserting sp|O75822|EIF3J_HUMAN
15 Dec 2023 00:40:16,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:16,499 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 00:40:16,549 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:16,549 INFO : Imported 100 peptide groups.
15 Dec 2023 00:40:16,549 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 00:40:16,688 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:16,688 INFO : Inserting sp|O75886|STAM2_HUMAN
15 Dec 2023 00:40:16,723 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,724 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 00:40:16,803 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:16,803 INFO : Inserting sp|O75937|DNJC8_HUMAN
15 Dec 2023 00:40:16,843 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:16,843 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 00:40:17,063 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:17,063 INFO : Inserting sp|O76003|GLRX3_HUMAN
15 Dec 2023 00:40:17,222 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:17,222 INFO : Inserting sp|O76031|CLPX_HUMAN
15 Dec 2023 00:40:17,239 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,239 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 00:40:17,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,257 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 00:40:17,295 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,295 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 00:40:17,465 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:17,465 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 00:40:17,589 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:17,589 INFO : Inserting sp|O94905|ERLN2_HUMAN
15 Dec 2023 00:40:17,627 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,627 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 00:40:17,645 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,645 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 00:40:17,685 INFO : 5% Done
15 Dec 2023 00:40:17,709 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:17,709 INFO : Inserting sp|O94973|AP2A2_HUMAN
15 Dec 2023 00:40:17,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:17,744 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 00:40:17,966 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:17,966 INFO : Inserting sp|O95185|UNC5C_HUMAN
15 Dec 2023 00:40:18,042 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:18,043 INFO : Inserting sp|O95196|CSPG5_HUMAN
15 Dec 2023 00:40:18,075 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,075 INFO : Inserting sp|O95202|LETM1_HUMAN
15 Dec 2023 00:40:18,109 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,109 INFO : Inserting sp|O95206|PCDH8_HUMAN
15 Dec 2023 00:40:18,163 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,163 INFO : Inserting sp|O95373|IPO7_HUMAN
15 Dec 2023 00:40:18,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,196 INFO : Inserting sp|O95428|PPN_HUMAN
15 Dec 2023 00:40:18,224 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:18,224 INFO : Inserting sp|O95433|AHSA1_HUMAN
15 Dec 2023 00:40:18,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,257 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 00:40:18,306 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:18,306 INFO : Inserting sp|O95466|FMNL1_HUMAN
15 Dec 2023 00:40:18,388 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:18,388 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 00:40:18,431 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:18,431 INFO : Inserting sp|O95613|PCNT_HUMAN
15 Dec 2023 00:40:18,466 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,466 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 00:40:18,482 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,482 INFO : Inserting sp|O95670|VATG2_HUMAN
15 Dec 2023 00:40:18,514 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:18,514 INFO : Inserting sp|O95747|OXSR1_HUMAN
15 Dec 2023 00:40:18,557 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:18,557 INFO : Inserting sp|O95758|PTBP3_HUMAN
15 Dec 2023 00:40:18,591 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,591 INFO : Inserting sp|O95782|AP2A1_HUMAN
15 Dec 2023 00:40:18,621 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,621 INFO : Inserting sp|O95831|AIFM1_HUMAN
15 Dec 2023 00:40:18,653 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,653 INFO : Inserting sp|O95865|DDAH2_HUMAN
15 Dec 2023 00:40:18,697 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,697 INFO : Inserting sp|O95922|TTLL1_HUMAN
15 Dec 2023 00:40:18,730 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,730 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 00:40:18,799 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:18,799 INFO : Inserting sp|O95989|NUDT3_HUMAN
15 Dec 2023 00:40:18,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,852 INFO : Inserting sp|O95998|I18BP_HUMAN
15 Dec 2023 00:40:18,884 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,884 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 00:40:18,908 INFO : 6% Done
15 Dec 2023 00:40:18,983 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:18,983 INFO : Inserting sp|P00367|DHE3_HUMAN
15 Dec 2023 00:40:18,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:18,999 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 00:40:19,032 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:19,033 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 00:40:19,376 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:40:19,376 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 00:40:19,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:19,408 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 00:40:19,422 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:19,422 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 00:40:19,508 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:19,508 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 00:40:19,539 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:19,539 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 00:40:19,553 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:19,553 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 00:40:19,779 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:19,779 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 00:40:19,847 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:19,847 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 00:40:20,009 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:20,009 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 00:40:20,084 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:20,084 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 00:40:20,383 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:20,383 INFO : Inserting sp|P00813|ADA_HUMAN
15 Dec 2023 00:40:20,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:20,414 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 00:40:20,596 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:20,596 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 00:40:20,808 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:20,808 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 00:40:21,077 INFO : 7% Done
15 Dec 2023 00:40:21,360 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:40:21,360 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 00:40:21,635 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:21,635 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 00:40:21,914 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:21,914 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 00:40:22,133 INFO : 8% Done
15 Dec 2023 00:40:23,460 INFO : 9% Done
15 Dec 2023 00:40:24,023 DEBUG: Inserted 50 peptides
15 Dec 2023 00:40:24,381 DEBUG: Total peptides inserted: 58
15 Dec 2023 00:40:24,381 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 00:40:24,661 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:24,661 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 00:40:24,745 INFO : 10% Done
15 Dec 2023 00:40:24,839 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:24,839 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 00:40:24,903 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:24,903 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 00:40:25,066 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:25,066 INFO : Inserting sp|P01137|TGFB1_HUMAN
15 Dec 2023 00:40:25,096 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:25,096 INFO : Inserting sp|P01178|NEU1_HUMAN
15 Dec 2023 00:40:25,131 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:25,131 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 00:40:25,337 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:25,337 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 00:40:25,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:25,353 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 00:40:25,368 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:25,368 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 00:40:25,486 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:25,487 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 00:40:25,605 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:25,605 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 00:40:25,635 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:25,635 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 00:40:25,651 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:25,651 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 00:40:25,724 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:25,724 INFO : Inserting sp|P02100|HBE_HUMAN
15 Dec 2023 00:40:25,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:25,828 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 00:40:26,057 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:26,058 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 00:40:26,078 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:26,079 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 00:40:26,314 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:26,315 INFO : Inserting sp|P02538|K2C6A_HUMAN
15 Dec 2023 00:40:26,531 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:26,531 INFO : Inserting sp|P02545|LMNA_HUMAN
15 Dec 2023 00:40:26,819 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:26,819 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 00:40:26,930 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:26,930 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 00:40:27,239 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:27,239 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 00:40:27,250 INFO : 11% Done
15 Dec 2023 00:40:27,862 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:40:27,862 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 00:40:27,997 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:27,998 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 00:40:28,032 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:28,032 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 00:40:28,064 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:28,065 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 00:40:28,352 INFO : 12% Done
15 Dec 2023 00:40:28,406 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:28,406 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 00:40:28,525 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:28,525 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 00:40:28,617 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:28,617 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 00:40:28,680 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:28,680 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 00:40:28,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:28,716 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 00:40:28,751 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:28,751 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 00:40:28,900 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:28,900 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 00:40:28,956 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:28,957 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 00:40:29,020 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:29,020 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 00:40:29,194 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:29,194 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 00:40:29,382 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:29,383 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 00:40:29,488 INFO : 13% Done
15 Dec 2023 00:40:29,533 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:29,533 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 00:40:29,678 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:29,678 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 00:40:29,926 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:29,926 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 00:40:30,925 INFO : 14% Done
15 Dec 2023 00:40:31,666 DEBUG: Total peptides inserted: 39
15 Dec 2023 00:40:31,666 INFO : Imported 200 peptide groups.
15 Dec 2023 00:40:31,666 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 00:40:32,153 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:40:32,153 INFO : Inserting sp|P02775|CXCL7_HUMAN
15 Dec 2023 00:40:32,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:32,225 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 00:40:32,240 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:32,241 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 00:40:32,406 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:32,406 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 00:40:32,508 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:32,508 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 00:40:32,964 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:40:32,964 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 00:40:33,034 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:33,034 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 00:40:33,174 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:33,175 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 00:40:33,264 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:33,264 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 00:40:33,317 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:33,317 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 00:40:33,386 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:33,386 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 00:40:33,403 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:33,403 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 00:40:33,484 INFO : 15% Done
15 Dec 2023 00:40:33,697 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:33,697 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 00:40:33,950 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:33,950 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 00:40:34,579 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:40:34,579 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 00:40:34,607 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:34,607 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 00:40:34,641 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:34,642 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 00:40:34,699 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:34,700 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 00:40:34,768 INFO : 16% Done
15 Dec 2023 00:40:34,813 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:34,813 INFO : Inserting sp|P04259|K2C6B_HUMAN
15 Dec 2023 00:40:35,029 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:35,029 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 00:40:35,517 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:40:35,517 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 00:40:35,681 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:35,681 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 00:40:35,727 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:35,727 INFO : Inserting sp|P04424|ARLY_HUMAN
15 Dec 2023 00:40:35,760 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,760 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 00:40:35,842 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:35,842 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 00:40:35,870 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,870 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 00:40:35,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,885 INFO : Inserting sp|P04792|HSPB1_HUMAN
15 Dec 2023 00:40:35,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,899 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 00:40:35,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,913 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 00:40:35,921 INFO : 17% Done
15 Dec 2023 00:40:35,947 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:35,947 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 00:40:36,032 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:36,032 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 00:40:36,169 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:36,169 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 00:40:36,263 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:36,263 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 00:40:36,377 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:36,377 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 00:40:36,885 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:40:36,885 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 00:40:37,075 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:37,075 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 00:40:37,116 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:37,117 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 00:40:37,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:37,137 INFO : Inserting sp|P05091|ALDH2_HUMAN
15 Dec 2023 00:40:37,163 INFO : 18% Done
15 Dec 2023 00:40:37,182 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:37,182 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 00:40:37,404 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:37,404 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 00:40:37,563 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:37,563 INFO : Inserting sp|P05120|PAI2_HUMAN
15 Dec 2023 00:40:37,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:37,626 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 00:40:37,686 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:37,686 INFO : Inserting sp|P05141|ADT2_HUMAN
15 Dec 2023 00:40:37,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:37,705 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 00:40:37,787 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:37,787 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 00:40:38,164 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:38,164 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 00:40:38,396 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:38,396 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 00:40:38,515 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:38,515 INFO : Inserting sp|P05186|PPBT_HUMAN
15 Dec 2023 00:40:38,530 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:38,530 INFO : Inserting sp|P05198|IF2A_HUMAN
15 Dec 2023 00:40:38,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:38,566 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 00:40:38,586 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:38,586 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 00:40:38,660 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:38,660 INFO : Inserting sp|P05413|FABPH_HUMAN
15 Dec 2023 00:40:38,730 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:38,730 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 00:40:38,771 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:38,771 INFO : Inserting sp|P05455|LA_HUMAN
15 Dec 2023 00:40:38,943 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:38,943 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 00:40:39,056 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:39,056 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 00:40:39,206 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:39,207 INFO : Inserting sp|P05771|KPCB_HUMAN
15 Dec 2023 00:40:39,221 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:39,221 INFO : Inserting sp|P05787|K2C8_HUMAN
15 Dec 2023 00:40:39,403 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:39,403 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 00:40:39,417 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:39,417 INFO : Inserting sp|P05976|MYL1_HUMAN
15 Dec 2023 00:40:39,434 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:39,434 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 00:40:39,480 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:39,480 INFO : Inserting sp|P06239|LCK_HUMAN
15 Dec 2023 00:40:39,497 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:39,497 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 00:40:39,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:39,531 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 00:40:39,740 INFO : 19% Done
15 Dec 2023 00:40:39,762 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:39,762 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 00:40:40,005 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:40,005 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 00:40:40,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:40,055 INFO : Inserting sp|P06703|S10A6_HUMAN
15 Dec 2023 00:40:40,155 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:40,155 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 00:40:40,445 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:40,445 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 00:40:40,710 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:40,710 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 00:40:40,863 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:40,863 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 00:40:40,887 INFO : 20% Done
15 Dec 2023 00:40:40,984 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:40,984 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 00:40:41,095 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:41,095 INFO : Inserting sp|P06753|TPM3_HUMAN
15 Dec 2023 00:40:41,278 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:41,278 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 00:40:41,362 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:41,363 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 00:40:41,484 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:41,484 INFO : Inserting sp|P07197|NFM_HUMAN
15 Dec 2023 00:40:41,773 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:41,773 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 00:40:41,981 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:41,981 INFO : Inserting sp|P07305|H10_HUMAN
15 Dec 2023 00:40:41,996 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:41,997 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 00:40:42,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:42,029 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 00:40:42,035 INFO : 21% Done
15 Dec 2023 00:40:42,070 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:42,070 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 00:40:42,257 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:42,257 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 00:40:42,463 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:42,463 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 00:40:42,659 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:42,659 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 00:40:42,796 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:42,796 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 00:40:42,815 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:42,815 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 00:40:42,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:42,831 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 00:40:42,905 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:42,905 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 00:40:42,999 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:42,999 INFO : Inserting sp|P07814|SYEP_HUMAN
15 Dec 2023 00:40:43,128 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:43,128 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 00:40:43,144 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:43,144 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 00:40:43,154 INFO : 22% Done
15 Dec 2023 00:40:43,564 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:40:43,565 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 00:40:43,922 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:40:43,922 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 00:40:43,995 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:43,995 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 00:40:44,243 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:44,243 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 00:40:44,266 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:44,266 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 00:40:44,406 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:44,407 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 00:40:44,660 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:44,660 INFO : Inserting sp|P08134|RHOC_HUMAN
15 Dec 2023 00:40:44,680 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:44,680 INFO : Inserting sp|P08174|DAF_HUMAN
15 Dec 2023 00:40:44,756 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:44,756 INFO : Imported 300 peptide groups.
15 Dec 2023 00:40:44,756 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 00:40:44,808 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:44,808 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 00:40:44,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:44,867 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 00:40:45,210 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:45,210 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 00:40:45,347 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:45,347 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 00:40:45,424 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:45,424 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 00:40:45,463 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:45,463 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 00:40:45,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:45,480 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 00:40:45,532 INFO : 23% Done
15 Dec 2023 00:40:45,656 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:45,656 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 00:40:45,864 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:45,864 INFO : Inserting sp|P08590|MYL3_HUMAN
15 Dec 2023 00:40:45,879 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:45,879 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 00:40:46,008 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:40:46,008 INFO : Inserting sp|P08631|HCK_HUMAN
15 Dec 2023 00:40:46,035 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:46,035 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 00:40:46,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:46,056 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 00:40:46,329 INFO : 24% Done
15 Dec 2023 00:40:46,447 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:40:46,447 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 00:40:46,661 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:46,661 INFO : Inserting sp|P08729|K2C7_HUMAN
15 Dec 2023 00:40:46,742 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:46,742 INFO : Inserting sp|P08754|GNAI3_HUMAN
15 Dec 2023 00:40:46,776 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:46,776 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 00:40:46,840 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:46,840 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 00:40:46,979 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:46,979 INFO : Inserting sp|P08962|CD63_HUMAN
15 Dec 2023 00:40:46,999 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:46,999 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 00:40:47,049 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,049 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 00:40:47,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:47,084 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 00:40:47,105 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,105 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 00:40:47,127 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,127 INFO : Inserting sp|P09455|RET1_HUMAN
15 Dec 2023 00:40:47,163 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,163 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 00:40:47,173 INFO : 25% Done
15 Dec 2023 00:40:47,200 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,201 INFO : Inserting sp|P09496|CLCA_HUMAN
15 Dec 2023 00:40:47,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:47,223 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 00:40:47,323 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:47,324 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 00:40:47,365 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:47,365 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 00:40:47,404 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:47,404 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 00:40:47,431 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:47,431 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 00:40:47,490 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:47,490 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 00:40:47,540 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:47,540 INFO : Inserting sp|P09874|PARP1_HUMAN
15 Dec 2023 00:40:47,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:47,554 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 00:40:47,624 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:47,624 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 00:40:47,713 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:47,713 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 00:40:47,776 INFO : 26% Done
15 Dec 2023 00:40:48,139 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:40:48,139 INFO : Inserting sp|P0C0S5|H2AZ_HUMAN
15 Dec 2023 00:40:48,193 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:48,193 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 00:40:48,255 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:48,255 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 00:40:48,323 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:48,323 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 00:40:48,531 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:40:48,532 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 00:40:48,550 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:48,550 INFO : Inserting sp|P0DMM9|ST1A3_HUMAN
15 Dec 2023 00:40:48,563 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:48,563 INFO : Inserting sp|P0DMN0|ST1A4_HUMAN
15 Dec 2023 00:40:48,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:48,575 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 00:40:48,690 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:48,690 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 00:40:48,798 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:48,798 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 00:40:48,841 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:48,842 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 00:40:48,885 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:48,885 INFO : Inserting sp|P0DP23|CALM1_HUMAN
15 Dec 2023 00:40:48,912 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:48,912 INFO : Inserting sp|P0DP24|CALM2_HUMAN
15 Dec 2023 00:40:48,943 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:48,943 INFO : Inserting sp|P0DP25|CALM3_HUMAN
15 Dec 2023 00:40:48,961 INFO : 27% Done
15 Dec 2023 00:40:48,972 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:48,972 INFO : Inserting sp|P0DTE7|AMY1B_HUMAN
15 Dec 2023 00:40:48,986 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:48,986 INFO : Inserting sp|P0DTE8|AMY1C_HUMAN
15 Dec 2023 00:40:48,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:48,999 INFO : Inserting sp|P0DUB6|AMY1A_HUMAN
15 Dec 2023 00:40:49,011 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:49,011 INFO : Inserting sp|P10145|IL8_HUMAN
15 Dec 2023 00:40:49,031 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:49,031 INFO : Inserting sp|P10155|RO60_HUMAN
15 Dec 2023 00:40:49,041 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:49,042 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 00:40:49,061 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:49,061 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 00:40:49,096 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:49,096 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 00:40:49,245 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:49,245 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 00:40:49,286 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:49,286 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 00:40:49,512 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:40:49,512 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 00:40:49,549 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:49,550 INFO : Inserting sp|P10645|CMGA_HUMAN
15 Dec 2023 00:40:49,585 INFO : 28% Done
15 Dec 2023 00:40:49,639 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:49,639 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 00:40:49,679 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:49,679 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 00:40:49,827 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:49,827 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 00:40:49,903 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:49,903 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 00:40:50,105 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:40:50,106 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 00:40:50,139 INFO : 29% Done
15 Dec 2023 00:40:50,206 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:50,206 INFO : Inserting sp|P11166|GTR1_HUMAN
15 Dec 2023 00:40:50,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:50,225 INFO : Inserting sp|P11171|EPB41_HUMAN
15 Dec 2023 00:40:50,243 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:50,243 INFO : Inserting sp|P11177|ODPB_HUMAN
15 Dec 2023 00:40:50,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:50,264 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 00:40:50,276 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:50,276 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 00:40:50,296 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:50,296 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 00:40:50,422 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:50,423 INFO : Inserting sp|P11310|ACADM_HUMAN
15 Dec 2023 00:40:50,438 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:50,438 INFO : Inserting sp|P11387|TOP1_HUMAN
15 Dec 2023 00:40:50,484 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:50,484 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 00:40:50,569 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:50,569 INFO : Inserting sp|P11586|C1TC_HUMAN
15 Dec 2023 00:40:50,644 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:50,645 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 00:40:50,758 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:50,758 INFO : Inserting sp|P11940|PABP1_HUMAN
15 Dec 2023 00:40:50,828 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:50,829 INFO : Inserting sp|P12081|HARS1_HUMAN
15 Dec 2023 00:40:50,898 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:50,898 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 00:40:50,934 INFO : 30% Done
15 Dec 2023 00:40:50,971 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:50,971 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 00:40:51,063 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:51,063 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 00:40:51,244 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:40:51,244 INFO : Inserting sp|P12235|ADT1_HUMAN
15 Dec 2023 00:40:51,260 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:51,260 INFO : Inserting sp|P12236|ADT3_HUMAN
15 Dec 2023 00:40:51,275 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:51,275 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 00:40:51,447 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:51,447 INFO : Inserting sp|P12268|IMDH2_HUMAN
15 Dec 2023 00:40:51,472 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:51,472 INFO : Inserting sp|P12270|TPR_HUMAN
15 Dec 2023 00:40:51,499 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:51,499 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 00:40:51,570 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:51,570 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 00:40:51,667 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:51,667 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 00:40:51,718 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:51,718 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 00:40:51,827 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:51,827 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 00:40:51,867 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:51,867 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 00:40:51,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:51,888 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 00:40:51,990 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:51,990 INFO : Inserting sp|P13521|SCG2_HUMAN
15 Dec 2023 00:40:52,085 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:52,086 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 00:40:52,216 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:52,216 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 00:40:52,261 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:52,261 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 00:40:52,288 INFO : 31% Done
15 Dec 2023 00:40:52,324 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:52,324 INFO : Imported 400 peptide groups.
15 Dec 2023 00:40:52,324 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 00:40:52,554 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:40:52,555 INFO : Inserting sp|P13646|K1C13_HUMAN
15 Dec 2023 00:40:52,633 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:52,633 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 00:40:52,707 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:52,707 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 00:40:52,732 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:52,732 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 00:40:52,798 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:52,798 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 00:40:52,806 INFO : 32% Done
15 Dec 2023 00:40:53,055 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:40:53,055 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 00:40:53,092 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:53,092 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 00:40:53,109 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:53,109 INFO : Inserting sp|P13861|KAP2_HUMAN
15 Dec 2023 00:40:53,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:53,120 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 00:40:53,231 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:53,232 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 00:40:53,304 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:53,304 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 00:40:53,343 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:53,343 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 00:40:53,370 INFO : 33% Done
15 Dec 2023 00:40:53,400 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:53,400 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 00:40:53,439 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:53,439 INFO : Inserting sp|P14324|FPPS_HUMAN
15 Dec 2023 00:40:53,450 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:53,450 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 00:40:53,503 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:53,503 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 00:40:53,534 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:53,534 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 00:40:53,572 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:53,572 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 00:40:53,660 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:40:53,660 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 00:40:53,707 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:53,707 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 00:40:53,760 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:53,761 INFO : Inserting sp|P14927|QCR7_HUMAN
15 Dec 2023 00:40:53,773 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:53,773 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 00:40:53,792 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:53,792 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 00:40:53,848 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:53,848 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 00:40:53,888 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:53,889 INFO : Inserting sp|P15260|INGR1_HUMAN
15 Dec 2023 00:40:53,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:53,900 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 00:40:53,964 INFO : 34% Done
15 Dec 2023 00:40:54,005 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:54,005 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 00:40:54,035 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,035 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 00:40:54,051 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,051 INFO : Inserting sp|P15924|DESP_HUMAN
15 Dec 2023 00:40:54,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,071 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 00:40:54,104 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:54,104 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 00:40:54,136 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:54,136 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 00:40:54,187 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:54,188 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 00:40:54,203 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,204 INFO : Inserting sp|P16278|BGAL_HUMAN
15 Dec 2023 00:40:54,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,220 INFO : Inserting sp|P16298|PP2BB_HUMAN
15 Dec 2023 00:40:54,256 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,256 INFO : Inserting sp|P16519|NEC2_HUMAN
15 Dec 2023 00:40:54,284 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,284 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 00:40:54,331 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:54,331 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 00:40:54,378 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:54,378 INFO : Inserting sp|P16949|STMN1_HUMAN
15 Dec 2023 00:40:54,405 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,405 INFO : Inserting sp|P17252|KPCA_HUMAN
15 Dec 2023 00:40:54,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,415 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 00:40:54,441 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:54,441 INFO : Inserting sp|P17677|NEUM_HUMAN
15 Dec 2023 00:40:54,460 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,460 INFO : Inserting sp|P17844|DDX5_HUMAN
15 Dec 2023 00:40:54,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,477 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 00:40:54,497 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,497 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 00:40:54,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,509 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 00:40:54,531 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,532 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 00:40:54,718 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:40:54,718 INFO : Inserting sp|P18621|RL17_HUMAN
15 Dec 2023 00:40:54,730 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,730 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 00:40:54,767 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,767 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 00:40:54,777 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:54,777 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 00:40:54,808 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:54,808 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 00:40:54,830 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:54,830 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 00:40:54,882 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:54,882 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 00:40:54,954 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:54,954 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 00:40:55,009 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:55,009 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 00:40:55,077 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:55,077 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 00:40:55,181 INFO : 35% Done
15 Dec 2023 00:40:55,242 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:40:55,242 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 00:40:55,350 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:55,350 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 00:40:55,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,363 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 00:40:55,414 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:55,414 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 00:40:55,431 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,431 INFO : Inserting sp|P20042|IF2B_HUMAN
15 Dec 2023 00:40:55,447 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,447 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 00:40:55,464 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,464 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 00:40:55,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,480 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 00:40:55,495 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,495 INFO : Inserting sp|P20138|CD33_HUMAN
15 Dec 2023 00:40:55,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,511 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 00:40:55,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:55,524 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 00:40:55,576 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:55,576 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 00:40:55,638 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:55,638 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 00:40:55,781 INFO : 36% Done
15 Dec 2023 00:40:55,829 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:40:55,829 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 00:40:55,904 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:55,904 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 00:40:55,926 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:55,926 INFO : Inserting sp|P20810|ICAL_HUMAN
15 Dec 2023 00:40:56,034 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:56,034 INFO : Inserting sp|P20827|EFNA1_HUMAN
15 Dec 2023 00:40:56,049 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,049 INFO : Inserting sp|P20839|IMDH1_HUMAN
15 Dec 2023 00:40:56,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,065 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 00:40:56,115 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:56,115 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 00:40:56,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,130 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 00:40:56,142 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,142 INFO : Inserting sp|P21283|VATC1_HUMAN
15 Dec 2023 00:40:56,169 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:56,169 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 00:40:56,369 INFO : 37% Done
15 Dec 2023 00:40:56,399 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:40:56,399 INFO : Inserting sp|P21399|ACOHC_HUMAN
15 Dec 2023 00:40:56,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,414 INFO : Inserting sp|P21579|SYT1_HUMAN
15 Dec 2023 00:40:56,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,435 INFO : Inserting sp|P21757|MSRE_HUMAN
15 Dec 2023 00:40:56,445 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,446 INFO : Inserting sp|P21980|TGM2_HUMAN
15 Dec 2023 00:40:56,464 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:56,465 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 00:40:56,512 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:56,512 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 00:40:56,639 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:56,639 INFO : Inserting sp|P22223|CADH3_HUMAN
15 Dec 2023 00:40:56,663 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,663 INFO : Inserting sp|P22304|IDS_HUMAN
15 Dec 2023 00:40:56,677 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,677 INFO : Inserting sp|P22307|SCP2_HUMAN
15 Dec 2023 00:40:56,707 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:56,707 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 00:40:56,758 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:56,759 INFO : Inserting sp|P22607|FGFR3_HUMAN
15 Dec 2023 00:40:56,775 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,775 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 00:40:56,805 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:56,805 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 00:40:56,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,827 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 00:40:56,845 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:56,845 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 00:40:56,896 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:56,896 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 00:40:56,940 INFO : 38% Done
15 Dec 2023 00:40:56,951 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:56,951 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 00:40:57,098 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:40:57,098 INFO : Inserting sp|P23246|SFPQ_HUMAN
15 Dec 2023 00:40:57,156 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:57,156 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 00:40:57,176 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,176 INFO : Imported 500 peptide groups.
15 Dec 2023 00:40:57,177 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 00:40:57,210 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:57,210 INFO : Inserting sp|P23396|RS3_HUMAN
15 Dec 2023 00:40:57,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:57,228 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 00:40:57,253 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,253 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 00:40:57,280 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:57,280 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 00:40:57,373 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:57,374 INFO : Inserting sp|P23582|ANFC_HUMAN
15 Dec 2023 00:40:57,408 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,408 INFO : Inserting sp|P23634|AT2B4_HUMAN
15 Dec 2023 00:40:57,449 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,450 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 00:40:57,606 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:40:57,606 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 00:40:57,661 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:57,661 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 00:40:57,719 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:57,719 INFO : Inserting sp|P25024|CXCR1_HUMAN
15 Dec 2023 00:40:57,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:57,736 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 00:40:57,819 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:57,819 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 00:40:57,880 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:57,880 INFO : Inserting sp|P25391|LAMA1_HUMAN
15 Dec 2023 00:40:57,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:57,901 INFO : Inserting sp|P25445|TNR6_HUMAN
15 Dec 2023 00:40:57,918 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:57,918 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 00:40:57,953 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,953 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 00:40:57,997 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:57,997 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 00:40:58,026 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:58,026 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 00:40:58,089 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:58,089 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 00:40:58,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,108 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 00:40:58,389 INFO : 39% Done
15 Dec 2023 00:40:58,561 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:40:58,561 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 00:40:58,583 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:58,583 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 00:40:58,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,608 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 00:40:58,633 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,633 INFO : Inserting sp|P26639|SYTC_HUMAN
15 Dec 2023 00:40:58,649 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,649 INFO : Inserting sp|P26640|SYVC_HUMAN
15 Dec 2023 00:40:58,677 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:58,677 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 00:40:58,699 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,699 INFO : Inserting sp|P26951|IL3RA_HUMAN
15 Dec 2023 00:40:58,712 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,712 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 00:40:58,745 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:58,745 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 00:40:58,769 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,769 INFO : Inserting sp|P27694|RFA1_HUMAN
15 Dec 2023 00:40:58,786 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,786 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 00:40:58,868 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:58,868 INFO : Inserting sp|P27701|CD82_HUMAN
15 Dec 2023 00:40:58,886 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:58,887 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 00:40:58,992 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:40:58,993 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 00:40:59,068 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:59,068 INFO : Inserting sp|P27930|IL1R2_HUMAN
15 Dec 2023 00:40:59,111 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,112 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 00:40:59,129 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,129 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 00:40:59,167 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:59,168 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 00:40:59,186 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,186 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 00:40:59,204 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,205 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 00:40:59,215 INFO : 40% Done
15 Dec 2023 00:40:59,226 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,227 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 00:40:59,277 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:59,277 INFO : Inserting sp|P28907|CD38_HUMAN
15 Dec 2023 00:40:59,293 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,293 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 00:40:59,320 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:59,320 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 00:40:59,384 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:59,384 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 00:40:59,416 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:59,416 INFO : Inserting sp|P29590|PML_HUMAN
15 Dec 2023 00:40:59,466 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:59,466 INFO : Inserting sp|P29966|MARCS_HUMAN
15 Dec 2023 00:40:59,537 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:40:59,537 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 00:40:59,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,551 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 00:40:59,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,572 INFO : Inserting sp|P30049|ATPD_HUMAN
15 Dec 2023 00:40:59,603 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:59,603 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 00:40:59,615 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,615 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 00:40:59,631 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,632 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 00:40:59,680 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:40:59,680 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 00:40:59,740 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:40:59,740 INFO : Inserting sp|P30273|FCERG_HUMAN
15 Dec 2023 00:40:59,771 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:40:59,772 INFO : Inserting sp|P30622|CLIP1_HUMAN
15 Dec 2023 00:40:59,862 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:59,862 INFO : Inserting sp|P30626|SORCN_HUMAN
15 Dec 2023 00:40:59,879 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:40:59,880 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 00:40:59,900 INFO : 41% Done
15 Dec 2023 00:40:59,942 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:40:59,942 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 00:41:00,060 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:00,061 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 00:41:00,098 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:00,098 INFO : Inserting sp|P31943|HNRH1_HUMAN
15 Dec 2023 00:41:00,117 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,117 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 00:41:00,159 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:00,159 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 00:41:00,221 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:00,221 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 00:41:00,247 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:00,248 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 00:41:00,293 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:00,294 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 00:41:00,305 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,305 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 00:41:00,348 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:00,348 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 00:41:00,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,364 INFO : Inserting sp|P33151|CADH5_HUMAN
15 Dec 2023 00:41:00,379 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,379 INFO : Inserting sp|P33176|KINH_HUMAN
15 Dec 2023 00:41:00,406 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:00,406 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 00:41:00,532 INFO : 42% Done
15 Dec 2023 00:41:00,550 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:00,550 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 00:41:00,592 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:00,592 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 00:41:00,699 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:00,699 INFO : Inserting sp|P34949|MPI_HUMAN
15 Dec 2023 00:41:00,711 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,711 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 00:41:00,722 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,722 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 00:41:00,746 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:00,746 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 00:41:00,784 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:00,784 INFO : Inserting sp|P35318|ADML_HUMAN
15 Dec 2023 00:41:00,794 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,794 INFO : Inserting sp|P35354|PGH2_HUMAN
15 Dec 2023 00:41:00,805 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,805 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 00:41:00,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:00,834 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 00:41:00,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:00,852 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 00:41:00,963 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:00,963 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 00:41:01,177 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:41:01,177 INFO : Inserting sp|P35556|FBN2_HUMAN
15 Dec 2023 00:41:01,194 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:01,194 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 00:41:01,682 INFO : 43% Done
15 Dec 2023 00:41:02,092 DEBUG: Inserted 50 peptides
15 Dec 2023 00:41:02,185 INFO : 44% Done
15 Dec 2023 00:41:02,469 DEBUG: Total peptides inserted: 71
15 Dec 2023 00:41:02,469 INFO : Inserting sp|P35580|MYH10_HUMAN
15 Dec 2023 00:41:02,537 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:02,537 INFO : Inserting sp|P35609|ACTN2_HUMAN
15 Dec 2023 00:41:02,561 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:02,561 INFO : Inserting sp|P35611|ADDA_HUMAN
15 Dec 2023 00:41:02,577 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:02,577 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 00:41:02,639 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:02,639 INFO : Inserting sp|P35637|FUS_HUMAN
15 Dec 2023 00:41:02,651 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:02,652 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 00:41:02,728 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:02,728 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 00:41:02,750 INFO : 45% Done
15 Dec 2023 00:41:02,823 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:02,823 INFO : Inserting sp|P36507|MP2K2_HUMAN
15 Dec 2023 00:41:02,839 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:02,839 INFO : Inserting sp|P36543|VATE1_HUMAN
15 Dec 2023 00:41:02,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:02,850 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 00:41:02,902 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:02,902 INFO : Inserting sp|P36873|PP1G_HUMAN
15 Dec 2023 00:41:02,919 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:02,919 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 00:41:03,079 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:03,080 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 00:41:03,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,096 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 00:41:03,194 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:03,194 INFO : Imported 600 peptide groups.
15 Dec 2023 00:41:03,194 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 00:41:03,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,215 INFO : Inserting sp|P38646|GRP75_HUMAN
15 Dec 2023 00:41:03,227 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,227 INFO : Inserting sp|P39019|RS19_HUMAN
15 Dec 2023 00:41:03,241 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,241 INFO : Inserting sp|P39023|RL3_HUMAN
15 Dec 2023 00:41:03,262 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,262 INFO : Inserting sp|P39656|OST48_HUMAN
15 Dec 2023 00:41:03,286 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,286 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 00:41:03,333 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,333 INFO : Inserting sp|P39748|FEN1_HUMAN
15 Dec 2023 00:41:03,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,352 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 00:41:03,376 INFO : 46% Done
15 Dec 2023 00:41:03,386 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,386 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 00:41:03,412 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,412 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 00:41:03,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,424 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 00:41:03,443 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,443 INFO : Inserting sp|P40939|ECHA_HUMAN
15 Dec 2023 00:41:03,476 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,476 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 00:41:03,533 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:03,533 INFO : Inserting sp|P41226|UBA7_HUMAN
15 Dec 2023 00:41:03,599 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,599 INFO : Inserting sp|P41227|NAA10_HUMAN
15 Dec 2023 00:41:03,619 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,619 INFO : Inserting sp|P41240|CSK_HUMAN
15 Dec 2023 00:41:03,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,636 INFO : Inserting sp|P41250|GARS_HUMAN
15 Dec 2023 00:41:03,679 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:03,679 INFO : Inserting sp|P41252|SYIC_HUMAN
15 Dec 2023 00:41:03,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,704 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 00:41:03,733 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,733 INFO : Inserting sp|P42229|STA5A_HUMAN
15 Dec 2023 00:41:03,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,758 INFO : Inserting sp|P42331|RHG25_HUMAN
15 Dec 2023 00:41:03,800 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:03,800 INFO : Inserting sp|P42566|EPS15_HUMAN
15 Dec 2023 00:41:03,845 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,845 INFO : Inserting sp|P42574|CASP3_HUMAN
15 Dec 2023 00:41:03,865 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:03,865 INFO : Inserting sp|P42677|RS27_HUMAN
15 Dec 2023 00:41:03,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,893 INFO : Inserting sp|P42768|WASP_HUMAN
15 Dec 2023 00:41:03,917 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,917 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 00:41:03,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:03,931 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 00:41:04,023 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:04,023 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 00:41:04,086 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:04,086 INFO : Inserting sp|P43243|MATR3_HUMAN
15 Dec 2023 00:41:04,112 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,112 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 00:41:04,124 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,124 INFO : Inserting sp|P43487|RANG_HUMAN
15 Dec 2023 00:41:04,146 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,146 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 00:41:04,166 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,166 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 00:41:04,301 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:04,301 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 00:41:04,327 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,327 INFO : Inserting sp|P46459|NSF_HUMAN
15 Dec 2023 00:41:04,354 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,354 INFO : Inserting sp|P46821|MAP1B_HUMAN
15 Dec 2023 00:41:04,389 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,389 INFO : Inserting sp|P46939|UTRN_HUMAN
15 Dec 2023 00:41:04,413 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,413 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 00:41:04,561 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:04,561 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 00:41:04,613 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:04,613 INFO : Inserting sp|P47813|IF1AX_HUMAN
15 Dec 2023 00:41:04,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,628 INFO : Inserting sp|P48061|SDF1_HUMAN
15 Dec 2023 00:41:04,645 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,645 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 00:41:04,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,660 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 00:41:04,675 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,675 INFO : Inserting sp|P48553|TPC10_HUMAN
15 Dec 2023 00:41:04,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:04,698 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 00:41:04,734 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,734 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 00:41:04,743 INFO : 47% Done
15 Dec 2023 00:41:04,775 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,775 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 00:41:04,879 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:04,879 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 00:41:04,899 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,899 INFO : Inserting sp|P48739|PIPNB_HUMAN
15 Dec 2023 00:41:04,925 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:04,925 INFO : Inserting sp|P48745|CCN3_HUMAN
15 Dec 2023 00:41:05,000 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:05,000 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 00:41:05,025 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,025 INFO : Inserting sp|P49321|NASP_HUMAN
15 Dec 2023 00:41:05,066 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:05,066 INFO : Inserting sp|P49407|ARRB1_HUMAN
15 Dec 2023 00:41:05,092 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,092 INFO : Inserting sp|P49448|DHE4_HUMAN
15 Dec 2023 00:41:05,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,104 INFO : Inserting sp|P49589|SYCC_HUMAN
15 Dec 2023 00:41:05,151 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:05,151 INFO : Inserting sp|P49593|PPM1F_HUMAN
15 Dec 2023 00:41:05,175 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,175 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 00:41:05,253 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:05,253 INFO : Inserting sp|P49753|ACOT2_HUMAN
15 Dec 2023 00:41:05,293 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,293 INFO : Inserting sp|P49757|NUMB_HUMAN
15 Dec 2023 00:41:05,309 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,309 INFO : Inserting sp|P49789|FHIT_HUMAN
15 Dec 2023 00:41:05,339 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,339 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 00:41:05,367 INFO : 48% Done
15 Dec 2023 00:41:05,379 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,379 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 00:41:05,421 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:05,421 INFO : Inserting sp|P50135|HNMT_HUMAN
15 Dec 2023 00:41:05,439 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,439 INFO : Inserting sp|P50225|ST1A1_HUMAN
15 Dec 2023 00:41:05,451 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,451 INFO : Inserting sp|P50502|F10A1_HUMAN
15 Dec 2023 00:41:05,469 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,469 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 00:41:05,570 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:05,570 INFO : Inserting sp|P50570|DYN2_HUMAN
15 Dec 2023 00:41:05,618 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,618 INFO : Inserting sp|P50583|AP4A_HUMAN
15 Dec 2023 00:41:05,662 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,662 INFO : Inserting sp|P50895|BCAM_HUMAN
15 Dec 2023 00:41:05,694 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:05,695 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 00:41:05,769 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:05,769 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 00:41:05,805 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:05,805 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 00:41:05,892 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:05,892 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 00:41:05,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,913 INFO : Inserting sp|P51570|GALK1_HUMAN
15 Dec 2023 00:41:05,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,942 INFO : Inserting sp|P51572|BAP31_HUMAN
15 Dec 2023 00:41:05,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,962 INFO : Inserting sp|P51580|TPMT_HUMAN
15 Dec 2023 00:41:05,984 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:05,984 INFO : Inserting sp|P51606|RENBP_HUMAN
15 Dec 2023 00:41:06,003 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,004 INFO : Inserting sp|P51674|GPM6A_HUMAN
15 Dec 2023 00:41:06,023 INFO : 49% Done
15 Dec 2023 00:41:06,058 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:06,058 INFO : Inserting sp|P51692|STA5B_HUMAN
15 Dec 2023 00:41:06,087 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,087 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 00:41:06,202 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:06,202 INFO : Inserting sp|P51826|AFF3_HUMAN
15 Dec 2023 00:41:06,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,231 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 00:41:06,320 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:06,320 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 00:41:06,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,340 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 00:41:06,373 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,374 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 00:41:06,407 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,407 INFO : Inserting sp|P52272|HNRPM_HUMAN
15 Dec 2023 00:41:06,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,426 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 00:41:06,490 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:06,490 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 00:41:06,624 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:06,625 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 00:41:06,659 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,659 INFO : Inserting sp|P52823|STC1_HUMAN
15 Dec 2023 00:41:06,672 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,672 INFO : Inserting sp|P52888|THOP1_HUMAN
15 Dec 2023 00:41:06,690 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,690 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 00:41:06,700 INFO : 50% Done
15 Dec 2023 00:41:06,757 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,758 INFO : Inserting sp|P53985|MOT1_HUMAN
15 Dec 2023 00:41:06,770 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,771 INFO : Inserting sp|P53990|IST1_HUMAN
15 Dec 2023 00:41:06,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,795 INFO : Inserting sp|P53992|SC24C_HUMAN
15 Dec 2023 00:41:06,815 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,816 INFO : Inserting sp|P53999|TCP4_HUMAN
15 Dec 2023 00:41:06,828 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,828 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 00:41:06,849 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:06,849 INFO : Inserting sp|P54136|SYRC_HUMAN
15 Dec 2023 00:41:06,882 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:06,883 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 00:41:06,939 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,940 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 00:41:06,982 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:06,982 INFO : Imported 700 peptide groups.
15 Dec 2023 00:41:06,982 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 00:41:06,994 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:06,994 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 00:41:07,011 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,011 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 00:41:07,040 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,040 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 00:41:07,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,055 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 00:41:07,085 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,085 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 00:41:07,115 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,115 INFO : Inserting sp|P55010|IF5_HUMAN
15 Dec 2023 00:41:07,136 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,136 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 00:41:07,206 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,206 INFO : Inserting sp|P55060|XPO2_HUMAN
15 Dec 2023 00:41:07,241 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:07,241 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 00:41:07,460 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:41:07,460 INFO : Inserting sp|P55084|ECHB_HUMAN
15 Dec 2023 00:41:07,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,484 INFO : Inserting sp|P55145|MANF_HUMAN
15 Dec 2023 00:41:07,503 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,503 INFO : Inserting sp|P55265|DSRAD_HUMAN
15 Dec 2023 00:41:07,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,524 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 00:41:07,609 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:07,609 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 00:41:07,644 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:07,644 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 00:41:07,663 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,663 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 00:41:07,681 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,681 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 00:41:07,694 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,694 INFO : Inserting sp|P56377|AP1S2_HUMAN
15 Dec 2023 00:41:07,718 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,718 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 00:41:07,755 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:07,755 INFO : Inserting sp|P57087|JAM2_HUMAN
15 Dec 2023 00:41:07,774 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,774 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 00:41:07,798 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:07,799 INFO : Inserting sp|P57764|GSDMD_HUMAN
15 Dec 2023 00:41:07,813 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,813 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 00:41:07,823 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,823 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 00:41:07,858 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:07,858 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 00:41:07,869 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,869 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 00:41:07,887 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,887 INFO : Inserting sp|P60510|PP4C_HUMAN
15 Dec 2023 00:41:07,903 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:07,903 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 00:41:08,038 INFO : 51% Done
15 Dec 2023 00:41:08,048 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:08,048 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 00:41:08,064 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,064 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 00:41:08,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,080 INFO : Inserting sp|P61006|RAB8A_HUMAN
15 Dec 2023 00:41:08,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,092 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 00:41:08,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,103 INFO : Inserting sp|P61020|RAB5B_HUMAN
15 Dec 2023 00:41:08,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,119 INFO : Inserting sp|P61026|RAB10_HUMAN
15 Dec 2023 00:41:08,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,136 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 00:41:08,147 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,147 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 00:41:08,185 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:08,185 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 00:41:08,233 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:08,233 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 00:41:08,266 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:08,266 INFO : Inserting sp|P61221|ABCE1_HUMAN
15 Dec 2023 00:41:08,286 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,286 INFO : Inserting sp|P61254|RL26_HUMAN
15 Dec 2023 00:41:08,298 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,298 INFO : Inserting sp|P61313|RL15_HUMAN
15 Dec 2023 00:41:08,315 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,315 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 00:41:08,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,326 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 00:41:08,337 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,337 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 00:41:08,353 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,353 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 00:41:08,449 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:08,449 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 00:41:08,459 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,459 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 00:41:08,570 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:08,571 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 00:41:08,628 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:08,628 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 00:41:08,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,648 INFO : Inserting sp|P62241|RS8_HUMAN
15 Dec 2023 00:41:08,660 INFO : 52% Done
15 Dec 2023 00:41:08,716 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:08,716 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 00:41:08,788 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:08,788 INFO : Inserting sp|P62280|RS11_HUMAN
15 Dec 2023 00:41:08,813 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:08,813 INFO : Inserting sp|P62306|RUXF_HUMAN
15 Dec 2023 00:41:08,826 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,826 INFO : Inserting sp|P62316|SMD2_HUMAN
15 Dec 2023 00:41:08,854 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:08,854 INFO : Inserting sp|P62328|TYB4_HUMAN
15 Dec 2023 00:41:08,891 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:08,891 INFO : Inserting sp|P62491|RB11A_HUMAN
15 Dec 2023 00:41:08,917 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:08,917 INFO : Inserting sp|P62633|CNBP_HUMAN
15 Dec 2023 00:41:08,934 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,934 INFO : Inserting sp|P62753|RS6_HUMAN
15 Dec 2023 00:41:08,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:08,951 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 00:41:09,124 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:41:09,125 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 00:41:09,162 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:09,162 INFO : Inserting sp|P62857|RS28_HUMAN
15 Dec 2023 00:41:09,173 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,173 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 00:41:09,216 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:09,216 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 00:41:09,242 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:09,242 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 00:41:09,267 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:09,267 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 00:41:09,275 INFO : 53% Done
15 Dec 2023 00:41:09,285 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,286 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 00:41:09,315 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:09,315 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 00:41:09,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,328 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 00:41:09,372 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:09,372 INFO : Inserting sp|P63208|SKP1_HUMAN
15 Dec 2023 00:41:09,385 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,385 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 00:41:09,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,409 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 00:41:09,421 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,421 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 00:41:09,564 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:09,564 INFO : Inserting sp|P67936|TPM4_HUMAN
15 Dec 2023 00:41:09,640 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:09,640 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 00:41:09,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,656 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 00:41:09,714 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:09,714 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 00:41:09,779 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:09,779 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 00:41:09,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:09,795 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 00:41:09,850 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:09,850 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 00:41:09,873 INFO : 54% Done
15 Dec 2023 00:41:09,918 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:09,918 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 00:41:09,954 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:09,954 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 00:41:09,987 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:09,987 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 00:41:10,068 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,068 INFO : Inserting sp|P78318|IGBP1_HUMAN
15 Dec 2023 00:41:10,090 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,090 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 00:41:10,128 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:10,128 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 00:41:10,165 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,165 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 00:41:10,181 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,181 INFO : Inserting sp|P78509|RELN_HUMAN
15 Dec 2023 00:41:10,200 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,200 INFO : Inserting sp|P78536|ADA17_HUMAN
15 Dec 2023 00:41:10,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,220 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 00:41:10,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,236 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 00:41:10,284 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,284 INFO : Inserting sp|P80217|IN35_HUMAN
15 Dec 2023 00:41:10,308 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,308 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 00:41:10,342 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:10,342 INFO : Inserting sp|P80723|BASP1_HUMAN
15 Dec 2023 00:41:10,413 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:10,413 INFO : Inserting sp|P81605|DCD_HUMAN
15 Dec 2023 00:41:10,428 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,428 INFO : Inserting sp|P83916|CBX1_HUMAN
15 Dec 2023 00:41:10,478 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,478 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 00:41:10,511 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:10,511 INFO : Inserting sp|P84085|ARF5_HUMAN
15 Dec 2023 00:41:10,527 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,528 INFO : Inserting sp|P84243|H33_HUMAN
15 Dec 2023 00:41:10,576 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,576 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 00:41:10,589 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,589 INFO : Imported 800 peptide groups.
15 Dec 2023 00:41:10,590 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 00:41:10,623 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,623 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 00:41:10,736 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:10,736 INFO : Inserting sp|P98171|RHG04_HUMAN
15 Dec 2023 00:41:10,753 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,753 INFO : Inserting sp|Q00169|PIPNA_HUMAN
15 Dec 2023 00:41:10,767 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,767 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 00:41:10,839 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:10,839 INFO : Inserting sp|Q00688|FKBP3_HUMAN
15 Dec 2023 00:41:10,854 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:10,854 INFO : Inserting sp|Q00722|PLCB2_HUMAN
15 Dec 2023 00:41:10,886 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:10,886 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 00:41:10,924 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:10,924 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 00:41:11,044 INFO : 55% Done
15 Dec 2023 00:41:11,059 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:41:11,059 INFO : Inserting sp|Q01105|SET_HUMAN
15 Dec 2023 00:41:11,102 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:11,102 INFO : Inserting sp|Q01118|SCN7A_HUMAN
15 Dec 2023 00:41:11,115 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,115 INFO : Inserting sp|Q01130|SRSF2_HUMAN
15 Dec 2023 00:41:11,133 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,133 INFO : Inserting sp|Q01433|AMPD2_HUMAN
15 Dec 2023 00:41:11,155 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,155 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 00:41:11,172 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:11,172 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 00:41:11,240 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:11,240 INFO : Inserting sp|Q01844|EWS_HUMAN
15 Dec 2023 00:41:11,262 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:11,262 INFO : Inserting sp|Q01974|ROR2_HUMAN
15 Dec 2023 00:41:11,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,297 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 00:41:11,313 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,314 INFO : Inserting sp|Q02388|CO7A1_HUMAN
15 Dec 2023 00:41:11,354 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:11,354 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 00:41:11,379 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:11,379 INFO : Inserting sp|Q02750|MP2K1_HUMAN
15 Dec 2023 00:41:11,472 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:11,473 INFO : Inserting sp|Q02790|FKBP4_HUMAN
15 Dec 2023 00:41:11,516 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:11,517 INFO : Inserting sp|Q02817|MUC2_HUMAN
15 Dec 2023 00:41:11,535 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,535 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 00:41:11,632 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:11,632 INFO : Inserting sp|Q02878|RL6_HUMAN
15 Dec 2023 00:41:11,644 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,644 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 00:41:11,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,656 INFO : Inserting sp|Q03252|LMNB2_HUMAN
15 Dec 2023 00:41:11,700 INFO : 56% Done
15 Dec 2023 00:41:11,853 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:41:11,853 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 00:41:11,896 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:11,896 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 00:41:11,908 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:11,908 INFO : Inserting sp|Q04721|NOTC2_HUMAN
15 Dec 2023 00:41:11,953 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:11,953 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 00:41:12,019 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:12,019 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 00:41:12,078 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:12,078 INFO : Inserting sp|Q04941|PLP2_HUMAN
15 Dec 2023 00:41:12,090 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,090 INFO : Inserting sp|Q05209|PTN12_HUMAN
15 Dec 2023 00:41:12,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,108 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 00:41:12,126 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,126 INFO : Inserting sp|Q06124|PTN11_HUMAN
15 Dec 2023 00:41:12,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,138 INFO : Inserting sp|Q06210|GFPT1_HUMAN
15 Dec 2023 00:41:12,151 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,151 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 00:41:12,278 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:12,278 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 00:41:12,304 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:12,306 INFO : 57% Done
15 Dec 2023 00:41:12,306 INFO : Inserting sp|Q07065|CKAP4_HUMAN
15 Dec 2023 00:41:12,366 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:12,366 INFO : Inserting sp|Q07812|BAX_HUMAN
15 Dec 2023 00:41:12,388 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,388 INFO : Inserting sp|Q07866|KLC1_HUMAN
15 Dec 2023 00:41:12,404 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,405 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 00:41:12,528 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:12,528 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 00:41:12,558 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:12,558 INFO : Inserting sp|Q07960|RHG01_HUMAN
15 Dec 2023 00:41:12,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,572 INFO : Inserting sp|Q08043|ACTN3_HUMAN
15 Dec 2023 00:41:12,612 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:12,612 INFO : Inserting sp|Q08170|SRSF4_HUMAN
15 Dec 2023 00:41:12,635 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,635 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 00:41:12,723 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:12,723 INFO : Inserting sp|Q08623|HDHD1_HUMAN
15 Dec 2023 00:41:12,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,744 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 00:41:12,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,758 INFO : Inserting sp|Q08722|CD47_HUMAN
15 Dec 2023 00:41:12,776 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,776 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 00:41:12,804 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:12,804 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 00:41:12,826 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:12,826 INFO : Inserting sp|Q09161|NCBP1_HUMAN
15 Dec 2023 00:41:12,843 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:12,844 INFO : Inserting sp|Q09666|AHNK_HUMAN
15 Dec 2023 00:41:12,996 INFO : 58% Done
15 Dec 2023 00:41:13,196 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:41:13,196 INFO : Inserting sp|Q0VD83|APOBR_HUMAN
15 Dec 2023 00:41:13,396 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:41:13,396 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 00:41:13,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,408 INFO : Inserting sp|Q10472|GALT1_HUMAN
15 Dec 2023 00:41:13,438 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,439 INFO : Inserting sp|Q10567|AP1B1_HUMAN
15 Dec 2023 00:41:13,472 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,472 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 00:41:13,489 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,489 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 00:41:13,508 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,509 INFO : Inserting sp|Q12802|AKP13_HUMAN
15 Dec 2023 00:41:13,525 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,525 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 00:41:13,594 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:13,594 INFO : Inserting sp|Q12824|SNF5_HUMAN
15 Dec 2023 00:41:13,613 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,613 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 00:41:13,687 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:13,688 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 00:41:13,797 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:41:13,797 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 00:41:13,813 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,813 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 00:41:13,844 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,844 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 00:41:13,859 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,859 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 00:41:13,897 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,897 INFO : Inserting sp|Q12965|MYO1E_HUMAN
15 Dec 2023 00:41:13,918 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:13,918 INFO : Inserting sp|Q12986|NFX1_HUMAN
15 Dec 2023 00:41:13,936 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:13,936 INFO : Inserting sp|Q13153|PAK1_HUMAN
15 Dec 2023 00:41:13,972 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:13,972 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 00:41:14,019 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:14,020 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 00:41:14,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,038 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 00:41:14,114 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:14,115 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 00:41:14,150 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:14,150 INFO : Inserting sp|Q13247|SRSF6_HUMAN
15 Dec 2023 00:41:14,165 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,165 INFO : Inserting sp|Q13277|STX3_HUMAN
15 Dec 2023 00:41:14,193 INFO : 59% Done
15 Dec 2023 00:41:14,204 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:14,204 INFO : Inserting sp|Q13287|NMI_HUMAN
15 Dec 2023 00:41:14,227 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,227 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 00:41:14,273 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:14,274 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 00:41:14,305 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,305 INFO : Inserting sp|Q13410|BT1A1_HUMAN
15 Dec 2023 00:41:14,319 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,319 INFO : Inserting sp|Q13435|SF3B2_HUMAN
15 Dec 2023 00:41:14,354 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:14,354 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 00:41:14,393 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:14,393 INFO : Inserting sp|Q13451|FKBP5_HUMAN
15 Dec 2023 00:41:14,431 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:14,431 INFO : Inserting sp|Q13464|ROCK1_HUMAN
15 Dec 2023 00:41:14,461 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:14,461 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 00:41:14,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,484 INFO : Inserting sp|Q13515|BFSP2_HUMAN
15 Dec 2023 00:41:14,506 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,506 INFO : Inserting sp|Q13564|ULA1_HUMAN
15 Dec 2023 00:41:14,517 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,517 INFO : Inserting sp|Q13576|IQGA2_HUMAN
15 Dec 2023 00:41:14,550 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:14,550 INFO : Inserting sp|Q13586|STIM1_HUMAN
15 Dec 2023 00:41:14,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,566 INFO : Inserting sp|Q13637|RAB32_HUMAN
15 Dec 2023 00:41:14,576 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,576 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 00:41:14,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,593 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 00:41:14,726 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:41:14,726 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 00:41:14,797 INFO : 60% Done
15 Dec 2023 00:41:14,823 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:14,823 INFO : Inserting sp|Q13885|TBB2A_HUMAN
15 Dec 2023 00:41:14,837 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,837 INFO : Inserting sp|Q13951|PEBB_HUMAN
15 Dec 2023 00:41:14,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,852 INFO : Inserting sp|Q14005|IL16_HUMAN
15 Dec 2023 00:41:14,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,867 INFO : Inserting sp|Q14008|CKAP5_HUMAN
15 Dec 2023 00:41:14,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:14,889 INFO : Imported 900 peptide groups.
15 Dec 2023 00:41:14,889 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 00:41:14,942 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:14,942 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 00:41:15,028 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:15,028 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 00:41:15,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,039 INFO : Inserting sp|Q14166|TTL12_HUMAN
15 Dec 2023 00:41:15,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,056 INFO : Inserting sp|Q14204|DYHC1_HUMAN
15 Dec 2023 00:41:15,106 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:15,107 INFO : Inserting sp|Q14240|IF4A2_HUMAN
15 Dec 2023 00:41:15,121 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,121 INFO : Inserting sp|Q14246|AGRE1_HUMAN
15 Dec 2023 00:41:15,137 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,137 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 00:41:15,168 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:15,168 INFO : Inserting sp|Q14289|FAK2_HUMAN
15 Dec 2023 00:41:15,177 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,177 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 00:41:15,205 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:15,205 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 00:41:15,259 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:15,259 INFO : Inserting sp|Q14508|WFDC2_HUMAN
15 Dec 2023 00:41:15,282 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:15,282 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 00:41:15,396 INFO : 61% Done
15 Dec 2023 00:41:15,459 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:41:15,459 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 00:41:15,478 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:15,478 INFO : Inserting sp|Q14584|ZN266_HUMAN
15 Dec 2023 00:41:15,498 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:15,498 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 00:41:15,550 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:15,550 INFO : Inserting sp|Q14677|EPN4_HUMAN
15 Dec 2023 00:41:15,576 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:15,576 INFO : Inserting sp|Q14683|SMC1A_HUMAN
15 Dec 2023 00:41:15,651 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:15,652 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 00:41:15,720 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:15,720 INFO : Inserting sp|Q14739|LBR_HUMAN
15 Dec 2023 00:41:15,750 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:15,750 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 00:41:15,830 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:15,830 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 00:41:15,978 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:15,978 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 00:41:15,994 INFO : 62% Done
15 Dec 2023 00:41:16,014 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:16,014 INFO : Inserting sp|Q14839|CHD4_HUMAN
15 Dec 2023 00:41:16,025 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,025 INFO : Inserting sp|Q14847|LASP1_HUMAN
15 Dec 2023 00:41:16,084 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:16,084 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 00:41:16,095 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,095 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 00:41:16,119 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:16,119 INFO : Inserting sp|Q14980|NUMA1_HUMAN
15 Dec 2023 00:41:16,224 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:16,224 INFO : Inserting sp|Q15008|PSMD6_HUMAN
15 Dec 2023 00:41:16,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,265 INFO : Inserting sp|Q15027|ACAP1_HUMAN
15 Dec 2023 00:41:16,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,292 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 00:41:16,344 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:16,344 INFO : Inserting sp|Q15057|ACAP2_HUMAN
15 Dec 2023 00:41:16,415 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:16,415 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 00:41:16,427 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,427 INFO : Inserting sp|Q15075|EEA1_HUMAN
15 Dec 2023 00:41:16,443 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,444 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 00:41:16,469 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:16,469 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 00:41:16,494 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:16,495 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 00:41:16,516 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:16,516 INFO : Inserting sp|Q15121|PEA15_HUMAN
15 Dec 2023 00:41:16,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,534 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 00:41:16,943 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:41:16,943 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 00:41:16,955 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:16,955 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 00:41:16,981 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:16,981 INFO : Inserting sp|Q15233|NONO_HUMAN
15 Dec 2023 00:41:17,031 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:17,031 INFO : Inserting sp|Q15293|RCN1_HUMAN
15 Dec 2023 00:41:17,049 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,049 INFO : Inserting sp|Q15363|TMED2_HUMAN
15 Dec 2023 00:41:17,062 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,062 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 00:41:17,072 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,072 INFO : Inserting sp|Q15370|ELOB_HUMAN
15 Dec 2023 00:41:17,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,096 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 00:41:17,121 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,121 INFO : Inserting sp|Q15424|SAFB1_HUMAN
15 Dec 2023 00:41:17,135 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,136 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 00:41:17,165 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,165 INFO : Inserting sp|Q15436|SC23A_HUMAN
15 Dec 2023 00:41:17,183 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,183 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 00:41:17,192 INFO : 63% Done
15 Dec 2023 00:41:17,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,213 INFO : Inserting sp|Q15637|SF01_HUMAN
15 Dec 2023 00:41:17,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,236 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 00:41:17,266 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,266 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 00:41:17,303 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:17,303 INFO : Inserting sp|Q15819|UB2V2_HUMAN
15 Dec 2023 00:41:17,333 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,334 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 00:41:17,353 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,353 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 00:41:17,438 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:17,438 INFO : Inserting sp|Q15843|NEDD8_HUMAN
15 Dec 2023 00:41:17,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,469 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 00:41:17,481 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,481 INFO : Inserting sp|Q15907|RB11B_HUMAN
15 Dec 2023 00:41:17,506 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,506 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 00:41:17,519 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,520 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 00:41:17,539 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,539 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 00:41:17,617 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:17,617 INFO : Inserting sp|Q16363|LAMA4_HUMAN
15 Dec 2023 00:41:17,645 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,646 INFO : Inserting sp|Q16512|PKN1_HUMAN
15 Dec 2023 00:41:17,662 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,662 INFO : Inserting sp|Q16576|RBBP7_HUMAN
15 Dec 2023 00:41:17,690 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:17,690 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 00:41:17,717 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,717 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 00:41:17,766 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:17,766 INFO : Inserting sp|Q16666|IF16_HUMAN
15 Dec 2023 00:41:17,783 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,783 INFO : Inserting sp|Q16695|H31T_HUMAN
15 Dec 2023 00:41:17,865 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:17,865 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 00:41:17,873 INFO : 64% Done
15 Dec 2023 00:41:17,883 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:17,883 INFO : Inserting sp|Q16719|KYNU_HUMAN
15 Dec 2023 00:41:17,917 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,917 INFO : Inserting sp|Q16720|AT2B3_HUMAN
15 Dec 2023 00:41:17,958 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:17,958 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 00:41:18,019 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:18,019 INFO : Inserting sp|Q16836|HCDH_HUMAN
15 Dec 2023 00:41:18,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,029 INFO : Inserting sp|Q16850|CP51A_HUMAN
15 Dec 2023 00:41:18,050 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,050 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 00:41:18,060 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,060 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 00:41:18,079 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,079 INFO : Inserting sp|Q30154|DRB5_HUMAN
15 Dec 2023 00:41:18,102 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,102 INFO : Inserting sp|Q32MZ4|LRRF1_HUMAN
15 Dec 2023 00:41:18,217 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:41:18,217 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 00:41:18,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,229 INFO : Inserting sp|Q496F6|CLM2_HUMAN
15 Dec 2023 00:41:18,249 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,249 INFO : Inserting sp|Q4V328|GRAP1_HUMAN
15 Dec 2023 00:41:18,287 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,287 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 00:41:18,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,313 INFO : Inserting sp|Q5EG05|CAR16_HUMAN
15 Dec 2023 00:41:18,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,332 INFO : Inserting sp|Q5JRA6|TGO1_HUMAN
15 Dec 2023 00:41:18,351 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,351 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 00:41:18,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,363 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 00:41:18,373 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,374 INFO : Inserting sp|Q5MIZ7|P4R3B_HUMAN
15 Dec 2023 00:41:18,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,401 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 00:41:18,436 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:18,436 INFO : Inserting sp|Q5T1M5|FKB15_HUMAN
15 Dec 2023 00:41:18,486 INFO : 65% Done
15 Dec 2023 00:41:18,496 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:18,496 INFO : Inserting sp|Q5TAQ9|DCAF8_HUMAN
15 Dec 2023 00:41:18,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,509 INFO : Inserting sp|Q5VUA4|ZN318_HUMAN
15 Dec 2023 00:41:18,526 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,527 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 00:41:18,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,543 INFO : Inserting sp|Q63HN8|RN213_HUMAN
15 Dec 2023 00:41:18,560 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,560 INFO : Inserting sp|Q6DD88|ATLA3_HUMAN
15 Dec 2023 00:41:18,577 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,577 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 00:41:18,632 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:18,632 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 00:41:18,652 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,652 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 00:41:18,737 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:18,738 INFO : Inserting sp|Q6IA69|NADE_HUMAN
15 Dec 2023 00:41:18,761 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,761 INFO : Imported 1000 peptide groups.
15 Dec 2023 00:41:18,761 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 00:41:18,787 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,787 INFO : Inserting sp|Q6IN85|P4R3A_HUMAN
15 Dec 2023 00:41:18,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,827 INFO : Inserting sp|Q6JBY9|CPZIP_HUMAN
15 Dec 2023 00:41:18,860 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,860 INFO : Inserting sp|Q6P9A2|GLT18_HUMAN
15 Dec 2023 00:41:18,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,885 INFO : Inserting sp|Q6UVK1|CSPG4_HUMAN
15 Dec 2023 00:41:18,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:18,922 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 00:41:18,938 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,938 INFO : Inserting sp|Q6UX15|LAYN_HUMAN
15 Dec 2023 00:41:18,958 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:18,958 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 00:41:18,999 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:18,999 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 00:41:19,023 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,023 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 00:41:19,053 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,053 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 00:41:19,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,080 INFO : Inserting sp|Q6ZRP7|QSOX2_HUMAN
15 Dec 2023 00:41:19,099 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,099 INFO : Inserting sp|Q70J99|UN13D_HUMAN
15 Dec 2023 00:41:19,123 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,123 INFO : Inserting sp|Q71DI3|H32_HUMAN
15 Dec 2023 00:41:19,176 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:19,176 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 00:41:19,204 INFO : 66% Done
15 Dec 2023 00:41:19,242 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:19,242 INFO : Inserting sp|Q71UI9|H2AV_HUMAN
15 Dec 2023 00:41:19,305 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:19,305 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 00:41:19,375 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:19,375 INFO : Inserting sp|Q7KZI7|MARK2_HUMAN
15 Dec 2023 00:41:19,400 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,400 INFO : Inserting sp|Q7L014|DDX46_HUMAN
15 Dec 2023 00:41:19,434 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,434 INFO : Inserting sp|Q7L1Q6|5MP2_HUMAN
15 Dec 2023 00:41:19,465 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,465 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 00:41:19,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,485 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 00:41:19,564 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:19,564 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 00:41:19,586 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,586 INFO : Inserting sp|Q7Z4V5|HDGR2_HUMAN
15 Dec 2023 00:41:19,612 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,612 INFO : Inserting sp|Q7Z6I6|RHG30_HUMAN
15 Dec 2023 00:41:19,634 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,634 INFO : Inserting sp|Q7Z739|YTHD3_HUMAN
15 Dec 2023 00:41:19,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,655 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 00:41:19,685 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,686 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 00:41:19,791 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:19,791 INFO : Inserting sp|Q7Z7M9|GALT5_HUMAN
15 Dec 2023 00:41:19,808 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,809 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 00:41:19,819 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,819 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 00:41:19,855 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:19,855 INFO : Inserting sp|Q86T90|K1328_HUMAN
15 Dec 2023 00:41:19,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:19,867 INFO : Inserting sp|Q86TX2|ACOT1_HUMAN
15 Dec 2023 00:41:19,905 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,905 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 00:41:19,969 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:19,969 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 00:41:20,030 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:20,031 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 00:41:20,108 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:20,109 INFO : Inserting sp|Q86XX4|FRAS1_HUMAN
15 Dec 2023 00:41:20,131 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,131 INFO : Inserting sp|Q8IUC8|GLT13_HUMAN
15 Dec 2023 00:41:20,159 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,159 INFO : Inserting sp|Q8IUI8|CRLF3_HUMAN
15 Dec 2023 00:41:20,188 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,188 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 00:41:20,238 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:20,238 INFO : Inserting sp|Q8IWB7|WDFY1_HUMAN
15 Dec 2023 00:41:20,266 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,266 INFO : Inserting sp|Q8IWU5|SULF2_HUMAN
15 Dec 2023 00:41:20,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,281 INFO : Inserting sp|Q8IX05|CD302_HUMAN
15 Dec 2023 00:41:20,294 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,294 INFO : Inserting sp|Q8IX12|CCAR1_HUMAN
15 Dec 2023 00:41:20,319 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,319 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 00:41:20,391 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:20,391 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 00:41:20,441 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:20,441 INFO : Inserting sp|Q8N163|CCAR2_HUMAN
15 Dec 2023 00:41:20,496 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:20,496 INFO : Inserting sp|Q8N1N2|DYNAP_HUMAN
15 Dec 2023 00:41:20,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,509 INFO : Inserting sp|Q8N1N4|K2C78_HUMAN
15 Dec 2023 00:41:20,548 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,548 INFO : Inserting sp|Q8N2Q7|NLGN1_HUMAN
15 Dec 2023 00:41:20,565 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,565 INFO : Inserting sp|Q8N2S1|LTBP4_HUMAN
15 Dec 2023 00:41:20,625 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:20,625 INFO : Inserting sp|Q8N3J6|CADM2_HUMAN
15 Dec 2023 00:41:20,645 INFO : 67% Done
15 Dec 2023 00:41:20,656 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,656 INFO : Inserting sp|Q8N4C6|NIN_HUMAN
15 Dec 2023 00:41:20,673 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,673 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 00:41:20,717 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,717 INFO : Inserting sp|Q8N7H5|PAF1_HUMAN
15 Dec 2023 00:41:20,735 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,735 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 00:41:20,803 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:20,803 INFO : Inserting sp|Q8NBJ5|GT251_HUMAN
15 Dec 2023 00:41:20,827 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,827 INFO : Inserting sp|Q8NBS9|TXND5_HUMAN
15 Dec 2023 00:41:20,838 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,839 INFO : Inserting sp|Q8NCL4|GALT6_HUMAN
15 Dec 2023 00:41:20,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,851 INFO : Inserting sp|Q8NE71|ABCF1_HUMAN
15 Dec 2023 00:41:20,869 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,869 INFO : Inserting sp|Q8NF50|DOCK8_HUMAN
15 Dec 2023 00:41:20,890 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,891 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 00:41:20,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,911 INFO : Inserting sp|Q8NFP4|MDGA1_HUMAN
15 Dec 2023 00:41:20,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,935 INFO : Inserting sp|Q8NHL6|LIRB1_HUMAN
15 Dec 2023 00:41:20,946 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,946 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 00:41:20,964 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:20,964 INFO : Inserting sp|Q8TAG5|VTM2A_HUMAN
15 Dec 2023 00:41:20,996 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:20,996 INFO : Inserting sp|Q8TCZ2|C99L2_HUMAN
15 Dec 2023 00:41:21,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,016 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 00:41:21,042 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:21,042 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 00:41:21,073 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,074 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 00:41:21,106 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,106 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 00:41:21,203 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:21,204 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 00:41:21,259 INFO : 68% Done
15 Dec 2023 00:41:21,319 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:21,319 INFO : Inserting sp|Q8WXF1|PSPC1_HUMAN
15 Dec 2023 00:41:21,343 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:21,343 INFO : Inserting sp|Q8WXX5|DNJC9_HUMAN
15 Dec 2023 00:41:21,399 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,400 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 00:41:21,462 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:21,463 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 00:41:21,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,480 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 00:41:21,509 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:21,509 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 00:41:21,560 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,560 INFO : Inserting sp|Q92598|HS105_HUMAN
15 Dec 2023 00:41:21,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,575 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 00:41:21,590 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,590 INFO : Inserting sp|Q92614|MY18A_HUMAN
15 Dec 2023 00:41:21,656 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,656 INFO : Inserting sp|Q92626|PXDN_HUMAN
15 Dec 2023 00:41:21,667 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,667 INFO : Inserting sp|Q92673|SORL_HUMAN
15 Dec 2023 00:41:21,699 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,699 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 00:41:21,740 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:21,740 INFO : Inserting sp|Q92692|NECT2_HUMAN
15 Dec 2023 00:41:21,755 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,755 INFO : Inserting sp|Q92696|PGTA_HUMAN
15 Dec 2023 00:41:21,770 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,770 INFO : Inserting sp|Q92743|HTRA1_HUMAN
15 Dec 2023 00:41:21,786 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,786 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 00:41:21,818 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,818 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 00:41:21,832 INFO : 69% Done
15 Dec 2023 00:41:21,876 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:21,876 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 00:41:21,925 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,925 INFO : Inserting sp|Q92841|DDX17_HUMAN
15 Dec 2023 00:41:21,939 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,939 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 00:41:21,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:21,956 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 00:41:21,991 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:21,991 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 00:41:22,020 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,020 INFO : Inserting sp|Q92888|ARHG1_HUMAN
15 Dec 2023 00:41:22,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,038 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 00:41:22,111 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:22,111 INFO : Inserting sp|Q92905|CSN5_HUMAN
15 Dec 2023 00:41:22,131 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,131 INFO : Inserting sp|Q92911|SC5A5_HUMAN
15 Dec 2023 00:41:22,162 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,162 INFO : Inserting sp|Q92932|PTPR2_HUMAN
15 Dec 2023 00:41:22,187 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,187 INFO : Inserting sp|Q92956|TNR14_HUMAN
15 Dec 2023 00:41:22,198 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,198 INFO : Imported 1100 peptide groups.
15 Dec 2023 00:41:22,198 INFO : Inserting sp|Q93009|UBP7_HUMAN
15 Dec 2023 00:41:22,221 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,221 INFO : Inserting sp|Q93063|EXT2_HUMAN
15 Dec 2023 00:41:22,249 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,249 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 00:41:22,311 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,311 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 00:41:22,347 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:22,347 INFO : Inserting sp|Q93084|AT2A3_HUMAN
15 Dec 2023 00:41:22,362 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,362 INFO : Inserting sp|Q969H8|MYDGF_HUMAN
15 Dec 2023 00:41:22,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,372 INFO : Inserting sp|Q969Q5|RAB24_HUMAN
15 Dec 2023 00:41:22,392 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,392 INFO : Inserting sp|Q96AX1|VP33A_HUMAN
15 Dec 2023 00:41:22,402 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,402 INFO : Inserting sp|Q96B86|RGMA_HUMAN
15 Dec 2023 00:41:22,408 INFO : 70% Done
15 Dec 2023 00:41:22,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,414 INFO : Inserting sp|Q96B97|SH3K1_HUMAN
15 Dec 2023 00:41:22,489 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,489 INFO : Inserting sp|Q96BY2|MOAP1_HUMAN
15 Dec 2023 00:41:22,508 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,508 INFO : Inserting sp|Q96C86|DCPS_HUMAN
15 Dec 2023 00:41:22,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,524 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 00:41:22,552 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,552 INFO : Inserting sp|Q96FE7|P3IP1_HUMAN
15 Dec 2023 00:41:22,581 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:22,581 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 00:41:22,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,592 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 00:41:22,647 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,647 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 00:41:22,733 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:22,733 INFO : Inserting sp|Q96HE7|ERO1A_HUMAN
15 Dec 2023 00:41:22,775 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,776 INFO : Inserting sp|Q96K76|UBP47_HUMAN
15 Dec 2023 00:41:22,792 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,792 INFO : Inserting sp|Q96KG7|MEG10_HUMAN
15 Dec 2023 00:41:22,805 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,805 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 00:41:22,871 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:22,871 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 00:41:22,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,882 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 00:41:22,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,894 INFO : Inserting sp|Q96NY7|CLIC6_HUMAN
15 Dec 2023 00:41:22,958 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:22,958 INFO : Inserting sp|Q96P44|COLA1_HUMAN
15 Dec 2023 00:41:22,970 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,970 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 00:41:22,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,981 INFO : Inserting sp|Q96RU3|FNBP1_HUMAN
15 Dec 2023 00:41:22,992 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:22,993 INFO : Inserting sp|Q99426|TBCB_HUMAN
15 Dec 2023 00:41:23,022 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,022 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 00:41:23,112 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:23,112 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 00:41:23,149 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:23,149 INFO : Inserting sp|Q99456|K1C12_HUMAN
15 Dec 2023 00:41:23,205 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:23,205 INFO : Inserting sp|Q99460|PSMD1_HUMAN
15 Dec 2023 00:41:23,235 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:23,235 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 00:41:23,252 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,252 INFO : Inserting sp|Q99536|VAT1_HUMAN
15 Dec 2023 00:41:23,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,264 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 00:41:23,301 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:23,301 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 00:41:23,317 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,318 INFO : Inserting sp|Q99613|EIF3C_HUMAN
15 Dec 2023 00:41:23,347 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,347 INFO : Inserting sp|Q99623|PHB2_HUMAN
15 Dec 2023 00:41:23,357 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,357 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 00:41:23,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,367 INFO : Inserting sp|Q99674|CGRE1_HUMAN
15 Dec 2023 00:41:23,436 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:23,436 INFO : Inserting sp|Q99715|COCA1_HUMAN
15 Dec 2023 00:41:23,460 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,460 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 00:41:23,484 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,484 INFO : Inserting sp|Q99798|ACON_HUMAN
15 Dec 2023 00:41:23,514 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,515 INFO : Inserting sp|Q99816|TS101_HUMAN
15 Dec 2023 00:41:23,545 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,545 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 00:41:23,564 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,565 INFO : Inserting sp|Q99873|ANM1_HUMAN
15 Dec 2023 00:41:23,580 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,580 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 00:41:23,616 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:23,616 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 00:41:23,623 INFO : 71% Done
15 Dec 2023 00:41:23,682 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:23,682 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 00:41:23,719 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:23,719 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 00:41:23,756 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:23,756 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 00:41:23,786 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,786 INFO : Inserting sp|Q99972|MYOC_HUMAN
15 Dec 2023 00:41:23,798 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,798 INFO : Inserting sp|Q9BPW9|DHRS9_HUMAN
15 Dec 2023 00:41:23,809 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,809 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 00:41:23,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:23,828 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 00:41:23,845 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,845 INFO : Inserting sp|Q9BRK5|CAB45_HUMAN
15 Dec 2023 00:41:23,907 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:23,907 INFO : Inserting sp|Q9BS26|ERP44_HUMAN
15 Dec 2023 00:41:23,920 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,920 INFO : Inserting sp|Q9BT09|CNPY3_HUMAN
15 Dec 2023 00:41:23,946 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,946 INFO : Inserting sp|Q9BT92|TCHP_HUMAN
15 Dec 2023 00:41:23,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,962 INFO : Inserting sp|Q9BUH6|PAXX_HUMAN
15 Dec 2023 00:41:23,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,975 INFO : Inserting sp|Q9BUJ2|HNRL1_HUMAN
15 Dec 2023 00:41:23,987 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,987 INFO : Inserting sp|Q9BUP3|HTAI2_HUMAN
15 Dec 2023 00:41:23,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:23,997 INFO : Inserting sp|Q9BUQ8|DDX23_HUMAN
15 Dec 2023 00:41:24,012 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,012 INFO : Inserting sp|Q9BV40|VAMP8_HUMAN
15 Dec 2023 00:41:24,055 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:24,056 INFO : Inserting sp|Q9BVA1|TBB2B_HUMAN
15 Dec 2023 00:41:24,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,071 INFO : Inserting sp|Q9BWS9|CHID1_HUMAN
15 Dec 2023 00:41:24,097 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,097 INFO : Inserting sp|Q9BXP5|SRRT_HUMAN
15 Dec 2023 00:41:24,114 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,114 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 00:41:24,126 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,126 INFO : Inserting sp|Q9BXS4|TMM59_HUMAN
15 Dec 2023 00:41:24,142 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,143 INFO : Inserting sp|Q9BXS5|AP1M1_HUMAN
15 Dec 2023 00:41:24,157 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,157 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 00:41:24,265 INFO : 72% Done
15 Dec 2023 00:41:24,313 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:41:24,313 INFO : Inserting sp|Q9BY11|PACN1_HUMAN
15 Dec 2023 00:41:24,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,331 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 00:41:24,373 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:24,373 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 00:41:24,383 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,383 INFO : Inserting sp|Q9BYJ9|YTHD1_HUMAN
15 Dec 2023 00:41:24,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,397 INFO : Inserting sp|Q9BYT8|NEUL_HUMAN
15 Dec 2023 00:41:24,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,420 INFO : Inserting sp|Q9BYX2|TBD2A_HUMAN
15 Dec 2023 00:41:24,442 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,442 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 00:41:24,453 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,453 INFO : Inserting sp|Q9BZR6|RTN4R_HUMAN
15 Dec 2023 00:41:24,473 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,473 INFO : Inserting sp|Q9BZZ5|API5_HUMAN
15 Dec 2023 00:41:24,494 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,494 INFO : Inserting sp|Q9C0A0|CNTP4_HUMAN
15 Dec 2023 00:41:24,510 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,510 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 00:41:24,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,532 INFO : Inserting sp|Q9H0C2|ADT4_HUMAN
15 Dec 2023 00:41:24,543 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,543 INFO : Inserting sp|Q9H223|EHD4_HUMAN
15 Dec 2023 00:41:24,555 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,555 INFO : Inserting sp|Q9H257|CARD9_HUMAN
15 Dec 2023 00:41:24,570 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,570 INFO : Inserting sp|Q9H2G2|SLK_HUMAN
15 Dec 2023 00:41:24,618 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:24,618 INFO : Inserting sp|Q9H2K8|TAOK3_HUMAN
15 Dec 2023 00:41:24,642 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,642 INFO : Inserting sp|Q9H2X0|CHRD_HUMAN
15 Dec 2023 00:41:24,681 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:24,681 INFO : Inserting sp|Q9H2X3|CLC4M_HUMAN
15 Dec 2023 00:41:24,740 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:24,740 INFO : Inserting sp|Q9H361|PABP3_HUMAN
15 Dec 2023 00:41:24,784 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:24,784 INFO : Inserting sp|Q9H3K6|BOLA2_HUMAN
15 Dec 2023 00:41:24,826 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,826 INFO : Inserting sp|Q9H3R0|KDM4C_HUMAN
15 Dec 2023 00:41:24,842 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,842 INFO : Inserting sp|Q9H444|CHM4B_HUMAN
15 Dec 2023 00:41:24,851 INFO : 73% Done
15 Dec 2023 00:41:24,864 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,864 INFO : Inserting sp|Q9H4A3|WNK1_HUMAN
15 Dec 2023 00:41:24,894 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:24,894 INFO : Inserting sp|Q9H4D0|CSTN2_HUMAN
15 Dec 2023 00:41:24,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,911 INFO : Inserting sp|Q9H4E7|DEFI6_HUMAN
15 Dec 2023 00:41:24,982 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:24,982 INFO : Inserting sp|Q9H4F8|SMOC1_HUMAN
15 Dec 2023 00:41:24,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:24,999 INFO : Inserting sp|Q9H4G0|E41L1_HUMAN
15 Dec 2023 00:41:25,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,016 INFO : Inserting sp|Q9H6X2|ANTR1_HUMAN
15 Dec 2023 00:41:25,027 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,027 INFO : Inserting sp|Q9H7P6|MB12B_HUMAN
15 Dec 2023 00:41:25,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,037 INFO : Imported 1200 peptide groups.
15 Dec 2023 00:41:25,037 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 00:41:25,053 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,053 INFO : Inserting sp|Q9H993|ARMT1_HUMAN
15 Dec 2023 00:41:25,073 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,073 INFO : Inserting sp|Q9HB90|RRAGC_HUMAN
15 Dec 2023 00:41:25,095 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,095 INFO : Inserting sp|Q9HBT6|CAD20_HUMAN
15 Dec 2023 00:41:25,113 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,113 INFO : Inserting sp|Q9HC35|EMAL4_HUMAN
15 Dec 2023 00:41:25,127 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,128 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 00:41:25,178 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,179 INFO : Inserting sp|Q9HD15|SRA1_HUMAN
15 Dec 2023 00:41:25,197 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,197 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 00:41:25,233 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,233 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 00:41:25,255 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,255 INFO : Inserting sp|Q9NNX6|CD209_HUMAN
15 Dec 2023 00:41:25,360 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:25,360 INFO : Inserting sp|Q9NPG1|FZD3_HUMAN
15 Dec 2023 00:41:25,365 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,365 INFO : Inserting sp|Q9NPR2|SEM4B_HUMAN
15 Dec 2023 00:41:25,400 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:25,400 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 00:41:25,421 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:25,421 INFO : Inserting sp|Q9NQL2|RRAGD_HUMAN
15 Dec 2023 00:41:25,448 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,448 INFO : Inserting sp|Q9NQP4|PFD4_HUMAN
15 Dec 2023 00:41:25,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,479 INFO : Inserting sp|Q9NQW7|XPP1_HUMAN
15 Dec 2023 00:41:25,492 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,493 INFO : Inserting sp|Q9NR22|ANM8_HUMAN
15 Dec 2023 00:41:25,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,511 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 00:41:25,522 INFO : 74% Done
15 Dec 2023 00:41:25,540 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,540 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 00:41:25,559 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,560 INFO : Inserting sp|Q9NS15|LTBP3_HUMAN
15 Dec 2023 00:41:25,595 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,595 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 00:41:25,613 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,613 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 00:41:25,656 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:25,656 INFO : Inserting sp|Q9NTI5|PDS5B_HUMAN
15 Dec 2023 00:41:25,677 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:25,677 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 00:41:25,732 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,732 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 00:41:25,775 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,776 INFO : Inserting sp|Q9NUU7|DD19A_HUMAN
15 Dec 2023 00:41:25,798 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,798 INFO : Inserting sp|Q9NVA2|SEP11_HUMAN
15 Dec 2023 00:41:25,818 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,818 INFO : Inserting sp|Q9NVJ2|ARL8B_HUMAN
15 Dec 2023 00:41:25,844 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,844 INFO : Inserting sp|Q9NWY4|HPF1_HUMAN
15 Dec 2023 00:41:25,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,857 INFO : Inserting sp|Q9NY15|STAB1_HUMAN
15 Dec 2023 00:41:25,890 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:25,890 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 00:41:25,902 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:25,902 INFO : Inserting sp|Q9NYQ8|FAT2_HUMAN
15 Dec 2023 00:41:25,946 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,946 INFO : Inserting sp|Q9NYU2|UGGG1_HUMAN
15 Dec 2023 00:41:25,993 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:25,993 INFO : Inserting sp|Q9NYV6|RRN3_HUMAN
15 Dec 2023 00:41:26,012 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,012 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 00:41:26,085 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:26,085 INFO : Inserting sp|Q9NZJ9|NUDT4_HUMAN
15 Dec 2023 00:41:26,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,119 INFO : Inserting sp|Q9NZM1|MYOF_HUMAN
15 Dec 2023 00:41:26,133 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,133 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 00:41:26,162 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:26,162 INFO : Inserting sp|Q9P0K1|ADA22_HUMAN
15 Dec 2023 00:41:26,208 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:26,208 INFO : Inserting sp|Q9P0K9|FRS1L_HUMAN
15 Dec 2023 00:41:26,222 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,223 INFO : Inserting sp|Q9P0L0|VAPA_HUMAN
15 Dec 2023 00:41:26,254 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:26,254 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 00:41:26,304 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:26,305 INFO : Inserting sp|Q9P2E9|RRBP1_HUMAN
15 Dec 2023 00:41:26,415 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:26,415 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 00:41:26,460 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:26,460 INFO : Inserting sp|Q9UBE0|SAE1_HUMAN
15 Dec 2023 00:41:26,501 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:26,501 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 00:41:26,648 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:41:26,648 INFO : Inserting sp|Q9UBQ7|GRHPR_HUMAN
15 Dec 2023 00:41:26,659 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,659 INFO : Inserting sp|Q9UBT2|SAE2_HUMAN
15 Dec 2023 00:41:26,744 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:41:26,744 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 00:41:26,791 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:26,791 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 00:41:26,804 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,804 INFO : Inserting sp|Q9UEY8|ADDG_HUMAN
15 Dec 2023 00:41:26,815 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,815 INFO : Inserting sp|Q9UGI8|TES_HUMAN
15 Dec 2023 00:41:26,857 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:26,857 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 00:41:26,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,867 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 00:41:26,878 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:26,878 INFO : Inserting sp|Q9UH65|SWP70_HUMAN
15 Dec 2023 00:41:26,888 INFO : 75% Done
15 Dec 2023 00:41:26,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:26,922 INFO : Inserting sp|Q9UHD8|SEPT9_HUMAN
15 Dec 2023 00:41:26,965 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:26,965 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 00:41:26,998 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:26,998 INFO : Inserting sp|Q9UHI8|ATS1_HUMAN
15 Dec 2023 00:41:27,011 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,011 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 00:41:27,045 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,045 INFO : Inserting sp|Q9UHX1|PUF60_HUMAN
15 Dec 2023 00:41:27,078 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,078 INFO : Inserting sp|Q9UI08|EVL_HUMAN
15 Dec 2023 00:41:27,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,092 INFO : Inserting sp|Q9UI12|VATH_HUMAN
15 Dec 2023 00:41:27,105 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,106 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 00:41:27,123 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,123 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 00:41:27,145 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,145 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 00:41:27,177 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,177 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 00:41:27,199 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,199 INFO : Inserting sp|Q9UK76|JUPI1_HUMAN
15 Dec 2023 00:41:27,222 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,222 INFO : Inserting sp|Q9UKG1|DP13A_HUMAN
15 Dec 2023 00:41:27,237 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,237 INFO : Inserting sp|Q9UKK3|PARP4_HUMAN
15 Dec 2023 00:41:27,258 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,258 INFO : Inserting sp|Q9UKK9|NUDT5_HUMAN
15 Dec 2023 00:41:27,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,275 INFO : Inserting sp|Q9UKM9|RALY_HUMAN
15 Dec 2023 00:41:27,316 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,316 INFO : Inserting sp|Q9UKQ2|ADA28_HUMAN
15 Dec 2023 00:41:27,349 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,349 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 00:41:27,361 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,361 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 00:41:27,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,378 INFO : Inserting sp|Q9ULH1|ASAP1_HUMAN
15 Dec 2023 00:41:27,413 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,413 INFO : Inserting sp|Q9ULI3|HEG1_HUMAN
15 Dec 2023 00:41:27,446 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,446 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 00:41:27,475 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,475 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 00:41:27,503 INFO : 76% Done
15 Dec 2023 00:41:27,517 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,517 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 00:41:27,528 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,528 INFO : Inserting sp|Q9UMR2|DD19B_HUMAN
15 Dec 2023 00:41:27,549 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,549 INFO : Inserting sp|Q9UMY4|SNX12_HUMAN
15 Dec 2023 00:41:27,561 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,561 INFO : Inserting sp|Q9UNF0|PACN2_HUMAN
15 Dec 2023 00:41:27,606 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,606 INFO : Inserting sp|Q9UNH7|SNX6_HUMAN
15 Dec 2023 00:41:27,634 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,635 INFO : Inserting sp|Q9UNM6|PSD13_HUMAN
15 Dec 2023 00:41:27,664 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,664 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 00:41:27,692 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:27,692 INFO : Inserting sp|Q9UNZ2|NSF1C_HUMAN
15 Dec 2023 00:41:27,736 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:27,737 INFO : Inserting sp|Q9UP79|ATS8_HUMAN
15 Dec 2023 00:41:27,748 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,748 INFO : Inserting sp|Q9UPU5|UBP24_HUMAN
15 Dec 2023 00:41:27,760 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,760 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 00:41:27,852 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:27,852 INFO : Inserting sp|Q9UQE7|SMC3_HUMAN
15 Dec 2023 00:41:27,980 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:41:27,980 INFO : Inserting sp|Q9Y240|CLC11_HUMAN
15 Dec 2023 00:41:27,992 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:27,992 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 00:41:28,009 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,009 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 00:41:28,056 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:28,056 INFO : Inserting sp|Q9Y285|SYFA_HUMAN
15 Dec 2023 00:41:28,069 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,069 INFO : Inserting sp|Q9Y2H0|DLGP4_HUMAN
15 Dec 2023 00:41:28,097 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,097 INFO : Inserting sp|Q9Y2J2|E41L3_HUMAN
15 Dec 2023 00:41:28,124 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,126 INFO : 77% Done
15 Dec 2023 00:41:28,126 INFO : Inserting sp|Q9Y2Q0|AT8A1_HUMAN
15 Dec 2023 00:41:28,150 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,150 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 00:41:28,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,168 INFO : Inserting sp|Q9Y2T7|YBOX2_HUMAN
15 Dec 2023 00:41:28,190 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,190 INFO : Inserting sp|Q9Y2W1|TR150_HUMAN
15 Dec 2023 00:41:28,210 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,210 INFO : Imported 1300 peptide groups.
15 Dec 2023 00:41:28,210 INFO : Inserting sp|Q9Y2Z0|SGT1_HUMAN
15 Dec 2023 00:41:28,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,224 INFO : Inserting sp|Q9Y336|SIGL9_HUMAN
15 Dec 2023 00:41:28,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,246 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 00:41:28,265 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,265 INFO : Inserting sp|Q9Y383|LC7L2_HUMAN
15 Dec 2023 00:41:28,309 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:28,309 INFO : Inserting sp|Q9Y3I0|RTCB_HUMAN
15 Dec 2023 00:41:28,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,326 INFO : Inserting sp|Q9Y3Z3|SAMH1_HUMAN
15 Dec 2023 00:41:28,359 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,360 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 00:41:28,495 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:41:28,495 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 00:41:28,529 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:28,529 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 00:41:28,541 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,541 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 00:41:28,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,554 INFO : Inserting sp|Q9Y4P1|ATG4B_HUMAN
15 Dec 2023 00:41:28,573 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,573 INFO : Inserting sp|Q9Y570|PPME1_HUMAN
15 Dec 2023 00:41:28,584 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,584 INFO : Inserting sp|Q9Y5A9|YTHD2_HUMAN
15 Dec 2023 00:41:28,599 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,599 INFO : Inserting sp|Q9Y5B9|SP16H_HUMAN
15 Dec 2023 00:41:28,685 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:28,685 INFO : Inserting sp|Q9Y5K5|UCHL5_HUMAN
15 Dec 2023 00:41:28,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,698 INFO : Inserting sp|Q9Y5X3|SNX5_HUMAN
15 Dec 2023 00:41:28,708 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,708 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 00:41:28,724 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,724 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 00:41:28,748 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:28,748 INFO : Inserting sp|Q9Y696|CLIC4_HUMAN
15 Dec 2023 00:41:28,756 INFO : 78% Done
15 Dec 2023 00:41:28,775 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,775 INFO : Inserting sp|Q9Y6M5|ZNT1_HUMAN
15 Dec 2023 00:41:28,793 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,793 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 00:41:28,808 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,808 INFO : Inserting sp|Q9Y6Q5|AP1M2_HUMAN
15 Dec 2023 00:41:28,823 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:28,823 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 00:41:29,071 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:41:29,071 INFO : Inserting sp|Q9Y6Y9|LY96_HUMAN
15 Dec 2023 00:41:29,082 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,082 INFO : Inserting sp|A0A024RBG1|NUD4B_HUMAN
15 Dec 2023 00:41:29,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,103 INFO : Inserting sp|O14602|IF1AY_HUMAN
15 Dec 2023 00:41:29,113 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,113 INFO : Inserting sp|O15063|GRRE1_HUMAN
15 Dec 2023 00:41:29,124 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,124 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 00:41:29,145 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,145 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 00:41:29,199 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,199 INFO : Inserting sp|O75947|ATP5H_HUMAN
15 Dec 2023 00:41:29,219 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,219 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 00:41:29,240 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,241 INFO : Inserting sp|O94903|PLPHP_HUMAN
15 Dec 2023 00:41:29,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,259 INFO : Inserting sp|O95965|ITGBL_HUMAN
15 Dec 2023 00:41:29,310 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:29,310 INFO : Inserting sp|P01717|LV325_HUMAN
15 Dec 2023 00:41:29,323 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,323 INFO : Inserting sp|P01718|LV327_HUMAN
15 Dec 2023 00:41:29,337 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,337 INFO : Inserting sp|P0DOX3|IGD_HUMAN
15 Dec 2023 00:41:29,350 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,350 INFO : Inserting sp|P14621|ACYP2_HUMAN
15 Dec 2023 00:41:29,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,364 INFO : Inserting sp|P19961|AMY2B_HUMAN
15 Dec 2023 00:41:29,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,380 INFO : Inserting sp|P29762|RABP1_HUMAN
15 Dec 2023 00:41:29,406 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,406 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 00:41:29,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,433 INFO : Inserting sp|P56385|ATP5I_HUMAN
15 Dec 2023 00:41:29,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,464 INFO : Inserting sp|P69849|NOMO3_HUMAN
15 Dec 2023 00:41:29,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,499 INFO : Inserting sp|P86791|CCZ1_HUMAN
15 Dec 2023 00:41:29,527 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,527 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 00:41:29,585 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,585 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 00:41:29,654 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:41:29,654 INFO : Inserting sp|Q03169|TNAP2_HUMAN
15 Dec 2023 00:41:29,675 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,676 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 00:41:29,690 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,690 INFO : Inserting sp|Q13938|CAYP1_HUMAN
15 Dec 2023 00:41:29,715 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,715 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 00:41:29,738 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,738 INFO : Inserting sp|Q5JSL3|DOC11_HUMAN
15 Dec 2023 00:41:29,776 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,776 INFO : Inserting sp|Q5TFQ8|SIRBL_HUMAN
15 Dec 2023 00:41:29,805 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,805 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 00:41:29,851 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:29,851 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 00:41:29,875 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,875 INFO : Inserting sp|Q7Z4H3|HDDC2_HUMAN
15 Dec 2023 00:41:29,886 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,886 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 00:41:29,913 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,913 INFO : Inserting sp|Q8IZP7|H6ST3_HUMAN
15 Dec 2023 00:41:29,924 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,924 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 00:41:29,953 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:29,953 INFO : Inserting sp|Q8N8A2|ANR44_HUMAN
15 Dec 2023 00:41:29,969 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,969 INFO : Inserting sp|Q8NFI3|ENASE_HUMAN
15 Dec 2023 00:41:29,993 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:29,994 INFO : Inserting sp|Q8TDY8|IGDC4_HUMAN
15 Dec 2023 00:41:30,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,013 INFO : Inserting sp|Q96A05|VATE2_HUMAN
15 Dec 2023 00:41:30,026 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,026 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 00:41:30,057 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:30,057 INFO : Inserting sp|Q99614|TTC1_HUMAN
15 Dec 2023 00:41:30,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,088 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 00:41:30,152 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:30,152 INFO : Inserting sp|Q9BUN1|MENT_HUMAN
15 Dec 2023 00:41:30,182 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,182 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 00:41:30,188 INFO : 79% Done
15 Dec 2023 00:41:30,195 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,195 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 00:41:30,235 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:30,235 INFO : Inserting sp|Q9HBR0|S38AA_HUMAN
15 Dec 2023 00:41:30,251 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,251 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 00:41:30,285 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,285 INFO : Inserting sp|Q9NWV4|CZIB_HUMAN
15 Dec 2023 00:41:30,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,297 INFO : Inserting sp|Q9NZT2|OGFR_HUMAN
15 Dec 2023 00:41:30,328 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,328 INFO : Inserting sp|Q9ULF5|S39AA_HUMAN
15 Dec 2023 00:41:30,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,355 INFO : Inserting sp|Q9UN70|PCDGK_HUMAN
15 Dec 2023 00:41:30,365 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,365 INFO : Inserting sp|Q9UN71|PCDGG_HUMAN
15 Dec 2023 00:41:30,381 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,381 INFO : Inserting sp|Q9Y5G0|PCDGH_HUMAN
15 Dec 2023 00:41:30,398 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,398 INFO : Inserting sp|A0A075B6K0|LV316_HUMAN
15 Dec 2023 00:41:30,409 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,409 INFO : Inserting sp|A0A0B4J2D5|GAL3B_HUMAN
15 Dec 2023 00:41:30,419 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,419 INFO : Inserting sp|A6NEC2|PSAL_HUMAN
15 Dec 2023 00:41:30,436 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,436 INFO : Inserting sp|A6NI72|NCF1B_HUMAN
15 Dec 2023 00:41:30,467 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:30,467 INFO : Inserting sp|B1AJZ9|FHAD1_HUMAN
15 Dec 2023 00:41:30,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,480 INFO : Inserting sp|B5ME19|EIFCL_HUMAN
15 Dec 2023 00:41:30,509 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,509 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 00:41:30,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,531 INFO : Inserting sp|P0DOX7|IGK_HUMAN
15 Dec 2023 00:41:30,580 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:41:30,580 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 00:41:30,631 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:41:30,631 INFO : Inserting sp|P0DPI2|GAL3A_HUMAN
15 Dec 2023 00:41:30,642 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,642 INFO : Inserting sp|P86790|CCZ1B_HUMAN
15 Dec 2023 00:41:30,658 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,658 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 00:41:30,685 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,685 INFO : Inserting sp|Q6IS14|IF5AL_HUMAN
15 Dec 2023 00:41:30,706 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,706 INFO : Inserting sp|Q6UWH4|GAK1B_HUMAN
15 Dec 2023 00:41:30,721 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,722 INFO : Inserting sp|Q6ZQQ6|WDR87_HUMAN
15 Dec 2023 00:41:30,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,739 INFO : Inserting sp|Q7Z5L0|VMO1_HUMAN
15 Dec 2023 00:41:30,761 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,761 INFO : Inserting sp|Q8N3T6|T132C_HUMAN
15 Dec 2023 00:41:30,782 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,783 INFO : Inserting sp|Q8NFI4|F10A5_HUMAN
15 Dec 2023 00:41:30,799 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,799 INFO : Inserting sp|Q96K17|BT3L4_HUMAN
15 Dec 2023 00:41:30,807 INFO : 80% Done
15 Dec 2023 00:41:30,818 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,818 INFO : Inserting sp|Q96R05|RET7_HUMAN
15 Dec 2023 00:41:30,843 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,843 INFO : Inserting sp|Q9H6N6|MYH16_HUMAN
15 Dec 2023 00:41:30,876 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,876 INFO : Inserting sp|Q9H939|PPIP2_HUMAN
15 Dec 2023 00:41:30,886 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,886 INFO : Inserting sp|Q9UKY7|CDV3_HUMAN
15 Dec 2023 00:41:30,914 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,914 INFO : Inserting sp|Q9Y2H5|PKHA6_HUMAN
15 Dec 2023 00:41:30,925 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,925 INFO : Inserting sp|A6NHG4|DDTL_HUMAN
15 Dec 2023 00:41:30,944 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:30,944 INFO : Imported 1400 peptide groups.
15 Dec 2023 00:41:30,944 INFO : Inserting sp|A6NLU5|VTM2B_HUMAN
15 Dec 2023 00:41:30,971 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,971 INFO : Inserting sp|B7ZW38|HNRC3_HUMAN
15 Dec 2023 00:41:30,996 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:30,996 INFO : Inserting sp|P0DMR1|HNRC4_HUMAN
15 Dec 2023 00:41:31,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:31,020 INFO : Inserting sp|Q5BLP8|CD048_HUMAN
15 Dec 2023 00:41:31,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:31,036 INFO : Inserting sp|Q5JXB2|UE2NL_HUMAN
15 Dec 2023 00:41:31,048 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:31,050 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 00:41:31,066 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:31,066 INFO : Inserting sp|Q9H098|F107B_HUMAN
15 Dec 2023 00:41:31,109 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:41:31,109 INFO : Inserting sp|Q9UNX3|RL26L_HUMAN
15 Dec 2023 00:41:31,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:41:31,120 INFO : None of the 342133 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 00:44:28,720 INFO : Updated 107548 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 00:44:28,721 INFO : Done parsing Skyline document.
15 Dec 2023 00:44:28,835 INFO : Calculating fold changes
15 Dec 2023 00:44:28,835 DEBUG: Calculating fold change for group comparison AD vs Ctrl, 1 of 5
15 Dec 2023 00:44:42,745 INFO : 84% Done
15 Dec 2023 00:44:42,745 DEBUG: Calculating fold change for group comparison Ctrl vs DLB, 2 of 5
15 Dec 2023 00:44:56,836 INFO : 87% Done
15 Dec 2023 00:44:56,836 DEBUG: Calculating fold change for group comparison Ctrl vs FTD, 3 of 5
15 Dec 2023 00:45:10,517 INFO : 91% Done
15 Dec 2023 00:45:10,517 DEBUG: Calculating fold change for group comparison AD vs FTD, 4 of 5
15 Dec 2023 00:45:24,309 INFO : 94% Done
15 Dec 2023 00:45:24,309 DEBUG: Calculating fold change for group comparison FTD vs DLB, 5 of 5
15 Dec 2023 00:45:38,253 INFO : 98% Done
15 Dec 2023 00:45:38,253 INFO : Done calculating fold changes.
15 Dec 2023 00:45:38,279 WARN : Missed importing 1567 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.22_F2_S1-D7_1_2844.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1555 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.28_F2_S1-E7_1_2852.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1572 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.9_F2_S1-B7_1_2827.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1573 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.47_F2_S1-H7_1_2879.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1544 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.3_F2_S1-A4_1_3064.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1571 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6666.24_F2_S1-E8_1_2919.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1571 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6666.7_F2_S1-B8_1_2895.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1577 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.3_F2_S1-A7_1_2819.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1574 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.15_F2_S1-C7_1_2835.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1583 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.41_F2_S1-G7_1_2871.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1569 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6653.35_F2_S1-F7_1_2860.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1558 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6666.3_F2_S1-A8_1_2887.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1554 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6666.17_F2_S1-D8_1_2911.d
15 Dec 2023 00:45:38,280 WARN : Missed importing 1577 chromatograms from sample file D:\SILK\P017\CSF\Data\F2\CSF_6666.11_F2_S1-C8_1_2903.d
15 Dec 2023 00:45:38,280 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 00:45:39,400 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 00:45:43,920 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 00:45:45,637 INFO : Cleaning up temp tables
15 Dec 2023 00:45:46,005 INFO : Completed import of Skyline document from SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 00:45:46,007 INFO : 100% Done
15 Dec 2023 00:45:46,015 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179045/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip into the system
15 Dec 2023 00:45:46,017 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179048/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd into the system
15 Dec 2023 00:45:46,017 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179048/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd into the system
15 Dec 2023 00:45:46,018 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179048/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip into the system
15 Dec 2023 00:45:46,019 INFO : Starting import from SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 00:45:46,020 INFO : Starting to import Skyline document from SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 00:45:46,107 INFO : Expanding human.protdb
15 Dec 2023 00:45:49,093 INFO : Expanding CSF_P017_F2.imsdb
15 Dec 2023 00:45:49,120 INFO : Expanding SILK_P017_CSF_F2_a.blib
15 Dec 2023 00:45:50,337 INFO : Expanding SILK_P017_CSF_F2_a.redundant.blib
15 Dec 2023 00:45:56,325 INFO : Expanding SILK_P017_CSF_F2_a.skyd
15 Dec 2023 00:46:28,845 INFO : Expanding SILK_P017_CSF_F2_a.sky.view
15 Dec 2023 00:46:28,899 INFO : Expanding SILK_P017_CSF_F2_a.sky
15 Dec 2023 00:46:33,246 INFO : Expanding SILK_P017_CSF_F2_a.skyl
15 Dec 2023 00:48:26,128 DEBUG: Starting to load chromatogram headers
15 Dec 2023 00:48:27,573 DEBUG: Done loading chromatogram headers
15 Dec 2023 00:48:27,888 INFO : Inserting sp|A1L4H1|SRCRL_HUMAN
15 Dec 2023 00:48:27,900 WARN : 'SILK_P017_CSF_F2_turnover' library was not found in settings.
15 Dec 2023 00:48:28,193 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:28,193 INFO : Inserting sp|A6NC98|CC88B_HUMAN
15 Dec 2023 00:48:28,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:28,344 INFO : Inserting sp|A6NL88|SHSA7_HUMAN
15 Dec 2023 00:48:28,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:28,380 INFO : Inserting sp|A8MTJ3|GNAT3_HUMAN
15 Dec 2023 00:48:28,535 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:28,535 INFO : Inserting sp|B0I1T2|MYO1G_HUMAN
15 Dec 2023 00:48:28,776 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:48:28,777 INFO : Inserting sp|G2XKQ0|SUMO5_HUMAN
15 Dec 2023 00:48:28,807 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:28,807 INFO : Inserting sp|O00115|DNS2A_HUMAN
15 Dec 2023 00:48:29,004 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:29,004 INFO : Inserting sp|O00148|DX39A_HUMAN
15 Dec 2023 00:48:29,300 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:29,300 INFO : Inserting sp|O00160|MYO1F_HUMAN
15 Dec 2023 00:48:29,509 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:29,510 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 00:48:29,812 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:48:29,812 INFO : Inserting sp|O00231|PSD11_HUMAN
15 Dec 2023 00:48:29,976 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:29,976 INFO : Inserting sp|O00241|SIRB1_HUMAN
15 Dec 2023 00:48:30,040 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:30,040 INFO : Inserting sp|O00244|ATOX1_HUMAN
15 Dec 2023 00:48:30,112 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:30,112 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 00:48:30,644 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:48:30,644 INFO : Inserting sp|O00303|EIF3F_HUMAN
15 Dec 2023 00:48:30,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:30,698 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 00:48:31,287 INFO : 1% Done
15 Dec 2023 00:48:31,688 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:48:31,688 INFO : Inserting sp|O00451|GFRA2_HUMAN
15 Dec 2023 00:48:31,753 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:31,753 INFO : Inserting sp|O00461|GOLI4_HUMAN
15 Dec 2023 00:48:31,801 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:31,801 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 00:48:32,256 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:48:32,256 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 00:48:33,430 DEBUG: Total peptides inserted: 25
15 Dec 2023 00:48:33,430 INFO : Inserting sp|O00487|PSDE_HUMAN
15 Dec 2023 00:48:33,459 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:33,459 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 00:48:34,612 DEBUG: Total peptides inserted: 30
15 Dec 2023 00:48:34,613 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 00:48:34,793 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:34,793 INFO : Inserting sp|O00571|DDX3X_HUMAN
15 Dec 2023 00:48:34,912 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:34,912 INFO : Inserting sp|O00584|RNT2_HUMAN
15 Dec 2023 00:48:35,249 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:48:35,249 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 00:48:35,350 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:35,351 INFO : Inserting sp|O00754|MA2B1_HUMAN
15 Dec 2023 00:48:35,644 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:48:35,644 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 00:48:36,054 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:48:36,054 INFO : Inserting sp|O14579|COPE_HUMAN
15 Dec 2023 00:48:36,204 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:48:36,204 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 00:48:36,848 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:48:36,848 INFO : Inserting sp|O14646|CHD1_HUMAN
15 Dec 2023 00:48:36,880 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:36,880 INFO : Inserting sp|O14647|CHD2_HUMAN
15 Dec 2023 00:48:36,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:36,914 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 00:48:37,124 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:48:37,124 INFO : Inserting sp|O14727|APAF_HUMAN
15 Dec 2023 00:48:37,206 INFO : 2% Done
15 Dec 2023 00:48:37,317 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:37,317 INFO : Inserting sp|O14732|IMPA2_HUMAN
15 Dec 2023 00:48:37,395 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:37,395 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 00:48:37,516 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:37,516 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 00:48:37,947 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:37,947 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 00:48:38,183 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:48:38,183 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 00:48:38,335 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:38,335 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 00:48:38,662 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:48:38,663 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 00:48:39,131 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:48:39,132 INFO : Inserting sp|O14974|MYPT1_HUMAN
15 Dec 2023 00:48:39,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:39,169 INFO : Inserting sp|O14979|HNRDL_HUMAN
15 Dec 2023 00:48:39,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:39,222 INFO : Inserting sp|O14980|XPO1_HUMAN
15 Dec 2023 00:48:39,399 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:39,399 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 00:48:40,842 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:48:40,842 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 00:48:40,907 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:40,907 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 00:48:41,456 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:48:41,456 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 00:48:42,264 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:48:42,264 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 00:48:42,359 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:42,359 INFO : Inserting sp|O15162|PLS1_HUMAN
15 Dec 2023 00:48:42,409 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:42,409 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 00:48:42,766 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:42,766 INFO : Inserting sp|O15212|PFD6_HUMAN
15 Dec 2023 00:48:42,849 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:42,850 INFO : Inserting sp|O15240|VGF_HUMAN
15 Dec 2023 00:48:43,243 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:43,243 INFO : Inserting sp|O15371|EIF3D_HUMAN
15 Dec 2023 00:48:43,319 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:43,320 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 00:48:43,769 INFO : 3% Done
15 Dec 2023 00:48:43,827 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:48:43,827 INFO : Inserting sp|O15400|STX7_HUMAN
15 Dec 2023 00:48:43,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:43,897 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 00:48:44,156 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:44,156 INFO : Inserting sp|O15523|DDX3Y_HUMAN
15 Dec 2023 00:48:44,277 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:44,278 INFO : Inserting sp|O43143|DHX15_HUMAN
15 Dec 2023 00:48:44,407 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:44,407 INFO : Inserting sp|O43175|SERA_HUMAN
15 Dec 2023 00:48:44,466 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:44,466 INFO : Inserting sp|O43291|SPIT2_HUMAN
15 Dec 2023 00:48:44,504 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:44,505 INFO : Inserting sp|O43390|HNRPR_HUMAN
15 Dec 2023 00:48:44,981 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:48:44,981 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 00:48:45,020 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:45,020 INFO : Inserting sp|O43399|TPD54_HUMAN
15 Dec 2023 00:48:45,190 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:45,190 INFO : Inserting sp|O43405|COCH_HUMAN
15 Dec 2023 00:48:45,217 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:45,217 INFO : Inserting sp|O43451|MGA_HUMAN
15 Dec 2023 00:48:45,426 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:48:45,426 INFO : Inserting sp|O43493|TGON2_HUMAN
15 Dec 2023 00:48:45,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:45,463 INFO : Inserting sp|O43504|LTOR5_HUMAN
15 Dec 2023 00:48:45,522 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:45,522 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 00:48:45,788 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:45,788 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 00:48:45,853 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:45,853 INFO : Inserting sp|O43567|RNF13_HUMAN
15 Dec 2023 00:48:45,947 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:45,947 INFO : Inserting sp|O43581|SYT7_HUMAN
15 Dec 2023 00:48:45,965 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:45,965 INFO : Inserting sp|O43583|DENR_HUMAN
15 Dec 2023 00:48:46,002 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:46,002 INFO : Inserting sp|O43674|NDUB5_HUMAN
15 Dec 2023 00:48:46,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:46,055 INFO : Inserting sp|O43681|GET3_HUMAN
15 Dec 2023 00:48:46,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:46,103 INFO : Inserting sp|O43684|BUB3_HUMAN
15 Dec 2023 00:48:46,201 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:46,201 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 00:48:48,590 DEBUG: Total peptides inserted: 47
15 Dec 2023 00:48:48,590 INFO : Inserting sp|O43747|AP1G1_HUMAN
15 Dec 2023 00:48:48,701 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:48,702 INFO : Inserting sp|O43776|SYNC_HUMAN
15 Dec 2023 00:48:48,817 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:48,817 INFO : Inserting sp|O43827|ANGL7_HUMAN
15 Dec 2023 00:48:48,853 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:48,853 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 00:48:49,227 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:48:49,227 INFO : Inserting sp|O60216|RAD21_HUMAN
15 Dec 2023 00:48:49,317 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:49,317 INFO : Inserting sp|O60241|AGRB2_HUMAN
15 Dec 2023 00:48:49,448 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:49,449 INFO : Inserting sp|O60281|ZN292_HUMAN
15 Dec 2023 00:48:49,510 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:49,510 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 00:48:49,628 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:49,628 INFO : Inserting sp|O60486|PLXC1_HUMAN
15 Dec 2023 00:48:49,761 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:49,761 INFO : Inserting sp|O60493|SNX3_HUMAN
15 Dec 2023 00:48:49,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:49,828 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 00:48:50,266 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:48:50,266 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 00:48:50,276 INFO : 4% Done
15 Dec 2023 00:48:50,424 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:50,424 INFO : Inserting sp|O60603|TLR2_HUMAN
15 Dec 2023 00:48:50,460 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:50,460 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 00:48:50,701 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:50,701 INFO : Inserting sp|O60613|SEP15_HUMAN
15 Dec 2023 00:48:50,820 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:50,820 INFO : Inserting sp|O60664|PLIN3_HUMAN
15 Dec 2023 00:48:50,987 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:50,987 INFO : Inserting sp|O60667|FAIM3_HUMAN
15 Dec 2023 00:48:51,002 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:51,002 INFO : Inserting sp|O60749|SNX2_HUMAN
15 Dec 2023 00:48:51,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:51,056 INFO : Inserting sp|O60763|USO1_HUMAN
15 Dec 2023 00:48:51,203 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:51,203 INFO : Inserting sp|O60812|HNRC1_HUMAN
15 Dec 2023 00:48:51,390 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:51,390 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 00:48:51,507 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:51,507 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 00:48:51,668 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:51,668 INFO : Inserting sp|O75022|LIRB3_HUMAN
15 Dec 2023 00:48:51,741 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:51,741 INFO : Imported 100 peptide groups.
15 Dec 2023 00:48:51,741 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 00:48:52,510 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:48:52,510 INFO : Inserting sp|O75127|PTCD1_HUMAN
15 Dec 2023 00:48:52,684 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:52,684 INFO : Inserting sp|O75128|COBL_HUMAN
15 Dec 2023 00:48:52,703 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:52,703 INFO : Inserting sp|O75131|CPNE3_HUMAN
15 Dec 2023 00:48:53,301 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:48:53,301 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 00:48:53,462 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:53,462 INFO : Inserting sp|O75154|RFIP3_HUMAN
15 Dec 2023 00:48:53,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:53,533 INFO : Inserting sp|O75165|DJC13_HUMAN
15 Dec 2023 00:48:53,652 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:53,652 INFO : Inserting sp|O75173|ATS4_HUMAN
15 Dec 2023 00:48:53,901 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:53,901 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 00:48:54,046 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:48:54,046 INFO : Inserting sp|O75251|NDUS7_HUMAN
15 Dec 2023 00:48:54,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:54,088 INFO : Inserting sp|O75323|NIPS2_HUMAN
15 Dec 2023 00:48:54,124 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:54,125 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 00:48:54,933 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:48:54,933 INFO : Inserting sp|O75340|PDCD6_HUMAN
15 Dec 2023 00:48:55,047 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:55,047 INFO : Inserting sp|O75347|TBCA_HUMAN
15 Dec 2023 00:48:55,179 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:55,179 INFO : Inserting sp|O75351|VPS4B_HUMAN
15 Dec 2023 00:48:55,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:55,214 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 00:48:55,748 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:48:55,748 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 00:48:55,961 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:55,961 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 00:48:56,198 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:56,198 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 00:48:56,494 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:56,494 INFO : Inserting sp|O75396|SC22B_HUMAN
15 Dec 2023 00:48:56,593 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:56,593 INFO : Inserting sp|O75417|DPOLQ_HUMAN
15 Dec 2023 00:48:56,637 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:56,637 INFO : Inserting sp|O75436|VP26A_HUMAN
15 Dec 2023 00:48:56,804 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:56,804 INFO : Inserting sp|O75503|CLN5_HUMAN
15 Dec 2023 00:48:56,974 INFO : 5% Done
15 Dec 2023 00:48:57,031 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:57,031 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 00:48:57,373 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:48:57,374 INFO : Inserting sp|O75533|SF3B1_HUMAN
15 Dec 2023 00:48:57,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:57,424 INFO : Inserting sp|O75563|SKAP2_HUMAN
15 Dec 2023 00:48:57,655 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:48:57,655 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 00:48:58,014 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:48:58,014 INFO : Inserting sp|O75608|LYPA1_HUMAN
15 Dec 2023 00:48:58,063 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:48:58,063 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 00:48:58,369 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:48:58,369 INFO : Inserting sp|O75643|U520_HUMAN
15 Dec 2023 00:48:58,449 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:58,449 INFO : Inserting sp|O75688|PPM1B_HUMAN
15 Dec 2023 00:48:58,505 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:48:58,505 INFO : Inserting sp|O75695|XRP2_HUMAN
15 Dec 2023 00:48:58,692 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:48:58,692 INFO : Inserting sp|O75828|CBR3_HUMAN
15 Dec 2023 00:48:58,851 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:48:58,851 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 00:48:59,158 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:48:59,158 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 00:49:00,190 DEBUG: Total peptides inserted: 35
15 Dec 2023 00:49:00,190 INFO : Inserting sp|O75888|TNF13_HUMAN
15 Dec 2023 00:49:00,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:00,228 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 00:49:00,910 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:00,910 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 00:49:01,278 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:01,278 INFO : Inserting sp|O75976|CBPD_HUMAN
15 Dec 2023 00:49:01,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:01,329 INFO : Inserting sp|O75995|SASH3_HUMAN
15 Dec 2023 00:49:01,489 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:01,489 INFO : Inserting sp|O76014|KRT37_HUMAN
15 Dec 2023 00:49:01,554 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:01,554 INFO : Inserting sp|O76015|KRT38_HUMAN
15 Dec 2023 00:49:01,620 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:01,620 INFO : Inserting sp|O76071|CIAO1_HUMAN
15 Dec 2023 00:49:01,692 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:01,692 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 00:49:01,967 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:01,967 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 00:49:02,409 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:02,409 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 00:49:02,593 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:02,593 INFO : Inserting sp|O94811|TPPP_HUMAN
15 Dec 2023 00:49:02,765 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:02,765 INFO : Inserting sp|O94826|TOM70_HUMAN
15 Dec 2023 00:49:02,798 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:02,798 INFO : Inserting sp|O94851|MICA2_HUMAN
15 Dec 2023 00:49:02,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:02,852 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 00:49:03,320 INFO : 6% Done
15 Dec 2023 00:49:03,379 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:03,379 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 00:49:03,500 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:03,500 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 00:49:03,950 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:03,950 INFO : Inserting sp|O94972|TRI37_HUMAN
15 Dec 2023 00:49:04,054 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:04,054 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 00:49:05,309 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:49:05,309 INFO : Inserting sp|O95166|GBRAP_HUMAN
15 Dec 2023 00:49:05,343 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:05,344 INFO : Inserting sp|O95168|NDUB4_HUMAN
15 Dec 2023 00:49:05,422 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:05,422 INFO : Inserting sp|O95182|NDUA7_HUMAN
15 Dec 2023 00:49:05,511 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:05,511 INFO : Inserting sp|O95197|RTN3_HUMAN
15 Dec 2023 00:49:05,550 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:05,550 INFO : Inserting sp|O95202|LETM1_HUMAN
15 Dec 2023 00:49:05,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:05,594 INFO : Inserting sp|O95248|MTMR5_HUMAN
15 Dec 2023 00:49:05,625 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:05,626 INFO : Inserting sp|O95294|RASL1_HUMAN
15 Dec 2023 00:49:05,739 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:05,739 INFO : Inserting sp|O95319|CELF2_HUMAN
15 Dec 2023 00:49:05,797 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:05,797 INFO : Inserting sp|O95352|ATG7_HUMAN
15 Dec 2023 00:49:05,923 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:05,923 INFO : Inserting sp|O95372|LYPA2_HUMAN
15 Dec 2023 00:49:06,006 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:06,006 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 00:49:06,221 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:06,222 INFO : Inserting sp|O95466|FMNL1_HUMAN
15 Dec 2023 00:49:06,445 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:06,445 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 00:49:06,660 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:06,661 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 00:49:06,922 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:06,922 INFO : Inserting sp|O95498|VNN2_HUMAN
15 Dec 2023 00:49:07,140 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:07,140 INFO : Inserting sp|O95544|NADK_HUMAN
15 Dec 2023 00:49:07,282 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:07,282 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 00:49:07,452 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:07,452 INFO : Inserting sp|O95670|VATG2_HUMAN
15 Dec 2023 00:49:07,528 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:07,528 INFO : Inserting sp|O95714|HERC2_HUMAN
15 Dec 2023 00:49:07,659 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:07,659 INFO : Inserting sp|O95716|RAB3D_HUMAN
15 Dec 2023 00:49:07,806 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:07,806 INFO : Inserting sp|O95747|OXSR1_HUMAN
15 Dec 2023 00:49:07,905 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:07,905 INFO : Inserting sp|O95777|LSM8_HUMAN
15 Dec 2023 00:49:07,974 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:07,974 INFO : Inserting sp|O95782|AP2A1_HUMAN
15 Dec 2023 00:49:08,257 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:08,257 INFO : Inserting sp|O95834|EMAL2_HUMAN
15 Dec 2023 00:49:08,407 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:08,407 INFO : Inserting sp|O95861|BPNT1_HUMAN
15 Dec 2023 00:49:08,464 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:08,464 INFO : Inserting sp|O95865|DDAH2_HUMAN
15 Dec 2023 00:49:08,540 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:08,540 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 00:49:08,644 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:08,644 INFO : Inserting sp|O95970|LGI1_HUMAN
15 Dec 2023 00:49:08,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:08,655 INFO : Inserting sp|O95989|NUDT3_HUMAN
15 Dec 2023 00:49:08,665 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:08,665 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 00:49:09,139 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:49:09,139 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 00:49:09,180 INFO : 7% Done
15 Dec 2023 00:49:09,211 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:09,211 INFO : Inserting sp|P00367|DHE3_HUMAN
15 Dec 2023 00:49:09,363 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:09,363 INFO : Inserting sp|P00387|NB5R3_HUMAN
15 Dec 2023 00:49:09,396 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:09,396 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 00:49:09,599 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:09,599 INFO : Inserting sp|P00403|COX2_HUMAN
15 Dec 2023 00:49:09,619 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:09,619 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 00:49:09,736 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:09,736 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 00:49:10,668 DEBUG: Total peptides inserted: 39
15 Dec 2023 00:49:10,668 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 00:49:10,919 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:49:10,920 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 00:49:11,175 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:11,175 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 00:49:11,293 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:11,293 INFO : Inserting sp|P00505|AATM_HUMAN
15 Dec 2023 00:49:11,442 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:49:11,442 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 00:49:11,995 INFO : 8% Done
15 Dec 2023 00:49:12,010 DEBUG: Total peptides inserted: 30
15 Dec 2023 00:49:12,010 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 00:49:12,043 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:12,043 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 00:49:12,834 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:49:12,834 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 00:49:13,276 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:49:13,276 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 00:49:13,819 DEBUG: Total peptides inserted: 25
15 Dec 2023 00:49:13,819 INFO : Imported 200 peptide groups.
15 Dec 2023 00:49:13,819 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 00:49:14,134 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:49:14,134 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 00:49:14,275 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:14,275 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 00:49:14,420 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:49:14,420 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 00:49:14,907 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:49:14,907 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 00:49:15,039 INFO : 9% Done
15 Dec 2023 00:49:15,912 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:16,118 DEBUG: Total peptides inserted: 59
15 Dec 2023 00:49:16,118 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 00:49:16,384 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:49:16,384 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 00:49:17,239 DEBUG: Total peptides inserted: 41
15 Dec 2023 00:49:17,239 INFO : Inserting sp|P00813|ADA_HUMAN
15 Dec 2023 00:49:17,361 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:17,361 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 00:49:17,686 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:17,686 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 00:49:17,809 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:17,809 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 00:49:18,016 INFO : 10% Done
15 Dec 2023 00:49:18,401 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:49:18,401 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 00:49:18,981 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:49:18,981 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 00:49:19,796 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:49:19,796 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 00:49:20,011 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:20,011 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 00:49:20,849 INFO : 11% Done
15 Dec 2023 00:49:21,249 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:21,394 DEBUG: Total peptides inserted: 57
15 Dec 2023 00:49:21,395 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 00:49:22,438 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:23,656 DEBUG: Inserted 100 peptides
15 Dec 2023 00:49:23,816 INFO : 12% Done
15 Dec 2023 00:49:24,235 DEBUG: Total peptides inserted: 131
15 Dec 2023 00:49:24,235 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 00:49:25,017 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:25,298 DEBUG: Total peptides inserted: 66
15 Dec 2023 00:49:25,298 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 00:49:25,466 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:25,466 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 00:49:25,791 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:25,791 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 00:49:25,832 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:25,832 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 00:49:26,427 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:49:26,427 INFO : Inserting sp|P01111|RASN_HUMAN
15 Dec 2023 00:49:26,464 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,464 INFO : Inserting sp|P01116|RASK_HUMAN
15 Dec 2023 00:49:26,497 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,497 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 00:49:26,605 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,605 INFO : Inserting sp|P01236|PRL_HUMAN
15 Dec 2023 00:49:26,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:26,656 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 00:49:26,693 INFO : 13% Done
15 Dec 2023 00:49:26,731 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,732 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 00:49:26,794 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:26,794 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 00:49:26,824 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:26,824 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 00:49:26,856 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:26,856 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 00:49:26,891 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,891 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 00:49:26,961 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,961 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 00:49:26,991 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:26,991 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 00:49:27,024 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:27,024 INFO : Inserting sp|P01721|LV657_HUMAN
15 Dec 2023 00:49:27,048 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:27,048 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 00:49:27,080 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:27,080 INFO : Inserting sp|P01766|HV313_HUMAN
15 Dec 2023 00:49:27,156 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:27,156 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 00:49:27,220 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:27,221 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 00:49:27,307 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:27,307 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 00:49:27,384 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:27,384 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 00:49:27,532 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:27,532 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 00:49:27,766 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:27,766 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 00:49:27,993 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:27,993 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 00:49:28,270 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:49:28,270 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 00:49:28,525 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:28,525 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 00:49:28,839 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:49:28,839 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 00:49:29,079 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:29,079 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 00:49:29,185 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:29,185 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 00:49:29,269 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:29,269 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 00:49:29,396 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:29,396 INFO : Inserting sp|P01893|HLAH_HUMAN
15 Dec 2023 00:49:29,531 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:29,531 INFO : Inserting sp|P01903|DRA_HUMAN
15 Dec 2023 00:49:29,659 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:29,659 INFO : Inserting sp|P01906|DQA2_HUMAN
15 Dec 2023 00:49:29,688 INFO : 14% Done
15 Dec 2023 00:49:29,725 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:29,725 INFO : Inserting sp|P01911|DRB1_HUMAN
15 Dec 2023 00:49:29,763 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:29,763 INFO : Inserting sp|P01920|DQB1_HUMAN
15 Dec 2023 00:49:29,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:29,784 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 00:49:29,951 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:29,951 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 00:49:30,274 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:49:30,274 INFO : Inserting sp|P02458|CO2A1_HUMAN
15 Dec 2023 00:49:30,316 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:30,316 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 00:49:30,570 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:49:30,571 INFO : Inserting sp|P02462|CO4A1_HUMAN
15 Dec 2023 00:49:30,640 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:30,640 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 00:49:30,836 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:30,836 INFO : Inserting sp|P02538|K2C6A_HUMAN
15 Dec 2023 00:49:31,028 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:49:31,028 INFO : Inserting sp|P02545|LMNA_HUMAN
15 Dec 2023 00:49:31,113 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:31,113 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 00:49:31,765 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:49:31,765 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 00:49:32,450 INFO : 15% Done
15 Dec 2023 00:49:32,539 DEBUG: Total peptides inserted: 38
15 Dec 2023 00:49:32,540 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 00:49:32,663 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:32,663 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 00:49:32,741 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:32,741 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 00:49:32,808 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:32,808 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 00:49:32,867 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:32,867 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 00:49:33,622 DEBUG: Total peptides inserted: 45
15 Dec 2023 00:49:33,622 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 00:49:34,513 DEBUG: Total peptides inserted: 44
15 Dec 2023 00:49:34,513 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 00:49:35,050 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:49:35,051 INFO : Inserting sp|P02686|MBP_HUMAN
15 Dec 2023 00:49:35,135 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:35,135 INFO : Inserting sp|P02689|MYP2_HUMAN
15 Dec 2023 00:49:35,153 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:35,153 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 00:49:35,354 INFO : 16% Done
15 Dec 2023 00:49:35,389 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:35,389 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 00:49:35,476 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:35,477 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 00:49:35,573 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:35,573 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 00:49:35,637 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:35,637 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 00:49:35,768 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:35,768 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 00:49:35,858 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:35,858 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 00:49:36,181 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:49:36,181 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 00:49:36,417 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:36,417 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 00:49:36,770 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:36,770 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 00:49:37,600 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:38,331 INFO : 17% Done
15 Dec 2023 00:49:38,417 DEBUG: Total peptides inserted: 89
15 Dec 2023 00:49:38,418 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 00:49:38,678 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:38,678 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 00:49:39,055 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:49:39,056 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 00:49:39,192 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:39,192 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 00:49:39,484 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:39,485 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 00:49:39,744 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:39,744 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 00:49:40,922 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:40,980 DEBUG: Total peptides inserted: 52
15 Dec 2023 00:49:40,980 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 00:49:41,325 INFO : 18% Done
15 Dec 2023 00:49:41,773 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:49:41,773 INFO : Inserting sp|P02775|CXCL7_HUMAN
15 Dec 2023 00:49:41,876 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:41,876 INFO : Inserting sp|P02776|PLF4_HUMAN
15 Dec 2023 00:49:41,914 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:41,914 INFO : Inserting sp|P02778|CXL10_HUMAN
15 Dec 2023 00:49:41,956 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:41,956 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 00:49:42,141 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:42,142 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 00:49:43,077 DEBUG: Total peptides inserted: 46
15 Dec 2023 00:49:43,077 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 00:49:44,111 DEBUG: Total peptides inserted: 48
15 Dec 2023 00:49:44,111 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 00:49:44,190 INFO : 19% Done
15 Dec 2023 00:49:44,568 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:49:44,568 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 00:49:44,714 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:44,715 INFO : Inserting sp|P02794|FRIH_HUMAN
15 Dec 2023 00:49:45,045 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:49:45,045 INFO : Inserting sp|P02795|MT2_HUMAN
15 Dec 2023 00:49:45,060 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:45,060 INFO : Imported 300 peptide groups.
15 Dec 2023 00:49:45,060 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 00:49:45,162 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:45,162 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 00:49:45,442 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:49:45,442 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 00:49:45,980 DEBUG: Total peptides inserted: 35
15 Dec 2023 00:49:45,980 INFO : Inserting sp|P03973|SLPI_HUMAN
15 Dec 2023 00:49:46,007 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:46,007 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 00:49:46,515 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:49:46,515 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 00:49:46,773 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:49:46,773 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 00:49:47,144 INFO : 20% Done
15 Dec 2023 00:49:47,262 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:49:47,262 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 00:49:47,337 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:47,337 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 00:49:47,481 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:47,481 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 00:49:47,914 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:49:47,914 INFO : Inserting sp|P04080|CYTB_HUMAN
15 Dec 2023 00:49:47,946 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:47,946 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 00:49:48,327 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:49:48,328 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 00:49:49,328 DEBUG: Inserted 50 peptides
15 Dec 2023 00:49:50,101 INFO : 21% Done
15 Dec 2023 00:49:50,420 DEBUG: Inserted 100 peptides
15 Dec 2023 00:49:51,522 DEBUG: Inserted 150 peptides
15 Dec 2023 00:49:52,563 DEBUG: Inserted 200 peptides
15 Dec 2023 00:49:53,171 INFO : 22% Done
15 Dec 2023 00:49:53,288 DEBUG: Total peptides inserted: 236
15 Dec 2023 00:49:53,288 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 00:49:53,328 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:53,328 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 00:49:53,475 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:49:53,475 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 00:49:53,629 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:53,629 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 00:49:53,847 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:49:53,847 INFO : Inserting sp|P04216|THY1_HUMAN
15 Dec 2023 00:49:53,877 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:53,877 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 00:49:54,304 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:54,305 INFO : Inserting sp|P04259|K2C6B_HUMAN
15 Dec 2023 00:49:54,476 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:54,476 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 00:49:55,026 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:49:55,027 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 00:49:55,976 DEBUG: Total peptides inserted: 48
15 Dec 2023 00:49:55,976 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 00:49:56,029 INFO : 23% Done
15 Dec 2023 00:49:56,135 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:56,135 INFO : Inserting sp|P04350|TBB4A_HUMAN
15 Dec 2023 00:49:56,253 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:49:56,253 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 00:49:56,678 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:49:56,679 INFO : Inserting sp|P04424|ARLY_HUMAN
15 Dec 2023 00:49:56,777 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:56,777 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 00:49:56,934 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:49:56,934 INFO : Inserting sp|P04440|DPB1_HUMAN
15 Dec 2023 00:49:56,983 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:49:56,983 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 00:49:57,028 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:57,028 INFO : Inserting sp|P04732|MT1E_HUMAN
15 Dec 2023 00:49:57,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:57,045 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 00:49:57,060 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:49:57,060 INFO : Inserting sp|P04792|HSPB1_HUMAN
15 Dec 2023 00:49:57,116 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:57,116 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 00:49:57,208 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:49:57,208 INFO : Inserting sp|P04843|RPN1_HUMAN
15 Dec 2023 00:49:57,299 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:49:57,300 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 00:49:57,328 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:57,328 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 00:49:57,570 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:57,570 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 00:49:57,942 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:49:57,942 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 00:49:58,009 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:49:58,009 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 00:49:58,381 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:49:58,381 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 00:49:58,938 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:49:58,938 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 00:49:59,159 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:49:59,159 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 00:49:59,292 INFO : 24% Done
15 Dec 2023 00:49:59,321 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:49:59,321 INFO : Inserting sp|P05091|ALDH2_HUMAN
15 Dec 2023 00:49:59,356 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:49:59,356 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 00:49:59,791 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:49:59,791 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 00:50:00,003 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:00,003 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 00:50:00,091 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:00,091 INFO : Inserting sp|P05141|ADT2_HUMAN
15 Dec 2023 00:50:00,179 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:00,179 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 00:50:00,375 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:00,375 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 00:50:00,936 DEBUG: Total peptides inserted: 30
15 Dec 2023 00:50:00,936 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 00:50:01,299 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:50:01,299 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 00:50:01,790 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:50:01,790 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 00:50:02,372 INFO : 25% Done
15 Dec 2023 00:50:02,452 DEBUG: Total peptides inserted: 34
15 Dec 2023 00:50:02,453 INFO : Inserting sp|P05186|PPBT_HUMAN
15 Dec 2023 00:50:02,485 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:02,485 INFO : Inserting sp|P05198|IF2A_HUMAN
15 Dec 2023 00:50:02,551 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:02,551 INFO : Inserting sp|P05231|IL6_HUMAN
15 Dec 2023 00:50:02,574 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:02,575 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 00:50:02,748 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:02,748 INFO : Inserting sp|P05387|RLA2_HUMAN
15 Dec 2023 00:50:02,761 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:02,761 INFO : Inserting sp|P05388|RLA0_HUMAN
15 Dec 2023 00:50:02,820 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:02,820 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 00:50:02,879 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:02,880 INFO : Inserting sp|P05413|FABPH_HUMAN
15 Dec 2023 00:50:02,912 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:02,912 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 00:50:02,941 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:02,941 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 00:50:03,271 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:03,271 INFO : Inserting sp|P05455|LA_HUMAN
15 Dec 2023 00:50:03,335 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:03,335 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 00:50:03,728 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:50:03,728 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 00:50:04,073 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:04,073 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 00:50:04,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:04,132 INFO : Inserting sp|P05771|KPCB_HUMAN
15 Dec 2023 00:50:04,142 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:04,142 INFO : Inserting sp|P05787|K2C8_HUMAN
15 Dec 2023 00:50:04,199 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:04,199 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 00:50:04,320 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:04,320 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 00:50:04,421 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:04,421 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 00:50:04,579 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:04,579 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 00:50:04,613 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:04,613 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 00:50:05,413 DEBUG: Total peptides inserted: 30
15 Dec 2023 00:50:05,414 INFO : Inserting sp|P06576|ATPB_HUMAN
15 Dec 2023 00:50:05,619 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:05,619 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 00:50:06,249 DEBUG: Total peptides inserted: 34
15 Dec 2023 00:50:06,249 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 00:50:06,475 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:06,475 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 00:50:07,213 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:50:07,213 INFO : Inserting sp|P06730|IF4E_HUMAN
15 Dec 2023 00:50:07,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:07,225 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 00:50:07,744 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:50:07,744 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 00:50:08,275 DEBUG: Total peptides inserted: 35
15 Dec 2023 00:50:08,275 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 00:50:08,336 INFO : 26% Done
15 Dec 2023 00:50:08,561 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:50:08,561 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 00:50:08,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:08,593 INFO : Inserting sp|P06753|TPM3_HUMAN
15 Dec 2023 00:50:08,740 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:08,741 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 00:50:08,889 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:08,889 INFO : Inserting sp|P07099|HYEP_HUMAN
15 Dec 2023 00:50:08,912 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:08,912 INFO : Inserting sp|P07108|ACBP_HUMAN
15 Dec 2023 00:50:09,010 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:09,011 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 00:50:09,435 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:50:09,436 INFO : Inserting sp|P07196|NFL_HUMAN
15 Dec 2023 00:50:09,469 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:09,469 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 00:50:09,488 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:09,488 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 00:50:09,638 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:09,638 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 00:50:10,346 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:50:10,346 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 00:50:10,756 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:50:10,756 INFO : Inserting sp|P07332|FES_HUMAN
15 Dec 2023 00:50:10,786 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:10,786 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 00:50:11,062 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:11,062 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 00:50:11,331 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:50:11,332 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 00:50:11,525 INFO : 27% Done
15 Dec 2023 00:50:11,634 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:50:11,634 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 00:50:12,040 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:12,041 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 00:50:12,454 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:50:12,454 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 00:50:12,555 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:12,555 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 00:50:12,832 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:12,832 INFO : Imported 400 peptide groups.
15 Dec 2023 00:50:12,832 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 00:50:13,198 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:50:13,198 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 00:50:13,383 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:13,383 INFO : Inserting sp|P07477|TRY1_HUMAN
15 Dec 2023 00:50:13,440 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:13,440 INFO : Inserting sp|P07585|PGS2_HUMAN
15 Dec 2023 00:50:13,525 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:13,525 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 00:50:14,053 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:50:14,053 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 00:50:14,253 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:50:14,253 INFO : Inserting sp|P07711|CATL1_HUMAN
15 Dec 2023 00:50:14,360 INFO : 28% Done
15 Dec 2023 00:50:14,367 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:14,367 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 00:50:14,531 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:14,531 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 00:50:14,588 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:14,588 INFO : Inserting sp|P07741|APT_HUMAN
15 Dec 2023 00:50:14,617 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:14,617 INFO : Inserting sp|P07814|SYEP_HUMAN
15 Dec 2023 00:50:14,667 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:14,667 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 00:50:14,855 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:50:14,855 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 00:50:15,306 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:50:15,306 INFO : Inserting sp|P07910|HNRPC_HUMAN
15 Dec 2023 00:50:15,421 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:15,421 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 00:50:15,679 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:15,679 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 00:50:15,842 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:50:15,842 INFO : Inserting sp|P07954|FUMH_HUMAN
15 Dec 2023 00:50:15,935 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:15,935 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 00:50:16,397 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:50:16,397 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 00:50:16,553 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:16,553 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 00:50:17,061 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:50:17,061 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 00:50:17,457 INFO : 29% Done
15 Dec 2023 00:50:17,919 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:50:17,920 INFO : Inserting sp|P08138|TNR16_HUMAN
15 Dec 2023 00:50:17,955 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:17,955 INFO : Inserting sp|P08174|DAF_HUMAN
15 Dec 2023 00:50:18,105 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:18,105 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 00:50:18,257 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:18,259 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 00:50:18,628 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:18,628 INFO : Inserting sp|P08236|BGLR_HUMAN
15 Dec 2023 00:50:18,728 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:18,728 INFO : Inserting sp|P08237|PFKAM_HUMAN
15 Dec 2023 00:50:18,746 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:18,746 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 00:50:19,262 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:50:19,262 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 00:50:19,321 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:19,321 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 00:50:19,624 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:50:19,624 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 00:50:19,812 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:19,812 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 00:50:19,968 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:19,968 INFO : Inserting sp|P08473|NEP_HUMAN
15 Dec 2023 00:50:19,990 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:19,990 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 00:50:20,009 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:20,009 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 00:50:20,434 DEBUG: Total peptides inserted: 40
15 Dec 2023 00:50:20,434 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 00:50:20,489 INFO : 30% Done
15 Dec 2023 00:50:20,529 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:20,529 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 00:50:20,756 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:20,756 INFO : Inserting sp|P08572|CO4A2_HUMAN
15 Dec 2023 00:50:20,839 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:20,839 INFO : Inserting sp|P08574|CY1_HUMAN
15 Dec 2023 00:50:20,901 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:20,901 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 00:50:21,301 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:50:21,301 INFO : Inserting sp|P08582|TRFM_HUMAN
15 Dec 2023 00:50:21,404 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:21,404 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 00:50:22,187 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:22,599 DEBUG: Total peptides inserted: 77
15 Dec 2023 00:50:22,599 INFO : Inserting sp|P08621|RU17_HUMAN
15 Dec 2023 00:50:22,625 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:22,625 INFO : Inserting sp|P08631|HCK_HUMAN
15 Dec 2023 00:50:22,749 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:22,749 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 00:50:22,858 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:22,858 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 00:50:23,366 INFO : 31% Done
15 Dec 2023 00:50:23,673 DEBUG: Total peptides inserted: 33
15 Dec 2023 00:50:23,673 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 00:50:24,283 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:50:24,283 INFO : Inserting sp|P08709|FA7_HUMAN
15 Dec 2023 00:50:24,311 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:24,311 INFO : Inserting sp|P08727|K1C19_HUMAN
15 Dec 2023 00:50:24,503 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:24,503 INFO : Inserting sp|P08729|K2C7_HUMAN
15 Dec 2023 00:50:24,591 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:24,592 INFO : Inserting sp|P08754|GNAI3_HUMAN
15 Dec 2023 00:50:24,771 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:24,771 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 00:50:25,054 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:25,054 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 00:50:25,250 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:25,251 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 00:50:25,374 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:25,374 INFO : Inserting sp|P08962|CD63_HUMAN
15 Dec 2023 00:50:25,390 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:25,390 INFO : Inserting sp|P09012|SNRPA_HUMAN
15 Dec 2023 00:50:25,419 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:25,419 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 00:50:25,691 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:25,691 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 00:50:25,989 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:25,989 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 00:50:26,250 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:26,250 INFO : Inserting sp|P09234|RU1C_HUMAN
15 Dec 2023 00:50:26,270 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:26,270 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 00:50:26,332 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:26,332 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 00:50:26,500 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:26,500 INFO : Inserting sp|P09417|DHPR_HUMAN
15 Dec 2023 00:50:26,639 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:26,639 INFO : Inserting sp|P09429|HMGB1_HUMAN
15 Dec 2023 00:50:26,806 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:26,806 INFO : Inserting sp|P09455|RET1_HUMAN
15 Dec 2023 00:50:26,828 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:26,828 INFO : Inserting sp|P09467|F16P1_HUMAN
15 Dec 2023 00:50:26,845 INFO : 32% Done
15 Dec 2023 00:50:26,919 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:26,919 INFO : Inserting sp|P09471|GNAO_HUMAN
15 Dec 2023 00:50:27,005 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:27,005 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 00:50:27,352 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:27,352 INFO : Inserting sp|P09497|CLCB_HUMAN
15 Dec 2023 00:50:27,370 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:27,370 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 00:50:27,654 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:50:27,654 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 00:50:27,929 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:50:27,929 INFO : Inserting sp|P09601|HMOX1_HUMAN
15 Dec 2023 00:50:27,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:27,951 INFO : Inserting sp|P09603|CSF1_HUMAN
15 Dec 2023 00:50:28,108 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:28,108 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 00:50:28,138 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:28,138 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 00:50:28,221 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:28,221 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 00:50:28,396 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:28,396 INFO : Inserting sp|P09668|CATH_HUMAN
15 Dec 2023 00:50:28,478 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:28,478 INFO : Inserting sp|P09669|COX6C_HUMAN
15 Dec 2023 00:50:28,489 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:28,489 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 00:50:28,565 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:28,565 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 00:50:28,986 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:50:28,986 INFO : Inserting sp|P09917|LOX5_HUMAN
15 Dec 2023 00:50:29,081 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:29,081 INFO : Inserting sp|P09936|UCHL1_HUMAN
15 Dec 2023 00:50:29,122 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:29,122 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 00:50:29,529 INFO : 33% Done
15 Dec 2023 00:50:29,591 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:50:29,592 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 00:50:29,990 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:50:29,990 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 00:50:31,659 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:32,349 DEBUG: Total peptides inserted: 80
15 Dec 2023 00:50:32,349 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 00:50:32,861 INFO : 34% Done
15 Dec 2023 00:50:33,500 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:34,191 DEBUG: Total peptides inserted: 81
15 Dec 2023 00:50:34,191 INFO : Inserting sp|P0C0S5|H2AZ_HUMAN
15 Dec 2023 00:50:34,244 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:34,244 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 00:50:34,314 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:34,314 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 00:50:34,844 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:50:34,844 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 00:50:35,603 INFO : 35% Done
15 Dec 2023 00:50:36,117 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:36,518 DEBUG: Total peptides inserted: 63
15 Dec 2023 00:50:36,518 INFO : Inserting sp|P0DJI8|SAA1_HUMAN
15 Dec 2023 00:50:36,586 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:36,586 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 00:50:37,129 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:37,130 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 00:50:37,651 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:37,651 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 00:50:37,756 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:37,756 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 00:50:37,857 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:37,857 INFO : Inserting sp|P0DP23|CALM1_HUMAN
15 Dec 2023 00:50:37,986 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:37,986 INFO : Inserting sp|P0DP24|CALM2_HUMAN
15 Dec 2023 00:50:38,104 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:38,104 INFO : Inserting sp|P0DP25|CALM3_HUMAN
15 Dec 2023 00:50:38,225 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:38,225 INFO : Inserting sp|P0DP58|LYNX1_HUMAN
15 Dec 2023 00:50:38,262 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:38,263 INFO : Inserting sp|P0DTE7|AMY1B_HUMAN
15 Dec 2023 00:50:38,277 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,277 INFO : Imported 500 peptide groups.
15 Dec 2023 00:50:38,277 INFO : Inserting sp|P0DTE8|AMY1C_HUMAN
15 Dec 2023 00:50:38,290 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,290 INFO : Inserting sp|P0DUB6|AMY1A_HUMAN
15 Dec 2023 00:50:38,303 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,303 INFO : Inserting sp|P10124|SRGN_HUMAN
15 Dec 2023 00:50:38,400 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:38,400 INFO : Inserting sp|P10145|IL8_HUMAN
15 Dec 2023 00:50:38,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,420 INFO : Inserting sp|P10147|CCL3_HUMAN
15 Dec 2023 00:50:38,434 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,434 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 00:50:38,534 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:38,534 INFO : Inserting sp|P10155|RO60_HUMAN
15 Dec 2023 00:50:38,613 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:38,613 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 00:50:38,737 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:38,738 INFO : Inserting sp|P10301|RRAS_HUMAN
15 Dec 2023 00:50:38,763 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:38,763 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 00:50:38,856 INFO : 36% Done
15 Dec 2023 00:50:38,911 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:38,911 INFO : Inserting sp|P10412|H14_HUMAN
15 Dec 2023 00:50:39,044 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:39,044 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 00:50:39,230 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:39,230 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 00:50:39,376 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:39,376 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 00:50:39,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:39,401 INFO : Inserting sp|P10619|PPGB_HUMAN
15 Dec 2023 00:50:39,475 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:39,475 INFO : Inserting sp|P10636|TAU_HUMAN
15 Dec 2023 00:50:39,599 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:39,599 INFO : Inserting sp|P10636-9|TAU_HUMAN
15 Dec 2023 00:50:39,725 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:39,725 INFO : Inserting sp|P10636-8|TAU_HUMAN
15 Dec 2023 00:50:39,847 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:39,847 INFO : Inserting sp|P10636-7|TAU_HUMAN
15 Dec 2023 00:50:39,969 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:39,969 INFO : Inserting sp|P10636-6|TAU_HUMAN
15 Dec 2023 00:50:40,091 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:40,092 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 00:50:40,650 DEBUG: Total peptides inserted: 30
15 Dec 2023 00:50:40,650 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 00:50:40,789 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:40,789 INFO : Inserting sp|P10645|CMGA_HUMAN
15 Dec 2023 00:50:40,986 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:40,986 INFO : Inserting sp|P10720|PF4V_HUMAN
15 Dec 2023 00:50:41,022 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:41,022 INFO : Inserting sp|P10721|KIT_HUMAN
15 Dec 2023 00:50:41,079 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:41,079 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 00:50:41,232 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:41,232 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 00:50:41,361 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:41,361 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 00:50:41,462 INFO : 37% Done
15 Dec 2023 00:50:41,894 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:50:41,894 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 00:50:42,308 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:50:42,308 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 00:50:42,816 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:50:42,817 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 00:50:43,363 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:50:43,364 INFO : Inserting sp|P11166|GTR1_HUMAN
15 Dec 2023 00:50:43,376 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:43,376 INFO : Inserting sp|P11169|GTR3_HUMAN
15 Dec 2023 00:50:43,449 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:43,450 INFO : Inserting sp|P11171|EPB41_HUMAN
15 Dec 2023 00:50:43,491 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:43,491 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 00:50:44,382 DEBUG: Total peptides inserted: 36
15 Dec 2023 00:50:44,382 INFO : Inserting sp|P11216|PYGB_HUMAN
15 Dec 2023 00:50:44,532 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:44,532 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 00:50:44,677 INFO : 38% Done
15 Dec 2023 00:50:44,748 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:44,748 INFO : Inserting sp|P11233|RALA_HUMAN
15 Dec 2023 00:50:44,808 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:44,808 INFO : Inserting sp|P11234|RALB_HUMAN
15 Dec 2023 00:50:44,866 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:44,866 INFO : Inserting sp|P11274|BCR_HUMAN
15 Dec 2023 00:50:44,887 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:44,888 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 00:50:44,964 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:44,964 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 00:50:44,997 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:44,997 INFO : Inserting sp|P11310|ACADM_HUMAN
15 Dec 2023 00:50:45,028 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:45,028 INFO : Inserting sp|P11362|FGFR1_HUMAN
15 Dec 2023 00:50:45,160 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:45,160 INFO : Inserting sp|P11387|TOP1_HUMAN
15 Dec 2023 00:50:45,188 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:45,188 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 00:50:45,615 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:45,615 INFO : Inserting sp|P11488|GNAT1_HUMAN
15 Dec 2023 00:50:45,671 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:45,671 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 00:50:45,881 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:45,881 INFO : Inserting sp|P11766|ADHX_HUMAN
15 Dec 2023 00:50:45,995 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:45,996 INFO : Inserting sp|P11940|PABP1_HUMAN
15 Dec 2023 00:50:46,027 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:46,027 INFO : Inserting sp|P12036|NFH_HUMAN
15 Dec 2023 00:50:46,058 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:46,058 INFO : Inserting sp|P12081|HARS1_HUMAN
15 Dec 2023 00:50:46,137 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:46,137 INFO : Inserting sp|P12107|COBA1_HUMAN
15 Dec 2023 00:50:46,314 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:46,315 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 00:50:46,804 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:46,805 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 00:50:46,941 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:46,941 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 00:50:47,588 INFO : 39% Done
15 Dec 2023 00:50:47,748 DEBUG: Total peptides inserted: 47
15 Dec 2023 00:50:47,748 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 00:50:48,595 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:48,630 DEBUG: Total peptides inserted: 53
15 Dec 2023 00:50:48,630 INFO : Inserting sp|P12268|IMDH2_HUMAN
15 Dec 2023 00:50:48,672 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:48,672 INFO : Inserting sp|P12277|KCRB_HUMAN
15 Dec 2023 00:50:48,741 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:48,741 INFO : Inserting sp|P12318|FCG2A_HUMAN
15 Dec 2023 00:50:48,777 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:48,777 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 00:50:49,133 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:50:49,133 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 00:50:49,186 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:49,187 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 00:50:50,307 DEBUG: Inserted 50 peptides
15 Dec 2023 00:50:50,400 DEBUG: Total peptides inserted: 55
15 Dec 2023 00:50:50,400 INFO : Inserting sp|P12821|ACE_HUMAN
15 Dec 2023 00:50:50,491 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:50,491 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 00:50:50,500 INFO : 40% Done
15 Dec 2023 00:50:50,513 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:50,513 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 00:50:50,680 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:50,680 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 00:50:51,075 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:50:51,076 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 00:50:51,444 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:50:51,445 INFO : Inserting sp|P13164|IFM1_HUMAN
15 Dec 2023 00:50:51,474 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:51,475 INFO : Inserting sp|P13284|GILT_HUMAN
15 Dec 2023 00:50:51,663 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:51,663 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 00:50:51,726 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:51,726 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 00:50:52,087 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:52,087 INFO : Inserting sp|P13497|BMP1_HUMAN
15 Dec 2023 00:50:52,122 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:52,122 INFO : Inserting sp|P13498|CY24A_HUMAN
15 Dec 2023 00:50:52,157 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:52,157 INFO : Inserting sp|P13500|CCL2_HUMAN
15 Dec 2023 00:50:52,198 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:52,198 INFO : Inserting sp|P13521|SCG2_HUMAN
15 Dec 2023 00:50:52,308 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:52,309 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 00:50:52,662 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:50:52,662 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 00:50:52,704 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:50:52,704 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 00:50:53,178 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:50:53,178 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 00:50:53,558 DEBUG: Total peptides inserted: 25
15 Dec 2023 00:50:53,558 INFO : Inserting sp|P13640|MT1G_HUMAN
15 Dec 2023 00:50:53,570 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:53,570 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 00:50:53,730 INFO : 41% Done
15 Dec 2023 00:50:54,186 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:50:54,186 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 00:50:54,397 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:50:54,397 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 00:50:54,573 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:50:54,573 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 00:50:55,239 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:50:55,239 INFO : Inserting sp|P13693|TCTP_HUMAN
15 Dec 2023 00:50:55,354 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:55,354 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 00:50:55,444 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:55,444 INFO : Inserting sp|P13747|HLAE_HUMAN
15 Dec 2023 00:50:55,578 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:50:55,578 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 00:50:56,395 DEBUG: Total peptides inserted: 41
15 Dec 2023 00:50:56,395 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 00:50:56,570 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:56,570 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 00:50:56,638 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:56,639 INFO : Inserting sp|P13861|KAP2_HUMAN
15 Dec 2023 00:50:56,651 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:56,651 INFO : Inserting sp|P13929|ENOB_HUMAN
15 Dec 2023 00:50:56,672 INFO : 42% Done
15 Dec 2023 00:50:56,843 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:50:56,843 INFO : Inserting sp|P13987|CD59_HUMAN
15 Dec 2023 00:50:56,963 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:56,963 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 00:50:57,209 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:57,209 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 00:50:57,279 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:50:57,279 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 00:50:57,316 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:50:57,316 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 00:50:57,431 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:50:57,431 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 00:50:57,621 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:50:57,621 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 00:50:57,742 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:50:57,742 INFO : Imported 600 peptide groups.
15 Dec 2023 00:50:57,742 INFO : Inserting sp|P14324|FPPS_HUMAN
15 Dec 2023 00:50:57,779 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:57,779 INFO : Inserting sp|P14384|CBPM_HUMAN
15 Dec 2023 00:50:57,811 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:50:57,812 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 00:50:58,306 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:50:58,306 INFO : Inserting sp|P14550|AK1A1_HUMAN
15 Dec 2023 00:50:58,525 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:50:58,525 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 00:50:58,828 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:50:58,828 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 00:50:59,518 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:50:59,518 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 00:50:59,778 INFO : 43% Done
15 Dec 2023 00:50:59,871 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:50:59,871 INFO : Inserting sp|P14678|RSMB_HUMAN
15 Dec 2023 00:50:59,932 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:50:59,932 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 00:51:00,374 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:51:00,374 INFO : Inserting sp|P14866|HNRPL_HUMAN
15 Dec 2023 00:51:00,421 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:00,421 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 00:51:00,454 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:00,454 INFO : Inserting sp|P15090|FABP4_HUMAN
15 Dec 2023 00:51:00,471 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:00,471 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 00:51:00,520 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:00,520 INFO : Inserting sp|P15121|ALDR_HUMAN
15 Dec 2023 00:51:00,577 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:00,577 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 00:51:00,830 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:00,830 INFO : Inserting sp|P15151|PVR_HUMAN
15 Dec 2023 00:51:00,897 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:00,897 INFO : Inserting sp|P15153|RAC2_HUMAN
15 Dec 2023 00:51:00,995 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:00,995 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 00:51:01,201 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:01,201 INFO : Inserting sp|P15289|ARSA_HUMAN
15 Dec 2023 00:51:01,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:01,220 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 00:51:01,292 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:01,292 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 00:51:01,662 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:51:01,662 INFO : Inserting sp|P15328|FOLR1_HUMAN
15 Dec 2023 00:51:01,783 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:01,783 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 00:51:01,809 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:01,809 INFO : Inserting sp|P15502|ELN_HUMAN
15 Dec 2023 00:51:01,821 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:01,821 INFO : Inserting sp|P15509|CSF2R_HUMAN
15 Dec 2023 00:51:01,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:01,840 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 00:51:01,974 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:01,974 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 00:51:02,092 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:02,092 INFO : Inserting sp|P15848|ARSB_HUMAN
15 Dec 2023 00:51:02,118 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:02,118 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 00:51:02,279 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:02,279 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 00:51:02,332 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:02,332 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 00:51:02,410 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:02,410 INFO : Inserting sp|P16112|PGCA_HUMAN
15 Dec 2023 00:51:02,441 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:02,441 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 00:51:02,586 INFO : 44% Done
15 Dec 2023 00:51:02,608 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:02,608 INFO : Inserting sp|P16284|PECA1_HUMAN
15 Dec 2023 00:51:02,652 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:02,653 INFO : Inserting sp|P16298|PP2BB_HUMAN
15 Dec 2023 00:51:02,703 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:02,703 INFO : Inserting sp|P16401|H15_HUMAN
15 Dec 2023 00:51:02,819 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:02,819 INFO : Inserting sp|P16402|H13_HUMAN
15 Dec 2023 00:51:02,964 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:02,965 INFO : Inserting sp|P16403|H12_HUMAN
15 Dec 2023 00:51:03,120 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:03,120 INFO : Inserting sp|P16435|NCPR_HUMAN
15 Dec 2023 00:51:03,181 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:03,181 INFO : Inserting sp|P16615|AT2A2_HUMAN
15 Dec 2023 00:51:03,207 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:03,207 INFO : Inserting sp|P16619|CL3L1_HUMAN
15 Dec 2023 00:51:03,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:03,220 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 00:51:03,599 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:51:03,599 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 00:51:03,719 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:03,719 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 00:51:03,821 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:03,821 INFO : Inserting sp|P17050|NAGAB_HUMAN
15 Dec 2023 00:51:03,898 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:03,898 INFO : Inserting sp|P17066|HSP76_HUMAN
15 Dec 2023 00:51:04,068 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:04,068 INFO : Inserting sp|P17174|AATC_HUMAN
15 Dec 2023 00:51:04,283 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:04,283 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 00:51:04,429 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:04,429 INFO : Inserting sp|P17302|CXA1_HUMAN
15 Dec 2023 00:51:04,446 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:04,447 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 00:51:04,603 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:04,603 INFO : Inserting sp|P17612|KAPCA_HUMAN
15 Dec 2023 00:51:04,639 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:04,639 INFO : Inserting sp|P17693|HLAG_HUMAN
15 Dec 2023 00:51:04,667 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:04,668 INFO : Inserting sp|P17844|DDX5_HUMAN
15 Dec 2023 00:51:04,772 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:04,773 INFO : Inserting sp|P17858|PFKAL_HUMAN
15 Dec 2023 00:51:04,907 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:04,907 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 00:51:05,055 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:05,055 INFO : Inserting sp|P17927|CR1_HUMAN
15 Dec 2023 00:51:05,232 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:05,232 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 00:51:05,363 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:05,363 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 00:51:05,528 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:05,529 INFO : Inserting sp|P17980|PRS6A_HUMAN
15 Dec 2023 00:51:05,607 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:05,607 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 00:51:05,710 INFO : 45% Done
15 Dec 2023 00:51:05,795 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:05,795 INFO : Inserting sp|P18054|LOX12_HUMAN
15 Dec 2023 00:51:05,819 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:05,819 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 00:51:06,027 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:06,027 INFO : Inserting sp|P18124|RL7_HUMAN
15 Dec 2023 00:51:06,051 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:06,051 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 00:51:06,881 DEBUG: Inserted 50 peptides
15 Dec 2023 00:51:06,950 DEBUG: Total peptides inserted: 53
15 Dec 2023 00:51:06,950 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 00:51:07,013 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:07,013 INFO : Inserting sp|P18510|IL1RA_HUMAN
15 Dec 2023 00:51:07,102 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:07,102 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 00:51:07,498 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:51:07,499 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 00:51:07,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:07,511 INFO : Inserting sp|P19013|K2C4_HUMAN
15 Dec 2023 00:51:07,562 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:07,563 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 00:51:07,823 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:51:07,823 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 00:51:08,078 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:51:08,078 INFO : Inserting sp|P19087|GNAT2_HUMAN
15 Dec 2023 00:51:08,131 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:08,131 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 00:51:08,348 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:08,349 INFO : Inserting sp|P19256|LFA3_HUMAN
15 Dec 2023 00:51:08,385 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:08,385 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 00:51:08,694 INFO : 46% Done
15 Dec 2023 00:51:08,932 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:51:08,932 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 00:51:09,180 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:09,180 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 00:51:09,351 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:09,351 INFO : Inserting sp|P19438|TNR1A_HUMAN
15 Dec 2023 00:51:09,370 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:09,370 INFO : Inserting sp|P19447|ERCC3_HUMAN
15 Dec 2023 00:51:09,390 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:09,390 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 00:51:09,568 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:09,569 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 00:51:10,258 DEBUG: Total peptides inserted: 33
15 Dec 2023 00:51:10,258 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 00:51:11,030 DEBUG: Total peptides inserted: 36
15 Dec 2023 00:51:11,030 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 00:51:11,180 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:11,180 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 00:51:11,487 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:11,487 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 00:51:11,870 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:11,870 INFO : Inserting sp|P20036|DPA1_HUMAN
15 Dec 2023 00:51:11,884 INFO : 47% Done
15 Dec 2023 00:51:11,925 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:11,925 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 00:51:12,052 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:12,053 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 00:51:12,201 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:12,201 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 00:51:12,313 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:12,313 INFO : Inserting sp|P20138|CD33_HUMAN
15 Dec 2023 00:51:12,335 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:12,335 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 00:51:12,451 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:12,451 INFO : Inserting sp|P20333|TNR1B_HUMAN
15 Dec 2023 00:51:12,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:12,464 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 00:51:12,501 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:12,501 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 00:51:12,657 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:12,657 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 00:51:12,721 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:12,721 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 00:51:13,391 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:51:13,391 INFO : Inserting sp|P20701|ITAL_HUMAN
15 Dec 2023 00:51:13,477 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:13,477 INFO : Inserting sp|P20702|ITAX_HUMAN
15 Dec 2023 00:51:13,565 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:13,565 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 00:51:14,093 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:51:14,093 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 00:51:14,341 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:14,341 INFO : Imported 700 peptide groups.
15 Dec 2023 00:51:14,341 INFO : Inserting sp|P20794|MAK_HUMAN
15 Dec 2023 00:51:14,368 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:14,368 INFO : Inserting sp|P20810|ICAL_HUMAN
15 Dec 2023 00:51:14,416 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:14,416 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 00:51:14,536 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:14,536 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 00:51:14,722 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:14,722 INFO : Inserting sp|P20916|MAG_HUMAN
15 Dec 2023 00:51:14,739 INFO : 48% Done
15 Dec 2023 00:51:14,775 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:14,775 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 00:51:14,845 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:14,845 INFO : Inserting sp|P21246|PTN_HUMAN
15 Dec 2023 00:51:14,882 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:14,882 INFO : Inserting sp|P21266|GSTM3_HUMAN
15 Dec 2023 00:51:14,919 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:14,919 INFO : Inserting sp|P21281|VATB2_HUMAN
15 Dec 2023 00:51:15,035 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:15,035 INFO : Inserting sp|P21283|VATC1_HUMAN
15 Dec 2023 00:51:15,076 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:15,077 INFO : Inserting sp|P21291|CSRP1_HUMAN
15 Dec 2023 00:51:15,094 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:15,094 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 00:51:15,845 DEBUG: Inserted 50 peptides
15 Dec 2023 00:51:16,491 DEBUG: Total peptides inserted: 86
15 Dec 2023 00:51:16,491 INFO : Inserting sp|P21399|ACOHC_HUMAN
15 Dec 2023 00:51:16,514 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:16,514 INFO : Inserting sp|P21579|SYT1_HUMAN
15 Dec 2023 00:51:16,717 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:16,717 INFO : Inserting sp|P21730|C5AR1_HUMAN
15 Dec 2023 00:51:16,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:16,737 INFO : Inserting sp|P21741|MK_HUMAN
15 Dec 2023 00:51:16,750 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:16,750 INFO : Inserting sp|P21796|VDAC1_HUMAN
15 Dec 2023 00:51:16,805 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:16,805 INFO : Inserting sp|P21802|FGFR2_HUMAN
15 Dec 2023 00:51:16,900 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:16,901 INFO : Inserting sp|P21810|PGS1_HUMAN
15 Dec 2023 00:51:16,992 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:16,992 INFO : Inserting sp|P21926|CD9_HUMAN
15 Dec 2023 00:51:17,034 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:17,034 INFO : Inserting sp|P22004|BMP6_HUMAN
15 Dec 2023 00:51:17,070 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:17,070 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 00:51:17,155 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:17,155 INFO : Inserting sp|P22102|PUR2_HUMAN
15 Dec 2023 00:51:17,202 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:17,202 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 00:51:17,605 INFO : 49% Done
15 Dec 2023 00:51:18,316 DEBUG: Inserted 50 peptides
15 Dec 2023 00:51:19,001 DEBUG: Total peptides inserted: 77
15 Dec 2023 00:51:19,001 INFO : Inserting sp|P22234|PUR6_HUMAN
15 Dec 2023 00:51:19,069 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:19,069 INFO : Inserting sp|P22304|IDS_HUMAN
15 Dec 2023 00:51:19,146 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:19,146 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 00:51:19,720 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:51:19,720 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 00:51:19,845 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:19,845 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 00:51:19,964 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:19,964 INFO : Inserting sp|P22607|FGFR3_HUMAN
15 Dec 2023 00:51:19,995 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:19,995 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 00:51:20,195 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:20,195 INFO : Inserting sp|P22692|IBP4_HUMAN
15 Dec 2023 00:51:20,431 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:20,431 INFO : Inserting sp|P22694|KAPCB_HUMAN
15 Dec 2023 00:51:20,460 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:20,460 INFO : Inserting sp|P22748|CAH4_HUMAN
15 Dec 2023 00:51:20,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:20,528 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 00:51:20,710 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:20,710 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 00:51:20,764 INFO : 50% Done
15 Dec 2023 00:51:20,908 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:20,908 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 00:51:21,042 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:21,042 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 00:51:21,604 DEBUG: Total peptides inserted: 42
15 Dec 2023 00:51:21,604 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 00:51:21,628 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:21,628 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 00:51:21,702 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:21,702 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 00:51:22,530 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:51:22,530 INFO : Inserting sp|P23246|SFPQ_HUMAN
15 Dec 2023 00:51:22,640 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:22,640 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 00:51:22,805 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:22,805 INFO : Inserting sp|P23368|MAOM_HUMAN
15 Dec 2023 00:51:22,879 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:22,879 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 00:51:23,158 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:51:23,158 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 00:51:23,424 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:51:23,424 INFO : Inserting sp|P23469|PTPRE_HUMAN
15 Dec 2023 00:51:23,458 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:23,458 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 00:51:23,651 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:23,652 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 00:51:23,805 INFO : 51% Done
15 Dec 2023 00:51:23,975 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:51:23,975 INFO : Inserting sp|P23515|OMGP_HUMAN
15 Dec 2023 00:51:24,105 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:24,105 INFO : Inserting sp|P23526|SAHH_HUMAN
15 Dec 2023 00:51:24,391 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:24,391 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 00:51:24,626 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:24,627 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 00:51:25,021 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:51:25,021 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 00:51:25,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:25,039 INFO : Inserting sp|P24534|EF1B_HUMAN
15 Dec 2023 00:51:25,130 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:25,130 INFO : Inserting sp|P24539|AT5F1_HUMAN
15 Dec 2023 00:51:25,145 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:25,145 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 00:51:25,413 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:25,413 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 00:51:25,561 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:25,561 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 00:51:25,614 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:25,614 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 00:51:26,325 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:51:26,325 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 00:51:26,439 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:26,439 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 00:51:26,844 INFO : 52% Done
15 Dec 2023 00:51:26,880 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:51:26,880 INFO : Inserting sp|P25391|LAMA1_HUMAN
15 Dec 2023 00:51:26,901 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:26,901 INFO : Inserting sp|P25398|RS12_HUMAN
15 Dec 2023 00:51:26,961 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:26,961 INFO : Inserting sp|P25705|ATPA_HUMAN
15 Dec 2023 00:51:27,159 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:27,159 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 00:51:27,283 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:27,283 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 00:51:27,446 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:27,446 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 00:51:27,574 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:27,574 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 00:51:27,677 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:27,677 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 00:51:27,810 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:27,810 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 00:51:27,855 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:27,855 INFO : Inserting sp|P26022|PTX3_HUMAN
15 Dec 2023 00:51:27,955 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:27,955 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 00:51:28,648 DEBUG: Total peptides inserted: 38
15 Dec 2023 00:51:28,648 INFO : Inserting sp|P26358|DNMT1_HUMAN
15 Dec 2023 00:51:28,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:28,677 INFO : Inserting sp|P26368|U2AF2_HUMAN
15 Dec 2023 00:51:28,709 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:28,709 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 00:51:28,796 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:28,796 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 00:51:28,834 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:28,834 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 00:51:28,997 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:28,997 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 00:51:29,045 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:29,045 INFO : Inserting sp|P26639|SYTC_HUMAN
15 Dec 2023 00:51:29,259 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:29,259 INFO : Inserting sp|P26640|SYVC_HUMAN
15 Dec 2023 00:51:29,278 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:29,278 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 00:51:29,412 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:29,412 INFO : Inserting sp|P26885|FKBP2_HUMAN
15 Dec 2023 00:51:29,438 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:29,438 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 00:51:29,622 INFO : 53% Done
15 Dec 2023 00:51:29,853 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:51:29,853 INFO : Inserting sp|P26992|CNTFR_HUMAN
15 Dec 2023 00:51:29,898 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:29,898 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 00:51:30,080 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:30,080 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 00:51:30,304 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:30,305 INFO : Inserting sp|P27338|AOFB_HUMAN
15 Dec 2023 00:51:30,361 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:30,361 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 00:51:30,621 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:30,622 INFO : Inserting sp|P27361|MK03_HUMAN
15 Dec 2023 00:51:30,727 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:30,728 INFO : Inserting sp|P27694|RFA1_HUMAN
15 Dec 2023 00:51:30,799 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:30,800 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 00:51:31,049 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:31,049 INFO : Inserting sp|P27701|CD82_HUMAN
15 Dec 2023 00:51:31,118 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:31,118 INFO : Inserting sp|P27707|DCK_HUMAN
15 Dec 2023 00:51:31,137 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:31,137 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 00:51:31,266 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:31,266 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 00:51:31,379 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:31,379 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 00:51:31,579 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:31,579 INFO : Inserting sp|P28062|PSB8_HUMAN
15 Dec 2023 00:51:31,728 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:31,728 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 00:51:31,831 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:31,831 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 00:51:31,917 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:31,917 INFO : Imported 800 peptide groups.
15 Dec 2023 00:51:31,917 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 00:51:32,038 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:32,038 INFO : Inserting sp|P28072|PSB6_HUMAN
15 Dec 2023 00:51:32,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:32,132 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 00:51:32,143 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:32,143 INFO : Inserting sp|P28300|LYOX_HUMAN
15 Dec 2023 00:51:32,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:32,162 INFO : Inserting sp|P28482|MK01_HUMAN
15 Dec 2023 00:51:32,378 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:32,378 INFO : Inserting sp|P28676|GRAN_HUMAN
15 Dec 2023 00:51:32,566 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:32,566 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 00:51:32,656 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:32,656 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 00:51:32,723 INFO : 54% Done
15 Dec 2023 00:51:32,879 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:32,880 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 00:51:32,956 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:32,956 INFO : Inserting sp|P29218|IMPA1_HUMAN
15 Dec 2023 00:51:32,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:32,985 INFO : Inserting sp|P29279|CCN2_HUMAN
15 Dec 2023 00:51:33,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:33,019 INFO : Inserting sp|P29323|EPHB2_HUMAN
15 Dec 2023 00:51:33,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:33,038 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 00:51:33,347 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:51:33,347 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 00:51:33,959 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:51:33,959 INFO : Inserting sp|P29459|IL12A_HUMAN
15 Dec 2023 00:51:34,000 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:34,000 INFO : Inserting sp|P29466|CASP1_HUMAN
15 Dec 2023 00:51:34,107 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:34,108 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 00:51:34,609 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:51:34,609 INFO : Inserting sp|P29692|EF1D_HUMAN
15 Dec 2023 00:51:34,761 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:34,761 INFO : Inserting sp|P29972|AQP1_HUMAN
15 Dec 2023 00:51:34,794 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:34,794 INFO : Inserting sp|P30040|ERP29_HUMAN
15 Dec 2023 00:51:34,835 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:34,835 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 00:51:34,937 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:34,937 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 00:51:35,024 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:35,024 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 00:51:35,249 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:35,249 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 00:51:35,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:35,297 INFO : Inserting sp|P30048|PRDX3_HUMAN
15 Dec 2023 00:51:35,393 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:35,393 INFO : Inserting sp|P30050|RL12_HUMAN
15 Dec 2023 00:51:35,533 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:35,534 INFO : Inserting sp|P30084|ECHM_HUMAN
15 Dec 2023 00:51:35,559 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:35,559 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 00:51:35,633 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:35,633 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 00:51:35,900 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:35,900 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 00:51:35,912 INFO : 55% Done
15 Dec 2023 00:51:36,124 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:36,124 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 00:51:36,357 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:36,357 INFO : Inserting sp|P30273|FCERG_HUMAN
15 Dec 2023 00:51:36,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:36,374 INFO : Inserting sp|P30520|PURA2_HUMAN
15 Dec 2023 00:51:36,638 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:36,638 INFO : Inserting sp|P30530|UFO_HUMAN
15 Dec 2023 00:51:36,834 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:36,834 INFO : Inserting sp|P30566|PUR8_HUMAN
15 Dec 2023 00:51:36,870 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:36,870 INFO : Inserting sp|P30613|KPYR_HUMAN
15 Dec 2023 00:51:36,931 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:36,931 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 00:51:37,587 DEBUG: Total peptides inserted: 26
15 Dec 2023 00:51:37,587 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 00:51:37,921 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:51:37,921 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 00:51:38,224 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:51:38,224 INFO : Inserting sp|P31153|METK2_HUMAN
15 Dec 2023 00:51:38,314 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:38,314 INFO : Inserting sp|P31321|KAP1_HUMAN
15 Dec 2023 00:51:38,325 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:38,326 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 00:51:38,516 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:38,516 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 00:51:38,740 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:38,740 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 00:51:38,863 INFO : 56% Done
15 Dec 2023 00:51:38,894 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:38,894 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 00:51:38,916 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:38,916 INFO : Inserting sp|P31997|CEAM8_HUMAN
15 Dec 2023 00:51:38,988 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:38,988 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 00:51:38,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:38,997 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 00:51:39,078 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:39,078 INFO : Inserting sp|P32121|ARRB2_HUMAN
15 Dec 2023 00:51:39,164 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:39,164 INFO : Inserting sp|P32320|CDD_HUMAN
15 Dec 2023 00:51:39,279 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:39,279 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 00:51:39,491 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:39,491 INFO : Inserting sp|P32456|GBP2_HUMAN
15 Dec 2023 00:51:39,594 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:39,595 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 00:51:39,677 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:39,678 INFO : Inserting sp|P32969|RL9_HUMAN
15 Dec 2023 00:51:39,715 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:39,715 INFO : Inserting sp|P33121|ACSL1_HUMAN
15 Dec 2023 00:51:39,752 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:39,752 INFO : Inserting sp|P33151|CADH5_HUMAN
15 Dec 2023 00:51:39,822 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:39,822 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 00:51:39,910 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:39,910 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 00:51:40,049 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:40,049 INFO : Inserting sp|P34059|GALNS_HUMAN
15 Dec 2023 00:51:40,091 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:40,091 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 00:51:40,187 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:40,188 INFO : Inserting sp|P34896|GLYC_HUMAN
15 Dec 2023 00:51:40,268 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:40,269 INFO : Inserting sp|P34910|EVI2B_HUMAN
15 Dec 2023 00:51:40,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:40,319 INFO : Inserting sp|P34931|HS71L_HUMAN
15 Dec 2023 00:51:40,521 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:40,521 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 00:51:40,809 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:51:40,809 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 00:51:40,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:40,825 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 00:51:40,869 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:40,869 INFO : Inserting sp|P35080|PROF2_HUMAN
15 Dec 2023 00:51:40,879 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:40,880 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 00:51:41,084 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:41,084 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 00:51:41,307 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:51:41,307 INFO : Inserting sp|P35247|SFTPD_HUMAN
15 Dec 2023 00:51:41,329 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:41,329 INFO : Inserting sp|P35268|RL22_HUMAN
15 Dec 2023 00:51:41,354 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:41,354 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 00:51:41,571 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:51:41,571 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 00:51:41,659 INFO : 57% Done
15 Dec 2023 00:51:41,702 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:41,702 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 00:51:42,321 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:51:42,321 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 00:51:43,019 DEBUG: Total peptides inserted: 38
15 Dec 2023 00:51:43,019 INFO : Inserting sp|P35556|FBN2_HUMAN
15 Dec 2023 00:51:43,106 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:43,106 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 00:51:44,186 DEBUG: Inserted 50 peptides
15 Dec 2023 00:51:44,751 INFO : 58% Done
15 Dec 2023 00:51:45,123 DEBUG: Total peptides inserted: 85
15 Dec 2023 00:51:45,123 INFO : Inserting sp|P35580|MYH10_HUMAN
15 Dec 2023 00:51:45,500 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:51:45,500 INFO : Inserting sp|P35606|COPB2_HUMAN
15 Dec 2023 00:51:45,567 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:45,567 INFO : Inserting sp|P35609|ACTN2_HUMAN
15 Dec 2023 00:51:45,898 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:51:45,898 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 00:51:45,952 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:45,952 INFO : Inserting sp|P35626|ARBK2_HUMAN
15 Dec 2023 00:51:46,011 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:46,011 INFO : Inserting sp|P35637|FUS_HUMAN
15 Dec 2023 00:51:46,048 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:46,048 INFO : Inserting sp|P35659|DEK_HUMAN
15 Dec 2023 00:51:46,101 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:46,101 INFO : Inserting sp|P35749|MYH11_HUMAN
15 Dec 2023 00:51:46,452 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:51:46,453 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 00:51:46,583 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:46,583 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 00:51:47,091 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:51:47,091 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 00:51:47,439 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:51:47,439 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 00:51:47,534 INFO : 59% Done
15 Dec 2023 00:51:47,679 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:47,679 INFO : Inserting sp|P36269|GGT5_HUMAN
15 Dec 2023 00:51:47,725 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:47,725 INFO : Inserting sp|P36507|MP2K2_HUMAN
15 Dec 2023 00:51:47,746 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:47,746 INFO : Inserting sp|P36543|VATE1_HUMAN
15 Dec 2023 00:51:47,842 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:47,842 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 00:51:48,160 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:51:48,160 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 00:51:48,508 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:51:48,508 INFO : Inserting sp|P36957|ODO2_HUMAN
15 Dec 2023 00:51:48,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:48,533 INFO : Inserting sp|P36959|GMPR1_HUMAN
15 Dec 2023 00:51:48,545 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:48,545 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 00:51:48,678 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:48,678 INFO : Inserting sp|P37173|TGFR2_HUMAN
15 Dec 2023 00:51:48,707 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:48,707 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 00:51:48,832 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:48,832 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 00:51:49,171 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:51:49,171 INFO : Imported 900 peptide groups.
15 Dec 2023 00:51:49,171 INFO : Inserting sp|P38159|RBMX_HUMAN
15 Dec 2023 00:51:49,230 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:49,230 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 00:51:49,496 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:51:49,496 INFO : Inserting sp|P38646|GRP75_HUMAN
15 Dec 2023 00:51:49,582 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:49,582 INFO : Inserting sp|P38919|IF4A3_HUMAN
15 Dec 2023 00:51:49,656 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:49,656 INFO : Inserting sp|P39059|COFA1_HUMAN
15 Dec 2023 00:51:49,726 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:49,726 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 00:51:49,931 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:49,931 INFO : Inserting sp|P39656|OST48_HUMAN
15 Dec 2023 00:51:49,964 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:49,964 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 00:51:50,188 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:50,188 INFO : Inserting sp|P39748|FEN1_HUMAN
15 Dec 2023 00:51:50,255 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:50,255 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 00:51:50,361 INFO : 60% Done
15 Dec 2023 00:51:50,436 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:50,436 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 00:51:50,602 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:50,602 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 00:51:50,735 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:50,735 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 00:51:50,774 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:50,774 INFO : Inserting sp|P40763|STAT3_HUMAN
15 Dec 2023 00:51:50,837 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:50,837 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 00:51:51,053 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:51,053 INFO : Inserting sp|P40926|MDHM_HUMAN
15 Dec 2023 00:51:51,245 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:51,245 INFO : Inserting sp|P40939|ECHA_HUMAN
15 Dec 2023 00:51:51,290 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:51,290 INFO : Inserting sp|P41091|IF2G_HUMAN
15 Dec 2023 00:51:51,347 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:51,347 INFO : Inserting sp|P41218|MNDA_HUMAN
15 Dec 2023 00:51:51,660 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:51:51,660 INFO : Inserting sp|P41219|PERI_HUMAN
15 Dec 2023 00:51:51,711 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:51,711 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 00:51:51,909 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:51,909 INFO : Inserting sp|P41226|UBA7_HUMAN
15 Dec 2023 00:51:51,923 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:51,923 INFO : Inserting sp|P41240|CSK_HUMAN
15 Dec 2023 00:51:51,975 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:51,975 INFO : Inserting sp|P41250|GARS_HUMAN
15 Dec 2023 00:51:52,014 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,014 INFO : Inserting sp|P41271|NBL1_HUMAN
15 Dec 2023 00:51:52,054 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,054 INFO : Inserting sp|P41439|FOLR3_HUMAN
15 Dec 2023 00:51:52,086 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:52,086 INFO : Inserting sp|P41567|EIF1_HUMAN
15 Dec 2023 00:51:52,128 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:52,128 INFO : Inserting sp|P42126|ECI1_HUMAN
15 Dec 2023 00:51:52,169 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,169 INFO : Inserting sp|P42166|LAP2A_HUMAN
15 Dec 2023 00:51:52,239 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,239 INFO : Inserting sp|P42167|LAP2B_HUMAN
15 Dec 2023 00:51:52,308 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,309 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 00:51:52,466 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:52,466 INFO : Inserting sp|P42331|RHG25_HUMAN
15 Dec 2023 00:51:52,488 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:52,489 INFO : Inserting sp|P42574|CASP3_HUMAN
15 Dec 2023 00:51:52,517 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:52,517 INFO : Inserting sp|P42765|THIM_HUMAN
15 Dec 2023 00:51:52,552 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:52,552 INFO : Inserting sp|P42768|WASP_HUMAN
15 Dec 2023 00:51:52,616 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:52,616 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 00:51:52,727 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:52,727 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 00:51:52,854 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:52,854 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 00:51:52,987 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:52,987 INFO : Inserting sp|P43234|CATO_HUMAN
15 Dec 2023 00:51:52,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:52,999 INFO : Inserting sp|P43243|MATR3_HUMAN
15 Dec 2023 00:51:53,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:53,024 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 00:51:53,159 INFO : 61% Done
15 Dec 2023 00:51:53,217 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:53,217 INFO : Inserting sp|P43353|AL3B1_HUMAN
15 Dec 2023 00:51:53,240 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:53,241 INFO : Inserting sp|P43405|KSYK_HUMAN
15 Dec 2023 00:51:53,325 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:53,325 INFO : Inserting sp|P43487|RANG_HUMAN
15 Dec 2023 00:51:53,355 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:53,355 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 00:51:53,752 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:51:53,753 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 00:51:54,265 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:51:54,265 INFO : Inserting sp|P45877|PPIC_HUMAN
15 Dec 2023 00:51:54,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:54,281 INFO : Inserting sp|P45880|VDAC2_HUMAN
15 Dec 2023 00:51:54,325 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:54,325 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 00:51:54,355 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:54,356 INFO : Inserting sp|P45984|MK09_HUMAN
15 Dec 2023 00:51:54,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:54,372 INFO : Inserting sp|P46109|CRKL_HUMAN
15 Dec 2023 00:51:54,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:54,401 INFO : Inserting sp|P46459|NSF_HUMAN
15 Dec 2023 00:51:54,443 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:54,443 INFO : Inserting sp|P46777|RL5_HUMAN
15 Dec 2023 00:51:54,461 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:54,461 INFO : Inserting sp|P46782|RS5_HUMAN
15 Dec 2023 00:51:54,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:54,485 INFO : Inserting sp|P46821|MAP1B_HUMAN
15 Dec 2023 00:51:54,578 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:54,578 INFO : Inserting sp|P46926|GNPI1_HUMAN
15 Dec 2023 00:51:54,700 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:54,701 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 00:51:55,748 DEBUG: Inserted 50 peptides
15 Dec 2023 00:51:55,877 DEBUG: Total peptides inserted: 55
15 Dec 2023 00:51:55,877 INFO : Inserting sp|P46952|3HAO_HUMAN
15 Dec 2023 00:51:55,906 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:55,906 INFO : Inserting sp|P46976|GLYG_HUMAN
15 Dec 2023 00:51:56,046 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:56,046 INFO : Inserting sp|P47755|CAZA2_HUMAN
15 Dec 2023 00:51:56,124 INFO : 62% Done
15 Dec 2023 00:51:56,221 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:51:56,221 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 00:51:56,398 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:51:56,398 INFO : Inserting sp|P47897|SYQ_HUMAN
15 Dec 2023 00:51:56,431 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:56,431 INFO : Inserting sp|P48047|ATPO_HUMAN
15 Dec 2023 00:51:56,837 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:56,837 INFO : Inserting sp|P48147|PPCE_HUMAN
15 Dec 2023 00:51:57,079 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:57,080 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 00:51:57,126 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:57,126 INFO : Inserting sp|P48444|COPD_HUMAN
15 Dec 2023 00:51:57,227 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:57,227 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 00:51:57,265 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:57,265 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 00:51:57,300 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:57,300 INFO : Inserting sp|P48551|INAR2_HUMAN
15 Dec 2023 00:51:57,318 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:57,318 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 00:51:57,534 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:51:57,534 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 00:51:57,714 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:57,715 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 00:51:57,894 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:57,894 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 00:51:58,092 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:58,092 INFO : Inserting sp|P48723|HSP13_HUMAN
15 Dec 2023 00:51:58,199 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:51:58,199 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 00:51:58,361 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:51:58,361 INFO : Inserting sp|P48739|PIPNB_HUMAN
15 Dec 2023 00:51:58,376 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:58,376 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 00:51:58,648 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:51:58,648 INFO : Inserting sp|P48745|CCN3_HUMAN
15 Dec 2023 00:51:58,698 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:58,698 INFO : Inserting sp|P48960|AGRE5_HUMAN
15 Dec 2023 00:51:58,757 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:58,758 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 00:51:58,845 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:58,845 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 00:51:58,879 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:58,879 INFO : Inserting sp|P49257|LMAN1_HUMAN
15 Dec 2023 00:51:58,912 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:58,912 INFO : Inserting sp|P49321|NASP_HUMAN
15 Dec 2023 00:51:58,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:58,935 INFO : Inserting sp|P49354|FNTA_HUMAN
15 Dec 2023 00:51:58,986 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:51:58,986 INFO : Inserting sp|P49368|TCPG_HUMAN
15 Dec 2023 00:51:59,103 INFO : 63% Done
15 Dec 2023 00:51:59,122 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:59,122 INFO : Inserting sp|P49407|ARRB1_HUMAN
15 Dec 2023 00:51:59,159 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,159 INFO : Inserting sp|P49441|INPP_HUMAN
15 Dec 2023 00:51:59,179 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,179 INFO : Inserting sp|P49458|SRP09_HUMAN
15 Dec 2023 00:51:59,229 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:59,229 INFO : Inserting sp|P49591|SYSC_HUMAN
15 Dec 2023 00:51:59,329 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:51:59,329 INFO : Inserting sp|P49593|PPM1F_HUMAN
15 Dec 2023 00:51:59,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,340 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 00:51:59,563 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:51:59,563 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 00:51:59,658 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:51:59,658 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 00:51:59,720 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:51:59,720 INFO : Inserting sp|P49746|TSP3_HUMAN
15 Dec 2023 00:51:59,742 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,742 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 00:51:59,873 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:51:59,873 INFO : Inserting sp|P49755|TMEDA_HUMAN
15 Dec 2023 00:51:59,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,899 INFO : Inserting sp|P49767|VEGFC_HUMAN
15 Dec 2023 00:51:59,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:51:59,912 INFO : Inserting sp|P49773|HINT1_HUMAN
15 Dec 2023 00:51:59,989 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:51:59,989 INFO : Inserting sp|P49788|TIG1_HUMAN
15 Dec 2023 00:52:00,032 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:00,033 INFO : Inserting sp|P49903|SPS1_HUMAN
15 Dec 2023 00:52:00,072 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:00,072 INFO : Imported 1000 peptide groups.
15 Dec 2023 00:52:00,072 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 00:52:00,328 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:00,328 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 00:52:00,386 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:00,386 INFO : Inserting sp|P50225|ST1A1_HUMAN
15 Dec 2023 00:52:00,438 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:00,438 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 00:52:00,921 DEBUG: Total peptides inserted: 25
15 Dec 2023 00:52:00,921 INFO : Inserting sp|P50452|SPB8_HUMAN
15 Dec 2023 00:52:01,069 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:01,070 INFO : Inserting sp|P50453|SPB9_HUMAN
15 Dec 2023 00:52:01,401 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:01,401 INFO : Inserting sp|P50458|LHX2_HUMAN
15 Dec 2023 00:52:01,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:01,415 INFO : Inserting sp|P50502|F10A1_HUMAN
15 Dec 2023 00:52:01,456 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:01,456 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 00:52:01,694 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:01,694 INFO : Inserting sp|P50570|DYN2_HUMAN
15 Dec 2023 00:52:01,740 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:01,740 INFO : Inserting sp|P50895|BCAM_HUMAN
15 Dec 2023 00:52:01,777 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:01,778 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 00:52:01,988 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:01,988 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 00:52:02,149 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:02,149 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 00:52:02,199 INFO : 64% Done
15 Dec 2023 00:52:02,458 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:02,459 INFO : Inserting sp|P51148|RAB5C_HUMAN
15 Dec 2023 00:52:02,495 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:02,496 INFO : Inserting sp|P51149|RAB7A_HUMAN
15 Dec 2023 00:52:02,713 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:02,714 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 00:52:02,782 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:02,782 INFO : Inserting sp|P51610|HCFC1_HUMAN
15 Dec 2023 00:52:02,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:02,795 INFO : Inserting sp|P51654|GPC3_HUMAN
15 Dec 2023 00:52:02,838 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:02,838 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 00:52:02,858 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:02,858 INFO : Inserting sp|P51674|GPM6A_HUMAN
15 Dec 2023 00:52:02,910 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:02,910 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 00:52:03,383 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:03,383 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 00:52:03,516 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:03,516 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 00:52:03,714 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:03,714 INFO : Inserting sp|P51888|PRELP_HUMAN
15 Dec 2023 00:52:03,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:03,739 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 00:52:03,805 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:03,805 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 00:52:04,198 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:52:04,198 INFO : Inserting sp|P52272|HNRPM_HUMAN
15 Dec 2023 00:52:04,265 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:04,266 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 00:52:04,363 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:04,363 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 00:52:04,678 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:52:04,678 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 00:52:04,741 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:04,741 INFO : Inserting sp|P52788|SPSY_HUMAN
15 Dec 2023 00:52:04,799 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:04,799 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 00:52:05,165 INFO : 65% Done
15 Dec 2023 00:52:05,211 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:52:05,211 INFO : Inserting sp|P52797|EFNA3_HUMAN
15 Dec 2023 00:52:05,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:05,230 INFO : Inserting sp|P52799|EFNB2_HUMAN
15 Dec 2023 00:52:05,278 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:05,278 INFO : Inserting sp|P52823|STC1_HUMAN
15 Dec 2023 00:52:05,323 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:05,323 INFO : Inserting sp|P52888|THOP1_HUMAN
15 Dec 2023 00:52:05,360 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:05,360 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 00:52:05,507 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:05,507 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 00:52:05,584 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:05,584 INFO : Inserting sp|P53041|PPP5_HUMAN
15 Dec 2023 00:52:05,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:05,604 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 00:52:05,813 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:05,814 INFO : Inserting sp|P53618|COPB_HUMAN
15 Dec 2023 00:52:05,848 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:05,848 INFO : Inserting sp|P53621|COPA_HUMAN
15 Dec 2023 00:52:05,926 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:05,926 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 00:52:06,079 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:06,079 INFO : Inserting sp|P53675|CLH2_HUMAN
15 Dec 2023 00:52:06,244 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:06,244 INFO : Inserting sp|P53985|MOT1_HUMAN
15 Dec 2023 00:52:06,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:06,265 INFO : Inserting sp|P53999|TCP4_HUMAN
15 Dec 2023 00:52:06,303 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:06,304 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 00:52:06,355 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:06,355 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 00:52:06,653 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:52:06,654 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 00:52:06,735 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:06,735 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 00:52:06,906 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:06,906 INFO : Inserting sp|P54707|AT12A_HUMAN
15 Dec 2023 00:52:06,961 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:06,961 INFO : Inserting sp|P54709|AT1B3_HUMAN
15 Dec 2023 00:52:07,005 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:07,005 INFO : Inserting sp|P54725|RD23A_HUMAN
15 Dec 2023 00:52:07,059 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:07,059 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 00:52:07,156 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:07,156 INFO : Inserting sp|P54756|EPHA5_HUMAN
15 Dec 2023 00:52:07,201 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:07,201 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 00:52:07,348 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:07,348 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 00:52:07,427 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:07,428 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 00:52:07,504 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:07,504 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 00:52:07,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:07,523 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 00:52:07,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:07,542 INFO : Inserting sp|P55036|PSMD4_HUMAN
15 Dec 2023 00:52:07,557 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:07,557 INFO : Inserting sp|P55056|APOC4_HUMAN
15 Dec 2023 00:52:07,685 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:07,686 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 00:52:08,224 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:52:08,225 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 00:52:08,239 INFO : 66% Done
15 Dec 2023 00:52:08,777 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:08,777 INFO : Inserting sp|P55145|MANF_HUMAN
15 Dec 2023 00:52:08,824 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:08,824 INFO : Inserting sp|P55160|NCKPL_HUMAN
15 Dec 2023 00:52:08,944 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:08,944 INFO : Inserting sp|P55209|NP1L1_HUMAN
15 Dec 2023 00:52:08,992 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:08,992 INFO : Inserting sp|P55210|CASP7_HUMAN
15 Dec 2023 00:52:09,027 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:09,027 INFO : Inserting sp|P55263|ADK_HUMAN
15 Dec 2023 00:52:09,091 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:09,092 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 00:52:09,256 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:09,256 INFO : Inserting sp|P55283|CADH4_HUMAN
15 Dec 2023 00:52:09,349 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:09,349 INFO : Inserting sp|P55285|CADH6_HUMAN
15 Dec 2023 00:52:09,376 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:09,376 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 00:52:09,480 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:09,480 INFO : Inserting sp|P55290|CAD13_HUMAN
15 Dec 2023 00:52:09,645 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:09,645 INFO : Inserting sp|P55735|SEC13_HUMAN
15 Dec 2023 00:52:09,657 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:09,657 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 00:52:09,978 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:52:09,978 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 00:52:10,040 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:10,040 INFO : Inserting sp|P55854|SUMO3_HUMAN
15 Dec 2023 00:52:10,071 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:10,071 INFO : Inserting sp|P55884|EIF3B_HUMAN
15 Dec 2023 00:52:10,154 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:10,154 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 00:52:10,212 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:10,212 INFO : Inserting sp|P56377|AP1S2_HUMAN
15 Dec 2023 00:52:10,242 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:10,242 INFO : Inserting sp|P56537|IF6_HUMAN
15 Dec 2023 00:52:10,358 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:10,358 INFO : Inserting sp|P57721|PCBP3_HUMAN
15 Dec 2023 00:52:10,427 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:10,427 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 00:52:10,557 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:10,558 INFO : Inserting sp|P58107|EPIPL_HUMAN
15 Dec 2023 00:52:10,579 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:10,580 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 00:52:10,636 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:10,636 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 00:52:10,700 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:10,700 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 00:52:10,761 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:10,761 INFO : Inserting sp|P59901|LIRA4_HUMAN
15 Dec 2023 00:52:10,817 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:10,817 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 00:52:10,910 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:10,910 INFO : Inserting sp|P60033|CD81_HUMAN
15 Dec 2023 00:52:10,940 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:10,940 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 00:52:11,147 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:11,147 INFO : Inserting sp|P60201|MYPR_HUMAN
15 Dec 2023 00:52:11,163 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:11,163 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 00:52:11,257 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:11,257 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 00:52:11,407 INFO : 67% Done
15 Dec 2023 00:52:11,745 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:52:11,746 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 00:52:11,917 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:11,917 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 00:52:12,079 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:12,079 INFO : Inserting sp|P60903|S10AA_HUMAN
15 Dec 2023 00:52:12,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:12,104 INFO : Inserting sp|P60953|CDC42_HUMAN
15 Dec 2023 00:52:12,188 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:12,188 INFO : Imported 1100 peptide groups.
15 Dec 2023 00:52:12,188 INFO : Inserting sp|P61018|RAB4B_HUMAN
15 Dec 2023 00:52:12,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:12,222 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 00:52:12,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:12,292 INFO : Inserting sp|P61020|RAB5B_HUMAN
15 Dec 2023 00:52:12,309 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:12,309 INFO : Inserting sp|P61026|RAB10_HUMAN
15 Dec 2023 00:52:12,370 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:12,370 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 00:52:12,387 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:12,387 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 00:52:12,485 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:12,485 INFO : Inserting sp|P61106|RAB14_HUMAN
15 Dec 2023 00:52:12,581 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:12,581 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 00:52:12,912 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:52:12,912 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 00:52:13,228 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:52:13,228 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 00:52:13,261 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:13,262 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 00:52:13,308 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:13,308 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 00:52:13,381 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:13,381 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 00:52:13,396 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:13,397 INFO : Inserting sp|P61326|MGN_HUMAN
15 Dec 2023 00:52:13,445 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:13,445 INFO : Inserting sp|P61457|PHS_HUMAN
15 Dec 2023 00:52:13,462 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:13,462 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 00:52:13,542 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:13,542 INFO : Inserting sp|P61604|CH10_HUMAN
15 Dec 2023 00:52:13,608 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:13,608 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 00:52:13,728 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:13,729 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 00:52:14,051 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:52:14,051 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 00:52:14,171 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:14,171 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 00:52:14,264 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:14,264 INFO : Inserting sp|P61956|SUMO2_HUMAN
15 Dec 2023 00:52:14,290 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:14,290 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 00:52:14,321 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:14,321 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 00:52:14,359 INFO : 68% Done
15 Dec 2023 00:52:14,416 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:14,416 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 00:52:14,650 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:14,650 INFO : Inserting sp|P62070|RRAS2_HUMAN
15 Dec 2023 00:52:14,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:14,689 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 00:52:14,861 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:14,862 INFO : Inserting sp|P62140|PP1B_HUMAN
15 Dec 2023 00:52:14,966 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:14,966 INFO : Inserting sp|P62191|PRS4_HUMAN
15 Dec 2023 00:52:14,978 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:14,978 INFO : Inserting sp|P62195|PRS8_HUMAN
15 Dec 2023 00:52:14,991 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:14,991 INFO : Inserting sp|P62241|RS8_HUMAN
15 Dec 2023 00:52:15,037 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,038 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 00:52:15,383 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:52:15,383 INFO : Inserting sp|P62277|RS13_HUMAN
15 Dec 2023 00:52:15,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:15,426 INFO : Inserting sp|P62304|RUXE_HUMAN
15 Dec 2023 00:52:15,479 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,479 INFO : Inserting sp|P62308|RUXG_HUMAN
15 Dec 2023 00:52:15,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,528 INFO : Inserting sp|P62310|LSM3_HUMAN
15 Dec 2023 00:52:15,553 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:15,553 INFO : Inserting sp|P62312|LSM6_HUMAN
15 Dec 2023 00:52:15,588 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,588 INFO : Inserting sp|P62314|SMD1_HUMAN
15 Dec 2023 00:52:15,628 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,628 INFO : Inserting sp|P62316|SMD2_HUMAN
15 Dec 2023 00:52:15,703 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:15,703 INFO : Inserting sp|P62318|SMD3_HUMAN
15 Dec 2023 00:52:15,742 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:15,742 INFO : Inserting sp|P62328|TYB4_HUMAN
15 Dec 2023 00:52:15,772 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:15,773 INFO : Inserting sp|P62495|ERF1_HUMAN
15 Dec 2023 00:52:15,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:15,795 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 00:52:16,176 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:52:16,176 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 00:52:16,404 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:16,404 INFO : Inserting sp|P62820|RAB1A_HUMAN
15 Dec 2023 00:52:16,542 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:16,542 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 00:52:16,633 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:16,633 INFO : Inserting sp|P62834|RAP1A_HUMAN
15 Dec 2023 00:52:16,698 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:16,698 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 00:52:16,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:16,716 INFO : Inserting sp|P62857|RS28_HUMAN
15 Dec 2023 00:52:16,747 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:16,747 INFO : Inserting sp|P62873|GBB1_HUMAN
15 Dec 2023 00:52:16,890 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:16,890 INFO : Inserting sp|P62879|GBB2_HUMAN
15 Dec 2023 00:52:17,018 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:17,018 INFO : Inserting sp|P62888|RL30_HUMAN
15 Dec 2023 00:52:17,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:17,037 INFO : Inserting sp|P62906|RL10A_HUMAN
15 Dec 2023 00:52:17,075 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:17,075 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 00:52:17,238 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:17,238 INFO : Inserting sp|P62942|FKB1A_HUMAN
15 Dec 2023 00:52:17,359 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:17,359 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 00:52:17,535 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:17,535 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 00:52:17,564 INFO : 69% Done
15 Dec 2023 00:52:17,712 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:17,712 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 00:52:17,852 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:17,852 INFO : Inserting sp|P63000|RAC1_HUMAN
15 Dec 2023 00:52:17,926 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:17,926 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 00:52:18,064 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:18,064 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 00:52:18,142 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:18,143 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 00:52:18,424 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:52:18,424 INFO : Inserting sp|P63151|2ABA_HUMAN
15 Dec 2023 00:52:18,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:18,435 INFO : Inserting sp|P63208|SKP1_HUMAN
15 Dec 2023 00:52:18,455 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:18,455 INFO : Inserting sp|P63220|RS21_HUMAN
15 Dec 2023 00:52:18,473 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:18,473 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 00:52:18,563 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:18,563 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 00:52:18,705 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:18,705 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 00:52:19,190 DEBUG: Total peptides inserted: 27
15 Dec 2023 00:52:19,190 INFO : Inserting sp|P63279|UBC9_HUMAN
15 Dec 2023 00:52:19,246 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:19,246 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 00:52:19,357 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:19,357 INFO : Inserting sp|P67809|YBOX1_HUMAN
15 Dec 2023 00:52:19,377 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:19,377 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 00:52:19,716 DEBUG: Total peptides inserted: 21
15 Dec 2023 00:52:19,716 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 00:52:19,731 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:19,731 INFO : Inserting sp|P68104|EF1A1_HUMAN
15 Dec 2023 00:52:19,909 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:19,909 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 00:52:20,149 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:20,149 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 00:52:20,363 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:20,363 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 00:52:20,475 INFO : 70% Done
15 Dec 2023 00:52:20,545 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:20,546 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 00:52:20,738 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:20,738 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 00:52:20,997 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:20,997 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 00:52:21,100 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:21,100 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 00:52:21,309 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:21,310 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 00:52:21,582 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:21,582 INFO : Inserting sp|P78325|ADAM8_HUMAN
15 Dec 2023 00:52:21,603 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:21,603 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 00:52:21,867 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:21,868 INFO : Inserting sp|P78380|OLR1_HUMAN
15 Dec 2023 00:52:21,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:21,882 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 00:52:22,092 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:22,093 INFO : Inserting sp|P78509|RELN_HUMAN
15 Dec 2023 00:52:22,126 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:22,126 INFO : Inserting sp|P78527|PRKDC_HUMAN
15 Dec 2023 00:52:22,315 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:22,315 INFO : Inserting sp|P78559|MAP1A_HUMAN
15 Dec 2023 00:52:22,412 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:22,412 INFO : Inserting sp|P79483|DRB3_HUMAN
15 Dec 2023 00:52:22,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:22,424 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 00:52:22,620 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:22,620 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 00:52:22,911 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:22,911 INFO : Inserting sp|P80297|MT1X_HUMAN
15 Dec 2023 00:52:22,924 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:22,924 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 00:52:23,046 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:23,046 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 00:52:23,077 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:23,077 INFO : Inserting sp|P80723|BASP1_HUMAN
15 Dec 2023 00:52:23,095 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:23,095 INFO : Inserting sp|P82279|CRUM1_HUMAN
15 Dec 2023 00:52:23,118 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:23,118 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 00:52:23,163 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:23,163 INFO : Inserting sp|P84090|ERH_HUMAN
15 Dec 2023 00:52:23,183 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:23,184 INFO : Inserting sp|P84095|RHOG_HUMAN
15 Dec 2023 00:52:23,284 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:23,285 INFO : Imported 1200 peptide groups.
15 Dec 2023 00:52:23,285 INFO : Inserting sp|P84103|SRSF3_HUMAN
15 Dec 2023 00:52:23,307 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:23,307 INFO : Inserting sp|P84243|H33_HUMAN
15 Dec 2023 00:52:23,458 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:23,458 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 00:52:23,535 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:23,535 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 00:52:23,729 INFO : 71% Done
15 Dec 2023 00:52:23,900 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:52:23,900 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 00:52:24,779 DEBUG: Inserted 50 peptides
15 Dec 2023 00:52:24,872 DEBUG: Total peptides inserted: 54
15 Dec 2023 00:52:24,872 INFO : Inserting sp|P98171|RHG04_HUMAN
15 Dec 2023 00:52:24,952 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:24,952 INFO : Inserting sp|P98172|EFNB1_HUMAN
15 Dec 2023 00:52:24,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:24,962 INFO : Inserting sp|P99999|CYC_HUMAN
15 Dec 2023 00:52:25,018 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:25,019 INFO : Inserting sp|Q00059|TFAM_HUMAN
15 Dec 2023 00:52:25,042 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:25,042 INFO : Inserting sp|Q00169|PIPNA_HUMAN
15 Dec 2023 00:52:25,053 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:25,053 INFO : Inserting sp|Q00325|MPCP_HUMAN
15 Dec 2023 00:52:25,087 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:25,087 INFO : Inserting sp|Q00526|CDK3_HUMAN
15 Dec 2023 00:52:25,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:25,108 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 00:52:25,861 DEBUG: Total peptides inserted: 43
15 Dec 2023 00:52:25,861 INFO : Inserting sp|Q00688|FKBP3_HUMAN
15 Dec 2023 00:52:25,946 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:25,946 INFO : Inserting sp|Q00722|PLCB2_HUMAN
15 Dec 2023 00:52:26,013 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:26,013 INFO : Inserting sp|Q00796|DHSO_HUMAN
15 Dec 2023 00:52:26,050 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:26,051 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 00:52:26,114 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:26,114 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 00:52:26,492 INFO : 72% Done
15 Dec 2023 00:52:26,522 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:52:26,522 INFO : Inserting sp|Q01105|SET_HUMAN
15 Dec 2023 00:52:26,611 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:26,611 INFO : Inserting sp|Q01130|SRSF2_HUMAN
15 Dec 2023 00:52:26,636 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:26,636 INFO : Inserting sp|Q01432|AMPD3_HUMAN
15 Dec 2023 00:52:26,695 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:26,695 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 00:52:26,812 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:26,812 INFO : Inserting sp|Q01484|ANK2_HUMAN
15 Dec 2023 00:52:26,846 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:26,846 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 00:52:27,229 DEBUG: Total peptides inserted: 25
15 Dec 2023 00:52:27,229 INFO : Inserting sp|Q01546|K22O_HUMAN
15 Dec 2023 00:52:27,300 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:27,300 INFO : Inserting sp|Q01628|IFM3_HUMAN
15 Dec 2023 00:52:27,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:27,319 INFO : Inserting sp|Q01629|IFM2_HUMAN
15 Dec 2023 00:52:27,338 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:27,338 INFO : Inserting sp|Q01844|EWS_HUMAN
15 Dec 2023 00:52:27,373 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:27,373 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 00:52:27,733 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:52:27,733 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 00:52:27,936 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:27,936 INFO : Inserting sp|Q02750|MP2K1_HUMAN
15 Dec 2023 00:52:27,959 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:27,960 INFO : Inserting sp|Q02809|PLOD1_HUMAN
15 Dec 2023 00:52:28,080 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:28,080 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 00:52:28,782 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:28,782 INFO : Inserting sp|Q02878|RL6_HUMAN
15 Dec 2023 00:52:28,798 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:28,799 INFO : Inserting sp|Q02880|TOP2B_HUMAN
15 Dec 2023 00:52:28,847 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:28,847 INFO : Inserting sp|Q02978|M2OM_HUMAN
15 Dec 2023 00:52:28,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:28,872 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 00:52:28,994 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:28,995 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 00:52:29,156 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:29,157 INFO : Inserting sp|Q03252|LMNB2_HUMAN
15 Dec 2023 00:52:29,419 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:29,419 INFO : Inserting sp|Q03405|UPAR_HUMAN
15 Dec 2023 00:52:29,557 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:29,557 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 00:52:29,642 INFO : 73% Done
15 Dec 2023 00:52:29,852 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:29,852 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 00:52:30,088 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:30,088 INFO : Inserting sp|Q04695|K1C17_HUMAN
15 Dec 2023 00:52:30,223 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:30,223 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 00:52:30,433 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:30,433 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 00:52:30,477 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:30,477 INFO : Inserting sp|Q04837|SSBP_HUMAN
15 Dec 2023 00:52:30,494 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:30,494 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 00:52:30,732 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:30,732 INFO : Inserting sp|Q05193|DYN1_HUMAN
15 Dec 2023 00:52:30,751 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:30,751 INFO : Inserting sp|Q05315|LEG10_HUMAN
15 Dec 2023 00:52:30,813 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:30,813 INFO : Inserting sp|Q05655|KPCD_HUMAN
15 Dec 2023 00:52:30,897 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:30,897 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 00:52:31,517 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:52:31,518 INFO : Inserting sp|Q06124|PTN11_HUMAN
15 Dec 2023 00:52:31,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:31,543 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 00:52:31,850 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:31,851 INFO : Inserting sp|Q06418|TYRO3_HUMAN
15 Dec 2023 00:52:31,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:31,900 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 00:52:32,157 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:32,157 INFO : Inserting sp|Q06828|FMOD_HUMAN
15 Dec 2023 00:52:32,288 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:32,288 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 00:52:32,470 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:32,471 INFO : Inserting sp|Q07021|C1QBP_HUMAN
15 Dec 2023 00:52:32,493 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:32,493 INFO : Inserting sp|Q07092|COGA1_HUMAN
15 Dec 2023 00:52:32,512 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:32,512 INFO : Inserting sp|Q07666|KHDR1_HUMAN
15 Dec 2023 00:52:32,580 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:32,580 INFO : Inserting sp|Q07812|BAX_HUMAN
15 Dec 2023 00:52:32,612 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:32,613 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 00:52:32,759 INFO : 74% Done
15 Dec 2023 00:52:33,327 DEBUG: Total peptides inserted: 44
15 Dec 2023 00:52:33,327 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 00:52:33,355 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:33,355 INFO : Inserting sp|Q07960|RHG01_HUMAN
15 Dec 2023 00:52:33,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:33,365 INFO : Inserting sp|Q08174|PCDH1_HUMAN
15 Dec 2023 00:52:33,413 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:33,413 INFO : Inserting sp|Q08209|PP2BA_HUMAN
15 Dec 2023 00:52:33,452 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:33,452 INFO : Inserting sp|Q08211|DHX9_HUMAN
15 Dec 2023 00:52:33,545 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:33,545 INFO : Inserting sp|Q08345|DDR1_HUMAN
15 Dec 2023 00:52:33,619 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:33,619 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 00:52:33,913 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:52:33,913 INFO : Inserting sp|Q08397|LOXL1_HUMAN
15 Dec 2023 00:52:33,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:33,932 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 00:52:34,051 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:34,051 INFO : Inserting sp|Q08722|CD47_HUMAN
15 Dec 2023 00:52:34,070 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:34,070 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 00:52:34,137 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:34,137 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 00:52:34,234 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:34,234 INFO : Inserting sp|Q09161|NCBP1_HUMAN
15 Dec 2023 00:52:34,251 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:34,251 INFO : Inserting sp|Q09666|AHNK_HUMAN
15 Dec 2023 00:52:34,737 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:52:34,737 INFO : Inserting sp|Q0VG99|MESP2_HUMAN
15 Dec 2023 00:52:34,771 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:34,771 INFO : Inserting sp|Q0WX57|U17LO_HUMAN
15 Dec 2023 00:52:34,803 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:34,803 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 00:52:35,070 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:52:35,071 INFO : Inserting sp|Q10567|AP1B1_HUMAN
15 Dec 2023 00:52:35,234 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:35,234 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 00:52:35,386 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:35,386 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 00:52:35,467 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:35,468 INFO : Inserting sp|Q12797|ASPH_HUMAN
15 Dec 2023 00:52:35,487 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:35,487 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 00:52:35,885 DEBUG: Total peptides inserted: 23
15 Dec 2023 00:52:35,885 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 00:52:36,214 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:52:36,215 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 00:52:36,794 DEBUG: Total peptides inserted: 35
15 Dec 2023 00:52:36,794 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 00:52:36,837 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:36,837 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 00:52:36,933 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:36,933 INFO : Inserting sp|Q12905|ILF2_HUMAN
15 Dec 2023 00:52:37,032 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:37,032 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 00:52:37,275 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:37,275 INFO : Inserting sp|Q12907|LMAN2_HUMAN
15 Dec 2023 00:52:37,552 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:52:37,552 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 00:52:37,787 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:37,787 INFO : Inserting sp|Q12931|TRAP1_HUMAN
15 Dec 2023 00:52:37,842 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:37,842 INFO : Inserting sp|Q13011|ECH1_HUMAN
15 Dec 2023 00:52:37,871 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:37,872 INFO : Inserting sp|Q13043|STK4_HUMAN
15 Dec 2023 00:52:37,910 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:37,911 INFO : Inserting sp|Q13045|FLII_HUMAN
15 Dec 2023 00:52:37,989 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:37,990 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 00:52:38,086 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:38,086 INFO : Inserting sp|Q13126|MTAP_HUMAN
15 Dec 2023 00:52:38,153 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:38,153 INFO : Inserting sp|Q13151|ROA0_HUMAN
15 Dec 2023 00:52:38,169 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:38,169 INFO : Inserting sp|Q13153|PAK1_HUMAN
15 Dec 2023 00:52:38,224 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:38,224 INFO : Imported 1300 peptide groups.
15 Dec 2023 00:52:38,224 INFO : Inserting sp|Q13177|PAK2_HUMAN
15 Dec 2023 00:52:38,333 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:38,333 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 00:52:38,382 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:38,382 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 00:52:38,412 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:38,412 INFO : Inserting sp|Q13214|SEM3B_HUMAN
15 Dec 2023 00:52:38,437 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:38,437 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 00:52:38,546 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:38,546 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 00:52:38,577 INFO : 75% Done
15 Dec 2023 00:52:38,692 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:38,692 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 00:52:38,902 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:52:38,902 INFO : Inserting sp|Q13263|TIF1B_HUMAN
15 Dec 2023 00:52:38,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:38,935 INFO : Inserting sp|Q13277|STX3_HUMAN
15 Dec 2023 00:52:38,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:38,956 INFO : Inserting sp|Q13287|NMI_HUMAN
15 Dec 2023 00:52:39,010 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:39,010 INFO : Inserting sp|Q13303|KCAB2_HUMAN
15 Dec 2023 00:52:39,063 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:39,063 INFO : Inserting sp|Q13308|PTK7_HUMAN
15 Dec 2023 00:52:39,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:39,080 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 00:52:39,355 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:52:39,355 INFO : Inserting sp|Q13347|EIF3I_HUMAN
15 Dec 2023 00:52:39,391 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:39,391 INFO : Inserting sp|Q13349|ITAD_HUMAN
15 Dec 2023 00:52:39,457 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:39,457 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 00:52:39,558 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:39,558 INFO : Inserting sp|Q13409|DC1I2_HUMAN
15 Dec 2023 00:52:39,581 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:39,581 INFO : Inserting sp|Q13421|MSLN_HUMAN
15 Dec 2023 00:52:39,664 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:39,664 INFO : Inserting sp|Q13443|ADAM9_HUMAN
15 Dec 2023 00:52:39,773 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:39,773 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 00:52:39,943 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:39,943 INFO : Inserting sp|Q13451|FKBP5_HUMAN
15 Dec 2023 00:52:39,981 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:39,981 INFO : Inserting sp|Q13464|ROCK1_HUMAN
15 Dec 2023 00:52:39,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:39,997 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 00:52:40,124 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:40,124 INFO : Inserting sp|Q13509|TBB3_HUMAN
15 Dec 2023 00:52:40,257 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:40,257 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 00:52:40,288 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:40,289 INFO : Inserting sp|Q13561|DCTN2_HUMAN
15 Dec 2023 00:52:40,329 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:40,329 INFO : Inserting sp|Q13576|IQGA2_HUMAN
15 Dec 2023 00:52:40,482 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:40,482 INFO : Inserting sp|Q13596|SNX1_HUMAN
15 Dec 2023 00:52:40,505 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:40,505 INFO : Inserting sp|Q13619|CUL4A_HUMAN
15 Dec 2023 00:52:40,526 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:40,526 INFO : Inserting sp|Q13636|RAB31_HUMAN
15 Dec 2023 00:52:40,565 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:40,565 INFO : Inserting sp|Q13637|RAB32_HUMAN
15 Dec 2023 00:52:40,583 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:40,583 INFO : Inserting sp|Q13733|AT1A4_HUMAN
15 Dec 2023 00:52:40,669 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:40,669 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 00:52:40,978 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:52:40,978 INFO : Inserting sp|Q13765|NACA_HUMAN
15 Dec 2023 00:52:41,008 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:41,008 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 00:52:41,057 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:41,058 INFO : Inserting sp|Q13796|SHRM2_HUMAN
15 Dec 2023 00:52:41,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:41,088 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 00:52:41,319 INFO : 76% Done
15 Dec 2023 00:52:41,929 DEBUG: Total peptides inserted: 38
15 Dec 2023 00:52:41,929 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 00:52:42,763 DEBUG: Total peptides inserted: 32
15 Dec 2023 00:52:42,763 INFO : Inserting sp|Q13838|DX39B_HUMAN
15 Dec 2023 00:52:42,910 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:42,910 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 00:52:43,016 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:43,016 INFO : Inserting sp|Q14005|IL16_HUMAN
15 Dec 2023 00:52:43,034 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:43,034 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 00:52:43,119 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:43,119 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 00:52:43,199 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:43,199 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 00:52:43,679 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:52:43,679 INFO : Inserting sp|Q14114|LRP8_HUMAN
15 Dec 2023 00:52:43,715 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:43,715 INFO : Inserting sp|Q14116|IL18_HUMAN
15 Dec 2023 00:52:43,730 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:43,730 INFO : Inserting sp|Q14118|DAG1_HUMAN
15 Dec 2023 00:52:44,028 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:44,028 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 00:52:44,103 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:44,103 INFO : Inserting sp|Q14141|SEPT6_HUMAN
15 Dec 2023 00:52:44,310 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:44,310 INFO : Inserting sp|Q14152|EIF3A_HUMAN
15 Dec 2023 00:52:44,337 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:44,337 INFO : Inserting sp|Q14155|ARHG7_HUMAN
15 Dec 2023 00:52:44,358 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:44,358 INFO : Inserting sp|Q14165|MLEC_HUMAN
15 Dec 2023 00:52:44,453 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:44,453 INFO : Inserting sp|Q14194|DPYL1_HUMAN
15 Dec 2023 00:52:44,497 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:44,497 INFO : Inserting sp|Q14195|DPYL3_HUMAN
15 Dec 2023 00:52:44,548 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:44,549 INFO : Inserting sp|Q14204|DYHC1_HUMAN
15 Dec 2023 00:52:44,644 INFO : 77% Done
15 Dec 2023 00:52:44,680 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:44,680 INFO : Inserting sp|Q14240|IF4A2_HUMAN
15 Dec 2023 00:52:44,810 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:44,810 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 00:52:44,941 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:44,941 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 00:52:45,069 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:45,069 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 00:52:45,137 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:45,137 INFO : Inserting sp|Q14344|GNA13_HUMAN
15 Dec 2023 00:52:45,200 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:45,200 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 00:52:45,273 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:45,273 INFO : Inserting sp|Q14444|CAPR1_HUMAN
15 Dec 2023 00:52:45,323 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:45,323 INFO : Inserting sp|Q14498|RBM39_HUMAN
15 Dec 2023 00:52:45,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:45,340 INFO : Inserting sp|Q14508|WFDC2_HUMAN
15 Dec 2023 00:52:45,358 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:45,358 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 00:52:45,863 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:45,863 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 00:52:46,159 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:46,159 INFO : Inserting sp|Q14574|DSC3_HUMAN
15 Dec 2023 00:52:46,181 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:46,181 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 00:52:46,850 DEBUG: Total peptides inserted: 34
15 Dec 2023 00:52:46,850 INFO : Inserting sp|Q14651|PLSI_HUMAN
15 Dec 2023 00:52:46,950 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:46,950 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 00:52:47,203 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:47,203 INFO : Inserting sp|Q14739|LBR_HUMAN
15 Dec 2023 00:52:47,235 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:47,235 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 00:52:47,391 INFO : 78% Done
15 Dec 2023 00:52:47,664 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:52:47,664 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 00:52:47,759 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:47,759 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 00:52:47,974 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:47,974 INFO : Inserting sp|Q14847|LASP1_HUMAN
15 Dec 2023 00:52:48,051 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:48,051 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 00:52:48,062 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:48,062 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 00:52:48,276 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:48,276 INFO : Inserting sp|Q14980|NUMA1_HUMAN
15 Dec 2023 00:52:48,366 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:48,367 INFO : Inserting sp|Q14982|OPCM_HUMAN
15 Dec 2023 00:52:48,488 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:48,488 INFO : Inserting sp|Q15008|PSMD6_HUMAN
15 Dec 2023 00:52:48,546 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:48,546 INFO : Inserting sp|Q15019|SEPT2_HUMAN
15 Dec 2023 00:52:48,619 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:48,619 INFO : Inserting sp|Q15022|SUZ12_HUMAN
15 Dec 2023 00:52:48,635 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:48,635 INFO : Inserting sp|Q15027|ACAP1_HUMAN
15 Dec 2023 00:52:48,704 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:48,704 INFO : Inserting sp|Q15046|SYK_HUMAN
15 Dec 2023 00:52:48,779 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:48,780 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 00:52:48,801 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:48,801 INFO : Inserting sp|Q15056|IF4H_HUMAN
15 Dec 2023 00:52:48,834 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:48,834 INFO : Inserting sp|Q15057|ACAP2_HUMAN
15 Dec 2023 00:52:48,922 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:48,922 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 00:52:49,026 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:49,026 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 00:52:49,238 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:49,238 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 00:52:49,400 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:49,401 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 00:52:49,800 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:52:49,801 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 00:52:50,129 DEBUG: Total peptides inserted: 16
15 Dec 2023 00:52:50,129 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 00:52:50,203 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:50,203 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 00:52:50,244 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:50,244 INFO : Inserting sp|Q15233|NONO_HUMAN
15 Dec 2023 00:52:50,296 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:50,296 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 00:52:50,341 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:50,341 INFO : Inserting sp|Q15262|PTPRK_HUMAN
15 Dec 2023 00:52:50,392 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:50,392 INFO : Inserting sp|Q15286|RAB35_HUMAN
15 Dec 2023 00:52:50,433 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:50,433 INFO : Inserting sp|Q15293|RCN1_HUMAN
15 Dec 2023 00:52:50,461 INFO : 79% Done
15 Dec 2023 00:52:50,472 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:50,472 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 00:52:50,563 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:50,563 INFO : Imported 1400 peptide groups.
15 Dec 2023 00:52:50,563 INFO : Inserting sp|Q15369|ELOC_HUMAN
15 Dec 2023 00:52:50,594 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:50,594 INFO : Inserting sp|Q15370|ELOB_HUMAN
15 Dec 2023 00:52:50,610 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:50,610 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 00:52:50,692 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:50,692 INFO : Inserting sp|Q15393|SF3B3_HUMAN
15 Dec 2023 00:52:50,721 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:50,721 INFO : Inserting sp|Q15427|SF3B4_HUMAN
15 Dec 2023 00:52:50,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:50,744 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 00:52:50,819 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:50,819 INFO : Inserting sp|Q15436|SC23A_HUMAN
15 Dec 2023 00:52:50,869 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:50,869 INFO : Inserting sp|Q15459|SF3A1_HUMAN
15 Dec 2023 00:52:50,925 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:50,925 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 00:52:50,969 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:50,969 INFO : Inserting sp|Q15555|MARE2_HUMAN
15 Dec 2023 00:52:51,000 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:51,000 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 00:52:51,677 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:51,677 INFO : Inserting sp|Q15631|TSN_HUMAN
15 Dec 2023 00:52:51,771 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:51,771 INFO : Inserting sp|Q15637|SF01_HUMAN
15 Dec 2023 00:52:51,793 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:51,793 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 00:52:51,851 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:51,851 INFO : Inserting sp|Q15717|ELAV1_HUMAN
15 Dec 2023 00:52:51,886 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:51,886 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 00:52:52,093 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:52,093 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 00:52:52,177 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:52,177 INFO : Inserting sp|Q15819|UB2V2_HUMAN
15 Dec 2023 00:52:52,272 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:52,272 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 00:52:52,325 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:52,325 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 00:52:52,476 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:52,476 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 00:52:52,525 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:52,526 INFO : Inserting sp|Q15904|VAS1_HUMAN
15 Dec 2023 00:52:52,657 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:52,657 INFO : Inserting sp|Q15907|RB11B_HUMAN
15 Dec 2023 00:52:52,769 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:52,769 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 00:52:52,885 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:52,885 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 00:52:52,945 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:52,945 INFO : Inserting sp|Q16204|CCDC6_HUMAN
15 Dec 2023 00:52:52,963 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:52,963 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 00:52:53,198 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:52:53,199 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 00:52:53,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:53,247 INFO : Inserting sp|Q16531|DDB1_HUMAN
15 Dec 2023 00:52:53,264 INFO : 80% Done
15 Dec 2023 00:52:53,360 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:53,360 INFO : Inserting sp|Q16539|MK14_HUMAN
15 Dec 2023 00:52:53,432 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:53,432 INFO : Inserting sp|Q16543|CDC37_HUMAN
15 Dec 2023 00:52:53,557 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:53,557 INFO : Inserting sp|Q16555|DPYL2_HUMAN
15 Dec 2023 00:52:53,862 DEBUG: Total peptides inserted: 19
15 Dec 2023 00:52:53,862 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 00:52:54,327 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:52:54,327 INFO : Inserting sp|Q16620|NTRK2_HUMAN
15 Dec 2023 00:52:54,399 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:54,399 INFO : Inserting sp|Q16627|CCL14_HUMAN
15 Dec 2023 00:52:54,424 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:54,424 INFO : Inserting sp|Q16629|SRSF7_HUMAN
15 Dec 2023 00:52:54,460 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:54,460 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 00:52:54,481 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:54,481 INFO : Inserting sp|Q16658|FSCN1_HUMAN
15 Dec 2023 00:52:54,605 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:54,605 INFO : Inserting sp|Q16666|IF16_HUMAN
15 Dec 2023 00:52:54,704 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:54,704 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 00:52:55,014 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:52:55,014 INFO : Inserting sp|Q16719|KYNU_HUMAN
15 Dec 2023 00:52:55,043 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:55,043 INFO : Inserting sp|Q16769|QPCT_HUMAN
15 Dec 2023 00:52:55,126 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:55,126 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 00:52:55,215 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:55,215 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 00:52:55,310 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:55,310 INFO : Inserting sp|Q16799|RTN1_HUMAN
15 Dec 2023 00:52:55,327 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:55,327 INFO : Inserting sp|Q16836|HCDH_HUMAN
15 Dec 2023 00:52:55,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:55,352 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 00:52:55,903 DEBUG: Total peptides inserted: 22
15 Dec 2023 00:52:55,903 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 00:52:56,058 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:56,058 INFO : Inserting sp|Q24JP5|T132A_HUMAN
15 Dec 2023 00:52:56,088 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:56,088 INFO : Inserting sp|Q30154|DRB5_HUMAN
15 Dec 2023 00:52:56,121 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:56,121 INFO : Inserting sp|Q32MZ4|LRRF1_HUMAN
15 Dec 2023 00:52:56,197 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:56,197 INFO : Inserting sp|Q3L8U1|CHD9_HUMAN
15 Dec 2023 00:52:56,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,216 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 00:52:56,354 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:56,355 INFO : Inserting sp|Q3V6T2|GRDN_HUMAN
15 Dec 2023 00:52:56,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,374 INFO : Inserting sp|Q502W6|VWA3B_HUMAN
15 Dec 2023 00:52:56,395 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,395 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 00:52:56,508 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:56,508 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 00:52:56,593 INFO : 81% Done
15 Dec 2023 00:52:56,734 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:52:56,734 INFO : Inserting sp|Q53FA7|QORX_HUMAN
15 Dec 2023 00:52:56,754 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,755 INFO : Inserting sp|Q5CZC0|FSIP2_HUMAN
15 Dec 2023 00:52:56,851 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:56,851 INFO : Inserting sp|Q5IJ48|CRUM2_HUMAN
15 Dec 2023 00:52:56,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,916 INFO : Inserting sp|Q5JRA6|TGO1_HUMAN
15 Dec 2023 00:52:56,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:56,935 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 00:52:57,013 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:57,014 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 00:52:57,201 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:57,201 INFO : Inserting sp|Q5SY16|NOL9_HUMAN
15 Dec 2023 00:52:57,212 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:57,212 INFO : Inserting sp|Q5T011|SZT2_HUMAN
15 Dec 2023 00:52:57,306 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:52:57,306 INFO : Inserting sp|Q5T1M5|FKB15_HUMAN
15 Dec 2023 00:52:57,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:57,340 INFO : Inserting sp|Q5TZA2|CROCC_HUMAN
15 Dec 2023 00:52:57,366 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:57,366 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 00:52:57,413 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:57,413 INFO : Inserting sp|Q5W5X9|TTC23_HUMAN
15 Dec 2023 00:52:57,454 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:57,454 INFO : Inserting sp|Q5XKE5|K2C79_HUMAN
15 Dec 2023 00:52:57,561 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:57,561 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 00:52:57,720 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:57,720 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 00:52:57,789 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:52:57,789 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 00:52:57,855 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:57,855 INFO : Inserting sp|Q6GTX8|LAIR1_HUMAN
15 Dec 2023 00:52:57,886 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:57,886 INFO : Inserting sp|Q6IA69|NADE_HUMAN
15 Dec 2023 00:52:57,943 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:57,943 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 00:52:58,290 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:58,290 INFO : Inserting sp|Q6P4A8|PLBL1_HUMAN
15 Dec 2023 00:52:58,379 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:52:58,380 INFO : Inserting sp|Q6UVK1|CSPG4_HUMAN
15 Dec 2023 00:52:58,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:52:58,408 INFO : Inserting sp|Q6UWR7|ENPP6_HUMAN
15 Dec 2023 00:52:58,452 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:58,453 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 00:52:58,655 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:58,655 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 00:52:58,825 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:52:58,825 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 00:52:59,011 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:59,011 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 00:52:59,159 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:52:59,159 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 00:52:59,356 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:52:59,356 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 00:52:59,396 INFO : 82% Done
15 Dec 2023 00:52:59,556 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:59,557 INFO : Inserting sp|Q70J99|UN13D_HUMAN
15 Dec 2023 00:52:59,589 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:52:59,589 INFO : Inserting sp|Q71DI3|H32_HUMAN
15 Dec 2023 00:52:59,734 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:52:59,734 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 00:52:59,944 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:52:59,944 INFO : Inserting sp|Q71UI9|H2AV_HUMAN
15 Dec 2023 00:52:59,993 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:52:59,993 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 00:53:00,066 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:00,066 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 00:53:00,114 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:00,114 INFO : Inserting sp|Q7L0Y3|TM10C_HUMAN
15 Dec 2023 00:53:00,132 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,132 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 00:53:00,204 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:00,204 INFO : Inserting sp|Q7L591|DOK3_HUMAN
15 Dec 2023 00:53:00,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,230 INFO : Inserting sp|Q7L5N1|CSN6_HUMAN
15 Dec 2023 00:53:00,268 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:00,268 INFO : Inserting sp|Q7L5N7|PCAT2_HUMAN
15 Dec 2023 00:53:00,284 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,284 INFO : Inserting sp|Q7L7X3|TAOK1_HUMAN
15 Dec 2023 00:53:00,295 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,295 INFO : Inserting sp|Q7L9L4|MOB1B_HUMAN
15 Dec 2023 00:53:00,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:00,344 INFO : Inserting sp|Q7LBR1|CHM1B_HUMAN
15 Dec 2023 00:53:00,360 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,360 INFO : Inserting sp|Q7RTP6|MICA3_HUMAN
15 Dec 2023 00:53:00,382 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,382 INFO : Imported 1500 peptide groups.
15 Dec 2023 00:53:00,382 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 00:53:00,438 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:00,438 INFO : Inserting sp|Q7Z3Y7|K1C28_HUMAN
15 Dec 2023 00:53:00,503 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:00,503 INFO : Inserting sp|Q7Z3Y9|K1C26_HUMAN
15 Dec 2023 00:53:00,568 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:00,568 INFO : Inserting sp|Q7Z3Z0|K1C25_HUMAN
15 Dec 2023 00:53:00,637 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:00,637 INFO : Inserting sp|Q7Z406|MYH14_HUMAN
15 Dec 2023 00:53:00,769 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:00,769 INFO : Inserting sp|Q7Z5A7|TAFA5_HUMAN
15 Dec 2023 00:53:00,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:00,779 INFO : Inserting sp|Q7Z5R6|AB1IP_HUMAN
15 Dec 2023 00:53:00,870 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:00,870 INFO : Inserting sp|Q7Z6I6|RHG30_HUMAN
15 Dec 2023 00:53:00,908 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:00,908 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 00:53:00,983 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:00,983 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 00:53:01,126 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:01,126 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 00:53:01,382 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:01,382 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 00:53:01,512 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:01,512 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 00:53:01,606 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:01,606 INFO : Inserting sp|Q86UW6|N4BP2_HUMAN
15 Dec 2023 00:53:01,624 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:01,624 INFO : Inserting sp|Q86UX2|ITIH5_HUMAN
15 Dec 2023 00:53:01,760 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:01,760 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 00:53:02,175 DEBUG: Total peptides inserted: 17
15 Dec 2023 00:53:02,175 INFO : Inserting sp|Q86V81|THOC4_HUMAN
15 Dec 2023 00:53:02,193 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:02,193 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 00:53:02,260 INFO : 83% Done
15 Dec 2023 00:53:02,829 DEBUG: Total peptides inserted: 31
15 Dec 2023 00:53:02,829 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 00:53:02,896 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:02,896 INFO : Inserting sp|Q86VZ4|LRP11_HUMAN
15 Dec 2023 00:53:02,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:02,935 INFO : Inserting sp|Q86X29|LSR_HUMAN
15 Dec 2023 00:53:02,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:02,960 INFO : Inserting sp|Q86XX4|FRAS1_HUMAN
15 Dec 2023 00:53:02,990 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:02,990 INFO : Inserting sp|Q86YS3|RFIP4_HUMAN
15 Dec 2023 00:53:03,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:03,016 INFO : Inserting sp|Q86YT9|JAML_HUMAN
15 Dec 2023 00:53:03,098 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:03,098 INFO : Inserting sp|Q86YZ3|HORN_HUMAN
15 Dec 2023 00:53:03,158 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:03,158 INFO : Inserting sp|Q8IUE6|H2A2B_HUMAN
15 Dec 2023 00:53:03,202 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,202 INFO : Inserting sp|Q8IUG5|MY18B_HUMAN
15 Dec 2023 00:53:03,242 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,242 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 00:53:03,443 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:03,444 INFO : Inserting sp|Q8IV08|PLD3_HUMAN
15 Dec 2023 00:53:03,501 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:03,501 INFO : Inserting sp|Q8IVL5|P3H2_HUMAN
15 Dec 2023 00:53:03,537 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:03,537 INFO : Inserting sp|Q8IWT3|CUL9_HUMAN
15 Dec 2023 00:53:03,575 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,575 INFO : Inserting sp|Q8IWU5|SULF2_HUMAN
15 Dec 2023 00:53:03,617 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:03,617 INFO : Inserting sp|Q8IX19|MCEM1_HUMAN
15 Dec 2023 00:53:03,678 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,678 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 00:53:03,847 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:03,847 INFO : Inserting sp|Q8IYJ0|PIANP_HUMAN
15 Dec 2023 00:53:03,888 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,888 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 00:53:03,913 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:03,913 INFO : Inserting sp|Q8IZP0|ABI1_HUMAN
15 Dec 2023 00:53:03,948 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:03,948 INFO : Inserting sp|Q8N114|SHSA5_HUMAN
15 Dec 2023 00:53:04,025 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:04,025 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 00:53:04,161 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:04,162 INFO : Inserting sp|Q8N1K5|THMS1_HUMAN
15 Dec 2023 00:53:04,190 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:04,190 INFO : Inserting sp|Q8N257|H2B3B_HUMAN
15 Dec 2023 00:53:04,327 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:04,327 INFO : Inserting sp|Q8N2C7|UNC80_HUMAN
15 Dec 2023 00:53:04,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:04,347 INFO : Inserting sp|Q8N2S1|LTBP4_HUMAN
15 Dec 2023 00:53:04,442 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:04,442 INFO : Inserting sp|Q8N339|MT1M_HUMAN
15 Dec 2023 00:53:04,454 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:04,454 INFO : Inserting sp|Q8N3J6|CADM2_HUMAN
15 Dec 2023 00:53:04,505 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:04,505 INFO : Inserting sp|Q8N474|SFRP1_HUMAN
15 Dec 2023 00:53:04,599 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:04,599 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 00:53:04,713 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:04,713 INFO : Inserting sp|Q8N6Q3|CD177_HUMAN
15 Dec 2023 00:53:04,809 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:04,810 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 00:53:04,956 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:04,956 INFO : Inserting sp|Q8NBP7|PCSK9_HUMAN
15 Dec 2023 00:53:04,988 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:04,988 INFO : Inserting sp|Q8NBQ5|DHB11_HUMAN
15 Dec 2023 00:53:05,017 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,017 INFO : Inserting sp|Q8NCL4|GALT6_HUMAN
15 Dec 2023 00:53:05,086 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:05,086 INFO : Inserting sp|Q8NCW6|GLT11_HUMAN
15 Dec 2023 00:53:05,105 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,105 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 00:53:05,177 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:05,177 INFO : Inserting sp|Q8NF99|ZN397_HUMAN
15 Dec 2023 00:53:05,189 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,189 INFO : Inserting sp|Q8NFP9|NBEA_HUMAN
15 Dec 2023 00:53:05,220 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:05,220 INFO : Inserting sp|Q8NFT8|DNER_HUMAN
15 Dec 2023 00:53:05,259 INFO : 84% Done
15 Dec 2023 00:53:05,271 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:05,271 INFO : Inserting sp|Q8NFZ8|CADM4_HUMAN
15 Dec 2023 00:53:05,463 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:05,463 INFO : Inserting sp|Q8NG11|TSN14_HUMAN
15 Dec 2023 00:53:05,514 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:05,514 INFO : Inserting sp|Q8NHJ6|LIRB4_HUMAN
15 Dec 2023 00:53:05,553 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:05,553 INFO : Inserting sp|Q8NHP6|MSPD2_HUMAN
15 Dec 2023 00:53:05,583 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,583 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 00:53:05,617 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,617 INFO : Inserting sp|Q8TAG5|VTM2A_HUMAN
15 Dec 2023 00:53:05,678 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:05,678 INFO : Inserting sp|Q8TAT6|NPL4_HUMAN
15 Dec 2023 00:53:05,703 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:05,703 INFO : Inserting sp|Q8TD26|CHD6_HUMAN
15 Dec 2023 00:53:05,719 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,719 INFO : Inserting sp|Q8TDQ0|HAVR2_HUMAN
15 Dec 2023 00:53:05,754 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:05,754 INFO : Inserting sp|Q8TDQ1|CLM1_HUMAN
15 Dec 2023 00:53:05,796 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:05,796 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 00:53:05,841 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:05,841 INFO : Inserting sp|Q8TES7|FBF1_HUMAN
15 Dec 2023 00:53:05,861 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:05,861 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 00:53:05,974 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:05,974 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 00:53:05,997 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:05,997 INFO : Inserting sp|Q8WU79|SMAP2_HUMAN
15 Dec 2023 00:53:06,024 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:06,024 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 00:53:06,491 DEBUG: Total peptides inserted: 24
15 Dec 2023 00:53:06,491 INFO : Inserting sp|Q8WVN6|SCTM1_HUMAN
15 Dec 2023 00:53:06,507 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:06,508 INFO : Inserting sp|Q8WVQ1|CANT1_HUMAN
15 Dec 2023 00:53:06,633 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:06,634 INFO : Inserting sp|Q8WVV9|HNRLL_HUMAN
15 Dec 2023 00:53:06,662 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:06,662 INFO : Inserting sp|Q8WWI1|LMO7_HUMAN
15 Dec 2023 00:53:06,709 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:06,709 INFO : Inserting sp|Q8WWI5|CTL1_HUMAN
15 Dec 2023 00:53:06,750 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:06,750 INFO : Inserting sp|Q8WWX9|SELM_HUMAN
15 Dec 2023 00:53:06,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:06,784 INFO : Inserting sp|Q8WXA3|RUFY2_HUMAN
15 Dec 2023 00:53:06,820 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:06,820 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 00:53:07,197 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:53:07,197 INFO : Inserting sp|Q8WXH0|SYNE2_HUMAN
15 Dec 2023 00:53:07,249 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:07,249 INFO : Inserting sp|Q8WXX5|DNJC9_HUMAN
15 Dec 2023 00:53:07,269 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:07,270 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 00:53:07,463 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:07,463 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 00:53:07,618 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:07,618 INFO : Inserting sp|Q92484|ASM3A_HUMAN
15 Dec 2023 00:53:07,634 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:07,634 INFO : Inserting sp|Q92496|FHR4_HUMAN
15 Dec 2023 00:53:07,753 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:07,753 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 00:53:07,968 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:07,968 INFO : Inserting sp|Q92522|H1X_HUMAN
15 Dec 2023 00:53:08,026 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:08,026 INFO : Inserting sp|Q92538|GBF1_HUMAN
15 Dec 2023 00:53:08,057 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:08,057 INFO : Inserting sp|Q92542|NICA_HUMAN
15 Dec 2023 00:53:08,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:08,092 INFO : Inserting sp|Q92556|ELMO1_HUMAN
15 Dec 2023 00:53:08,196 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:08,196 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 00:53:08,240 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:08,240 INFO : Inserting sp|Q92599|SEPT8_HUMAN
15 Dec 2023 00:53:08,302 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:08,302 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 00:53:08,394 INFO : 85% Done
15 Dec 2023 00:53:08,412 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:08,412 INFO : Inserting sp|Q92619|HMHA1_HUMAN
15 Dec 2023 00:53:08,461 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:08,461 INFO : Inserting sp|Q92673|SORL_HUMAN
15 Dec 2023 00:53:08,563 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:08,563 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 00:53:08,649 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:08,649 INFO : Inserting sp|Q92692|NECT2_HUMAN
15 Dec 2023 00:53:08,722 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:08,722 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 00:53:08,875 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:08,875 INFO : Imported 1600 peptide groups.
15 Dec 2023 00:53:08,875 INFO : Inserting sp|Q92764|KRT35_HUMAN
15 Dec 2023 00:53:08,913 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:08,913 INFO : Inserting sp|Q92765|SFRP3_HUMAN
15 Dec 2023 00:53:09,035 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:09,036 INFO : Inserting sp|Q92802|N42L2_HUMAN
15 Dec 2023 00:53:09,058 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:09,059 INFO : Inserting sp|Q92804|RBP56_HUMAN
15 Dec 2023 00:53:09,103 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:09,104 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 00:53:09,271 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:09,271 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 00:53:09,847 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:53:09,847 INFO : Inserting sp|Q92841|DDX17_HUMAN
15 Dec 2023 00:53:09,972 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:09,972 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 00:53:10,035 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:10,035 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 00:53:10,470 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:10,470 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 00:53:10,793 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:53:10,793 INFO : Inserting sp|Q92882|OSTF1_HUMAN
15 Dec 2023 00:53:10,900 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:10,900 INFO : Inserting sp|Q92888|ARHG1_HUMAN
15 Dec 2023 00:53:10,945 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:10,945 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 00:53:11,064 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:11,064 INFO : Inserting sp|Q92911|SC5A5_HUMAN
15 Dec 2023 00:53:11,211 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:11,211 INFO : Inserting sp|Q92922|SMRC1_HUMAN
15 Dec 2023 00:53:11,247 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:11,247 INFO : Inserting sp|Q92930|RAB8B_HUMAN
15 Dec 2023 00:53:11,328 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:11,328 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 00:53:11,483 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:11,483 INFO : Inserting sp|Q92973|TNPO1_HUMAN
15 Dec 2023 00:53:11,539 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:11,539 INFO : Inserting sp|Q93050|VPP1_HUMAN
15 Dec 2023 00:53:11,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:11,554 INFO : Inserting sp|Q93084|AT2A3_HUMAN
15 Dec 2023 00:53:11,578 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:11,578 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 00:53:11,613 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:11,613 INFO : Inserting sp|Q93097|WNT2B_HUMAN
15 Dec 2023 00:53:11,625 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:11,626 INFO : Inserting sp|Q969H8|MYDGF_HUMAN
15 Dec 2023 00:53:11,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:11,636 INFO : Inserting sp|Q969P0|IGSF8_HUMAN
15 Dec 2023 00:53:11,660 INFO : 86% Done
15 Dec 2023 00:53:11,826 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:11,827 INFO : Inserting sp|Q969Q5|RAB24_HUMAN
15 Dec 2023 00:53:11,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:11,851 INFO : Inserting sp|Q969T9|WBP2_HUMAN
15 Dec 2023 00:53:11,876 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:11,876 INFO : Inserting sp|Q96A08|H2B1A_HUMAN
15 Dec 2023 00:53:11,955 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:11,955 INFO : Inserting sp|Q96A72|MGN2_HUMAN
15 Dec 2023 00:53:12,002 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,003 INFO : Inserting sp|Q96AG4|LRC59_HUMAN
15 Dec 2023 00:53:12,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:12,024 INFO : Inserting sp|Q96AP7|ESAM_HUMAN
15 Dec 2023 00:53:12,051 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:12,052 INFO : Inserting sp|Q96AX2|RAB37_HUMAN
15 Dec 2023 00:53:12,075 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:12,075 INFO : Inserting sp|Q96B86|RGMA_HUMAN
15 Dec 2023 00:53:12,107 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,107 INFO : Inserting sp|Q96BY6|DOC10_HUMAN
15 Dec 2023 00:53:12,142 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,142 INFO : Inserting sp|Q96BZ4|PLD4_HUMAN
15 Dec 2023 00:53:12,219 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:12,220 INFO : Inserting sp|Q96C23|GALM_HUMAN
15 Dec 2023 00:53:12,313 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,314 INFO : Inserting sp|Q96C24|SYTL4_HUMAN
15 Dec 2023 00:53:12,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:12,331 INFO : Inserting sp|Q96C86|DCPS_HUMAN
15 Dec 2023 00:53:12,457 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:12,457 INFO : Inserting sp|Q96CG8|CTHR1_HUMAN
15 Dec 2023 00:53:12,511 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:12,511 INFO : Inserting sp|Q96CW1|AP2M1_HUMAN
15 Dec 2023 00:53:12,596 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:12,596 INFO : Inserting sp|Q96D96|HVCN1_HUMAN
15 Dec 2023 00:53:12,606 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:12,606 INFO : Inserting sp|Q96EP5|DAZP1_HUMAN
15 Dec 2023 00:53:12,629 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:12,629 INFO : Inserting sp|Q96EY7|PTCD3_HUMAN
15 Dec 2023 00:53:12,675 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:12,675 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 00:53:12,763 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:12,763 INFO : Inserting sp|Q96FE7|P3IP1_HUMAN
15 Dec 2023 00:53:12,792 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,793 INFO : Inserting sp|Q96FJ2|DYL2_HUMAN
15 Dec 2023 00:53:12,814 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:12,814 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 00:53:12,884 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:12,884 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 00:53:13,185 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:53:13,185 INFO : Inserting sp|Q96GG9|DCNL1_HUMAN
15 Dec 2023 00:53:13,209 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:13,209 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 00:53:13,354 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:13,354 INFO : Inserting sp|Q96GX9|MTNB_HUMAN
15 Dec 2023 00:53:13,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:13,367 INFO : Inserting sp|Q96HD1|CREL1_HUMAN
15 Dec 2023 00:53:13,407 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:13,407 INFO : Inserting sp|Q96HE7|ERO1A_HUMAN
15 Dec 2023 00:53:13,444 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:13,445 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 00:53:13,512 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:13,512 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 00:53:13,773 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:13,773 INFO : Inserting sp|Q96JG9|ZN469_HUMAN
15 Dec 2023 00:53:13,793 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:13,793 INFO : Inserting sp|Q96KG7|MEG10_HUMAN
15 Dec 2023 00:53:13,951 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:13,952 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 00:53:14,016 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:14,016 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 00:53:14,499 INFO : 87% Done
15 Dec 2023 00:53:14,537 DEBUG: Total peptides inserted: 28
15 Dec 2023 00:53:14,537 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 00:53:14,799 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:14,799 INFO : Inserting sp|Q96L92|SNX27_HUMAN
15 Dec 2023 00:53:14,840 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:14,840 INFO : Inserting sp|Q96LB3|IFT74_HUMAN
15 Dec 2023 00:53:14,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:14,851 INFO : Inserting sp|Q96NY7|CLIC6_HUMAN
15 Dec 2023 00:53:14,991 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:14,991 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 00:53:15,221 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:15,221 INFO : Inserting sp|Q96PP8|GBP5_HUMAN
15 Dec 2023 00:53:15,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:15,257 INFO : Inserting sp|Q96PX8|SLIK1_HUMAN
15 Dec 2023 00:53:15,304 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:15,304 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 00:53:15,563 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:15,563 INFO : Inserting sp|Q96S97|MYADM_HUMAN
15 Dec 2023 00:53:15,583 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:15,583 INFO : Inserting sp|Q96TA1|NIBA2_HUMAN
15 Dec 2023 00:53:15,603 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:15,603 INFO : Inserting sp|Q99426|TBCB_HUMAN
15 Dec 2023 00:53:15,664 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:15,664 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 00:53:16,235 DEBUG: Total peptides inserted: 29
15 Dec 2023 00:53:16,235 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 00:53:16,303 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:16,303 INFO : Inserting sp|Q99439|CNN2_HUMAN
15 Dec 2023 00:53:16,420 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:16,421 INFO : Inserting sp|Q99453|PHX2B_HUMAN
15 Dec 2023 00:53:16,440 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:16,440 INFO : Inserting sp|Q99471|PFD5_HUMAN
15 Dec 2023 00:53:16,521 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:16,521 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 00:53:16,882 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:16,882 INFO : Inserting sp|Q99519|NEUR1_HUMAN
15 Dec 2023 00:53:16,959 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:16,959 INFO : Inserting sp|Q99536|VAT1_HUMAN
15 Dec 2023 00:53:17,061 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:17,061 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 00:53:17,324 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:17,324 INFO : Inserting sp|Q99542|MMP19_HUMAN
15 Dec 2023 00:53:17,375 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:17,375 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 00:53:17,541 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:17,541 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 00:53:17,618 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:17,618 INFO : Inserting sp|Q99613|EIF3C_HUMAN
15 Dec 2023 00:53:17,670 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:17,670 INFO : Inserting sp|Q99623|PHB2_HUMAN
15 Dec 2023 00:53:17,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:17,698 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 00:53:17,713 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:17,713 INFO : Inserting sp|Q99715|COCA1_HUMAN
15 Dec 2023 00:53:17,764 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:17,765 INFO : Inserting sp|Q99729|ROAA_HUMAN
15 Dec 2023 00:53:17,793 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:17,793 INFO : Inserting sp|Q99733|NP1L4_HUMAN
15 Dec 2023 00:53:17,832 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:17,832 INFO : Inserting sp|Q99757|THIOM_HUMAN
15 Dec 2023 00:53:17,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:17,865 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 00:53:17,883 INFO : 88% Done
15 Dec 2023 00:53:17,955 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:17,955 INFO : Inserting sp|Q99798|ACON_HUMAN
15 Dec 2023 00:53:18,033 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:18,033 INFO : Inserting sp|Q99828|CIB1_HUMAN
15 Dec 2023 00:53:18,077 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:18,077 INFO : Inserting sp|Q99829|CPNE1_HUMAN
15 Dec 2023 00:53:18,135 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:18,136 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 00:53:18,225 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:18,225 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 00:53:18,295 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:18,295 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 00:53:18,455 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:53:18,455 INFO : Inserting sp|Q99941|ATF6B_HUMAN
15 Dec 2023 00:53:18,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:18,479 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 00:53:18,591 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:18,591 INFO : Inserting sp|Q99983|OMD_HUMAN
15 Dec 2023 00:53:18,710 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:18,710 INFO : Inserting sp|Q99986|VRK1_HUMAN
15 Dec 2023 00:53:18,804 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:18,805 INFO : Inserting sp|Q9BQ16|TICN3_HUMAN
15 Dec 2023 00:53:18,892 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:18,892 INFO : Imported 1700 peptide groups.
15 Dec 2023 00:53:18,892 INFO : Inserting sp|Q9BQ51|PD1L2_HUMAN
15 Dec 2023 00:53:18,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:18,916 INFO : Inserting sp|Q9BQT9|CSTN3_HUMAN
15 Dec 2023 00:53:19,074 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:19,074 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 00:53:19,101 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:19,101 INFO : Inserting sp|Q9BRA2|TXD17_HUMAN
15 Dec 2023 00:53:19,184 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:19,184 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 00:53:19,345 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:19,345 INFO : Inserting sp|Q9BRJ9|MESP1_HUMAN
15 Dec 2023 00:53:19,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:19,378 INFO : Inserting sp|Q9BRK3|MXRA8_HUMAN
15 Dec 2023 00:53:19,438 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:19,438 INFO : Inserting sp|Q9BRK5|CAB45_HUMAN
15 Dec 2023 00:53:19,464 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:19,464 INFO : Inserting sp|Q9BRR6|ADPGK_HUMAN
15 Dec 2023 00:53:19,493 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:19,494 INFO : Inserting sp|Q9BS26|ERP44_HUMAN
15 Dec 2023 00:53:19,538 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:19,538 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 00:53:19,558 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:19,559 INFO : Inserting sp|Q9BSJ8|ESYT1_HUMAN
15 Dec 2023 00:53:19,619 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:19,619 INFO : Inserting sp|Q9BT78|CSN4_HUMAN
15 Dec 2023 00:53:19,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:19,646 INFO : Inserting sp|Q9BTT0|AN32E_HUMAN
15 Dec 2023 00:53:19,860 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:19,860 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 00:53:20,066 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:53:20,066 INFO : Inserting sp|Q9BU40|CRDL1_HUMAN
15 Dec 2023 00:53:20,130 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:20,130 INFO : Inserting sp|Q9BUJ2|HNRL1_HUMAN
15 Dec 2023 00:53:20,209 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:20,209 INFO : Inserting sp|Q9BVA1|TBB2B_HUMAN
15 Dec 2023 00:53:20,380 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:20,380 INFO : Inserting sp|Q9BVC6|TM109_HUMAN
15 Dec 2023 00:53:20,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,399 INFO : Inserting sp|Q9BWM7|SFXN3_HUMAN
15 Dec 2023 00:53:20,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,420 INFO : Inserting sp|Q9BWP8|COL11_HUMAN
15 Dec 2023 00:53:20,437 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,437 INFO : Inserting sp|Q9BX67|JAM3_HUMAN
15 Dec 2023 00:53:20,465 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:20,465 INFO : Inserting sp|Q9BXJ0|C1QT5_HUMAN
15 Dec 2023 00:53:20,541 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:20,541 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 00:53:20,655 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:20,655 INFO : Inserting sp|Q9BXS5|AP1M1_HUMAN
15 Dec 2023 00:53:20,681 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,682 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 00:53:20,904 INFO : 89% Done
15 Dec 2023 00:53:20,925 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:20,925 INFO : Inserting sp|Q9BY11|PACN1_HUMAN
15 Dec 2023 00:53:20,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,943 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 00:53:20,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:20,960 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 00:53:21,059 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:21,059 INFO : Inserting sp|Q9BY76|ANGL4_HUMAN
15 Dec 2023 00:53:21,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,089 INFO : Inserting sp|Q9BY79|MFRP_HUMAN
15 Dec 2023 00:53:21,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,125 INFO : Inserting sp|Q9BYH1|SE6L1_HUMAN
15 Dec 2023 00:53:21,289 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:21,289 INFO : Inserting sp|Q9BYV7|BCDO2_HUMAN
15 Dec 2023 00:53:21,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,302 INFO : Inserting sp|Q9BZM5|ULBP2_HUMAN
15 Dec 2023 00:53:21,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,326 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 00:53:21,523 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:21,523 INFO : Inserting sp|Q9BZR6|RTN4R_HUMAN
15 Dec 2023 00:53:21,558 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:21,558 INFO : Inserting sp|Q9BZZ5|API5_HUMAN
15 Dec 2023 00:53:21,576 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,576 INFO : Inserting sp|Q9C0J1|B3GN4_HUMAN
15 Dec 2023 00:53:21,588 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,588 INFO : Inserting sp|Q9GZR1|SENP6_HUMAN
15 Dec 2023 00:53:21,623 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,623 INFO : Inserting sp|Q9GZS3|SKI8_HUMAN
15 Dec 2023 00:53:21,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,636 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 00:53:21,726 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:21,726 INFO : Inserting sp|Q9GZX9|TWSG1_HUMAN
15 Dec 2023 00:53:21,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,757 INFO : Inserting sp|Q9H008|LHPP_HUMAN
15 Dec 2023 00:53:21,815 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:21,815 INFO : Inserting sp|Q9H0E2|TOLIP_HUMAN
15 Dec 2023 00:53:21,843 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,843 INFO : Inserting sp|Q9H0Q3|FXYD6_HUMAN
15 Dec 2023 00:53:21,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:21,867 INFO : Inserting sp|Q9H0U4|RAB1B_HUMAN
15 Dec 2023 00:53:22,049 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:22,049 INFO : Inserting sp|Q9H0W9|CK054_HUMAN
15 Dec 2023 00:53:22,087 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:22,088 INFO : Inserting sp|Q9H1Z8|AUGN_HUMAN
15 Dec 2023 00:53:22,112 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,112 INFO : Inserting sp|Q9H254|SPTN4_HUMAN
15 Dec 2023 00:53:22,168 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:22,168 INFO : Inserting sp|Q9H269|VPS16_HUMAN
15 Dec 2023 00:53:22,204 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,204 INFO : Inserting sp|Q9H299|SH3L3_HUMAN
15 Dec 2023 00:53:22,364 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:22,364 INFO : Inserting sp|Q9H2A7|CXL16_HUMAN
15 Dec 2023 00:53:22,401 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:22,401 INFO : Inserting sp|Q9H2E6|SEM6A_HUMAN
15 Dec 2023 00:53:22,439 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:22,439 INFO : Inserting sp|Q9H2H8|PPIL3_HUMAN
15 Dec 2023 00:53:22,482 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,482 INFO : Inserting sp|Q9H2K8|TAOK3_HUMAN
15 Dec 2023 00:53:22,494 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,494 INFO : Inserting sp|Q9H2U2|IPYR2_HUMAN
15 Dec 2023 00:53:22,549 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:22,549 INFO : Inserting sp|Q9H3K6|BOLA2_HUMAN
15 Dec 2023 00:53:22,594 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,595 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 00:53:22,776 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:22,776 INFO : Inserting sp|Q9H3T3|SEM6B_HUMAN
15 Dec 2023 00:53:22,790 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,790 INFO : Inserting sp|Q9H461|FZD8_HUMAN
15 Dec 2023 00:53:22,819 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:22,819 INFO : Inserting sp|Q9H4A9|DPEP2_HUMAN
15 Dec 2023 00:53:22,926 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:22,926 INFO : Inserting sp|Q9H4E7|DEFI6_HUMAN
15 Dec 2023 00:53:22,979 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:22,979 INFO : Inserting sp|Q9H4F8|SMOC1_HUMAN
15 Dec 2023 00:53:23,049 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:23,049 INFO : Inserting sp|Q9H4G4|GAPR1_HUMAN
15 Dec 2023 00:53:23,105 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:23,105 INFO : Inserting sp|Q9H4M9|EHD1_HUMAN
15 Dec 2023 00:53:23,423 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:53:23,423 INFO : Inserting sp|Q9H5X1|CIA2A_HUMAN
15 Dec 2023 00:53:23,449 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:23,449 INFO : Inserting sp|Q9H741|SPRNG_HUMAN
15 Dec 2023 00:53:23,514 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:23,514 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 00:53:23,559 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:23,559 INFO : Inserting sp|Q9H8S9|MOB1A_HUMAN
15 Dec 2023 00:53:23,613 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:23,614 INFO : Inserting sp|Q9H993|ARMT1_HUMAN
15 Dec 2023 00:53:23,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:23,657 INFO : Inserting sp|Q9H9G7|AGO3_HUMAN
15 Dec 2023 00:53:23,708 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:23,708 INFO : Inserting sp|Q9HAB8|PPCS_HUMAN
15 Dec 2023 00:53:23,732 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:23,733 INFO : Inserting sp|Q9HAR2|AGRL3_HUMAN
15 Dec 2023 00:53:23,799 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:23,799 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 00:53:23,976 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:23,977 INFO : Inserting sp|Q9HAV0|GBB4_HUMAN
15 Dec 2023 00:53:24,087 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:24,087 INFO : Inserting sp|Q9HB71|CYBP_HUMAN
15 Dec 2023 00:53:24,133 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:24,133 INFO : Inserting sp|Q9HB90|RRAGC_HUMAN
15 Dec 2023 00:53:24,146 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,146 INFO : Inserting sp|Q9HBI0|PARVG_HUMAN
15 Dec 2023 00:53:24,179 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,179 INFO : Inserting sp|Q9HC35|EMAL4_HUMAN
15 Dec 2023 00:53:24,209 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,209 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 00:53:24,315 INFO : 90% Done
15 Dec 2023 00:53:24,342 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:24,343 INFO : Inserting sp|Q9HCD6|TANC2_HUMAN
15 Dec 2023 00:53:24,360 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,361 INFO : Inserting sp|Q9HCG8|CWC22_HUMAN
15 Dec 2023 00:53:24,381 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,381 INFO : Inserting sp|Q9HCJ1|ANKH_HUMAN
15 Dec 2023 00:53:24,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,399 INFO : Inserting sp|Q9HCK8|CHD8_HUMAN
15 Dec 2023 00:53:24,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,415 INFO : Inserting sp|Q9HCU0|CD248_HUMAN
15 Dec 2023 00:53:24,492 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:24,492 INFO : Inserting sp|Q9HCU4|CELR2_HUMAN
15 Dec 2023 00:53:24,536 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,536 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 00:53:24,647 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:24,647 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 00:53:24,818 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:24,818 INFO : Inserting sp|Q9NNX6|CD209_HUMAN
15 Dec 2023 00:53:24,891 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:24,891 INFO : Inserting sp|Q9NP72|RAB18_HUMAN
15 Dec 2023 00:53:24,926 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:24,926 INFO : Inserting sp|Q9NPA2|MMP25_HUMAN
15 Dec 2023 00:53:24,937 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,937 INFO : Inserting sp|Q9NPF2|CHSTB_HUMAN
15 Dec 2023 00:53:24,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,956 INFO : Inserting sp|Q9NPG1|FZD3_HUMAN
15 Dec 2023 00:53:24,973 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:24,973 INFO : Inserting sp|Q9NPH3|IL1AP_HUMAN
15 Dec 2023 00:53:25,028 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:25,028 INFO : Inserting sp|Q9NPR2|SEM4B_HUMAN
15 Dec 2023 00:53:25,112 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:25,112 INFO : Inserting sp|Q9NPY3|C1QR1_HUMAN
15 Dec 2023 00:53:25,136 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:25,137 INFO : Inserting sp|Q9NQ69|LHX9_HUMAN
15 Dec 2023 00:53:25,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,149 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 00:53:25,401 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:25,401 INFO : Inserting sp|Q9NQC3|RTN4_HUMAN
15 Dec 2023 00:53:25,439 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,439 INFO : Inserting sp|Q9NQR4|NIT2_HUMAN
15 Dec 2023 00:53:25,503 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:25,503 INFO : Imported 1800 peptide groups.
15 Dec 2023 00:53:25,503 INFO : Inserting sp|Q9NQW7|XPP1_HUMAN
15 Dec 2023 00:53:25,625 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:25,625 INFO : Inserting sp|Q9NQX5|NPDC1_HUMAN
15 Dec 2023 00:53:25,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,655 INFO : Inserting sp|Q9NR12|PDLI7_HUMAN
15 Dec 2023 00:53:25,671 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,671 INFO : Inserting sp|Q9NR34|MA1C1_HUMAN
15 Dec 2023 00:53:25,720 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:25,720 INFO : Inserting sp|Q9NR45|SIAS_HUMAN
15 Dec 2023 00:53:25,789 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:25,789 INFO : Inserting sp|Q9NRW1|RAB6B_HUMAN
15 Dec 2023 00:53:25,859 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:25,859 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 00:53:25,870 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,870 INFO : Inserting sp|Q9NS15|LTBP3_HUMAN
15 Dec 2023 00:53:25,918 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:25,918 INFO : Inserting sp|Q9NSB4|KRT82_HUMAN
15 Dec 2023 00:53:25,934 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,934 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 00:53:25,963 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:25,963 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 00:53:26,030 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:26,030 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 00:53:26,062 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:26,062 INFO : Inserting sp|Q9NUJ1|ABHDA_HUMAN
15 Dec 2023 00:53:26,094 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:26,094 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 00:53:26,297 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:26,297 INFO : Inserting sp|Q9NUV9|GIMA4_HUMAN
15 Dec 2023 00:53:26,353 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:26,353 INFO : Inserting sp|Q9NX46|ADPRS_HUMAN
15 Dec 2023 00:53:26,462 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:26,462 INFO : Inserting sp|Q9NX62|IMPA3_HUMAN
15 Dec 2023 00:53:26,525 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:26,525 INFO : Inserting sp|Q9NY15|STAB1_HUMAN
15 Dec 2023 00:53:26,652 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:26,652 INFO : Inserting sp|Q9NY33|DPP3_HUMAN
15 Dec 2023 00:53:26,853 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:53:26,853 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 00:53:26,886 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:26,886 INFO : Inserting sp|Q9NYU2|UGGG1_HUMAN
15 Dec 2023 00:53:26,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:26,898 INFO : Inserting sp|Q9NYV4|CDK12_HUMAN
15 Dec 2023 00:53:26,914 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:26,914 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 00:53:26,989 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:26,989 INFO : Inserting sp|Q9NZ53|PDXL2_HUMAN
15 Dec 2023 00:53:27,008 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:27,008 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 00:53:27,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:27,037 INFO : Inserting sp|Q9NZJ4|SACS_HUMAN
15 Dec 2023 00:53:27,061 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:27,061 INFO : Inserting sp|Q9NZJ7|MTCH1_HUMAN
15 Dec 2023 00:53:27,086 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:27,086 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 00:53:27,183 INFO : 91% Done
15 Dec 2023 00:53:27,344 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:27,344 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 00:53:27,415 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:27,415 INFO : Inserting sp|Q9NZM1|MYOF_HUMAN
15 Dec 2023 00:53:27,439 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:27,440 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 00:53:27,541 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:27,541 INFO : Inserting sp|Q9P0K1|ADA22_HUMAN
15 Dec 2023 00:53:27,626 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:27,626 INFO : Inserting sp|Q9P0L0|VAPA_HUMAN
15 Dec 2023 00:53:27,668 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:27,668 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 00:53:27,830 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:27,830 INFO : Inserting sp|Q9P219|DAPLE_HUMAN
15 Dec 2023 00:53:27,844 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:27,844 INFO : Inserting sp|Q9P232|CNTN3_HUMAN
15 Dec 2023 00:53:27,866 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:27,866 INFO : Inserting sp|Q9P258|RCC2_HUMAN
15 Dec 2023 00:53:28,034 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:28,034 INFO : Inserting sp|Q9P2D1|CHD7_HUMAN
15 Dec 2023 00:53:28,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:28,052 INFO : Inserting sp|Q9P2J5|SYLC_HUMAN
15 Dec 2023 00:53:28,068 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:28,068 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 00:53:28,401 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:28,401 INFO : Inserting sp|Q9P2T1|GMPR2_HUMAN
15 Dec 2023 00:53:28,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:28,415 INFO : Inserting sp|Q9UBC2|EP15R_HUMAN
15 Dec 2023 00:53:28,470 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:28,470 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 00:53:28,620 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:28,620 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 00:53:28,931 DEBUG: Total peptides inserted: 15
15 Dec 2023 00:53:28,931 INFO : Inserting sp|Q9UBQ0|VPS29_HUMAN
15 Dec 2023 00:53:29,021 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:29,021 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 00:53:29,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:29,057 INFO : Inserting sp|Q9UBR2|CATZ_HUMAN
15 Dec 2023 00:53:29,188 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:29,188 INFO : Inserting sp|Q9UBW5|BIN2_HUMAN
15 Dec 2023 00:53:29,315 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:29,315 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 00:53:29,355 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:29,356 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 00:53:29,382 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:29,382 INFO : Inserting sp|Q9UBX7|KLK11_HUMAN
15 Dec 2023 00:53:29,460 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:29,460 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 00:53:29,528 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:29,529 INFO : Inserting sp|Q9UEY8|ADDG_HUMAN
15 Dec 2023 00:53:29,563 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:29,563 INFO : Inserting sp|Q9UGJ0|AAKG2_HUMAN
15 Dec 2023 00:53:29,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:29,582 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 00:53:29,787 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:29,787 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 00:53:29,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:29,833 INFO : Inserting sp|Q9UHA4|LTOR3_HUMAN
15 Dec 2023 00:53:29,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:29,866 INFO : Inserting sp|Q9UHD8|SEPT9_HUMAN
15 Dec 2023 00:53:29,897 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:29,898 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 00:53:30,011 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:30,011 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 00:53:30,064 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:30,064 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 00:53:30,215 INFO : 92% Done
15 Dec 2023 00:53:30,338 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:30,338 INFO : Inserting sp|Q9UHX1|PUF60_HUMAN
15 Dec 2023 00:53:30,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:30,349 INFO : Inserting sp|Q9UHY7|ENOPH_HUMAN
15 Dec 2023 00:53:30,374 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:30,374 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 00:53:30,524 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:30,524 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 00:53:30,574 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:30,575 INFO : Inserting sp|Q9UJ68|MSRA_HUMAN
15 Dec 2023 00:53:30,661 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:30,661 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 00:53:30,845 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:30,845 INFO : Inserting sp|Q9UJJ9|GNPTG_HUMAN
15 Dec 2023 00:53:30,963 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:30,964 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 00:53:31,041 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:31,041 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 00:53:31,122 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:31,122 INFO : Inserting sp|Q9UKG1|DP13A_HUMAN
15 Dec 2023 00:53:31,182 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:31,182 INFO : Inserting sp|Q9UKJ1|PILRA_HUMAN
15 Dec 2023 00:53:31,207 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:31,207 INFO : Inserting sp|Q9UKK3|PARP4_HUMAN
15 Dec 2023 00:53:31,227 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:31,227 INFO : Inserting sp|Q9UKK9|NUDT5_HUMAN
15 Dec 2023 00:53:31,284 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:31,284 INFO : Inserting sp|Q9UKM9|RALY_HUMAN
15 Dec 2023 00:53:31,318 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:31,318 INFO : Inserting sp|Q9UKV8|AGO2_HUMAN
15 Dec 2023 00:53:31,343 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:31,343 INFO : Inserting sp|Q9UL18|AGO1_HUMAN
15 Dec 2023 00:53:31,367 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:31,367 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 00:53:31,416 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:31,416 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 00:53:31,522 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:31,523 INFO : Inserting sp|Q9UL54|TAOK2_HUMAN
15 Dec 2023 00:53:31,534 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:31,534 INFO : Inserting sp|Q9ULB1|NRX1A_HUMAN
15 Dec 2023 00:53:31,831 DEBUG: Total peptides inserted: 18
15 Dec 2023 00:53:31,831 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 00:53:31,849 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:31,849 INFO : Inserting sp|Q9ULI3|HEG1_HUMAN
15 Dec 2023 00:53:31,877 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:31,877 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 00:53:31,983 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:31,983 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 00:53:32,168 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:32,168 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 00:53:32,451 DEBUG: Total peptides inserted: 14
15 Dec 2023 00:53:32,451 INFO : Inserting sp|Q9UM22|EPDR1_HUMAN
15 Dec 2023 00:53:32,492 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:32,492 INFO : Inserting sp|Q9UMX5|NENF_HUMAN
15 Dec 2023 00:53:32,539 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:32,539 INFO : Inserting sp|Q9UN36|NDRG2_HUMAN
15 Dec 2023 00:53:32,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:32,554 INFO : Inserting sp|Q9UNF0|PACN2_HUMAN
15 Dec 2023 00:53:32,598 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:32,599 INFO : Inserting sp|Q9UNM6|PSD13_HUMAN
15 Dec 2023 00:53:32,658 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:32,658 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 00:53:32,678 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:32,678 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 00:53:32,866 DEBUG: Total peptides inserted: 11
15 Dec 2023 00:53:32,866 INFO : Inserting sp|Q9UNZ2|NSF1C_HUMAN
15 Dec 2023 00:53:32,886 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:32,886 INFO : Inserting sp|Q9UPR5|NAC2_HUMAN
15 Dec 2023 00:53:32,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:32,899 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 00:53:32,983 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:32,983 INFO : Inserting sp|Q9UQE7|SMC3_HUMAN
15 Dec 2023 00:53:33,060 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:33,060 INFO : Inserting sp|Q9Y240|CLC11_HUMAN
15 Dec 2023 00:53:33,070 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,070 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 00:53:33,111 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:33,112 INFO : Inserting sp|Q9Y275|TN13B_HUMAN
15 Dec 2023 00:53:33,131 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,131 INFO : Imported 1900 peptide groups.
15 Dec 2023 00:53:33,131 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 00:53:33,153 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,153 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 00:53:33,286 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:33,286 INFO : Inserting sp|Q9Y281|COF2_HUMAN
15 Dec 2023 00:53:33,295 INFO : 93% Done
15 Dec 2023 00:53:33,347 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:33,347 INFO : Inserting sp|Q9Y287|ITM2B_HUMAN
15 Dec 2023 00:53:33,370 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:33,370 INFO : Inserting sp|Q9Y2B0|CNPY2_HUMAN
15 Dec 2023 00:53:33,438 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:33,438 INFO : Inserting sp|Q9Y2E5|MA2B2_HUMAN
15 Dec 2023 00:53:33,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:33,468 INFO : Inserting sp|Q9Y2I2|NTNG1_HUMAN
15 Dec 2023 00:53:33,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,484 INFO : Inserting sp|Q9Y2J2|E41L3_HUMAN
15 Dec 2023 00:53:33,564 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:33,564 INFO : Inserting sp|Q9Y2J8|PADI2_HUMAN
15 Dec 2023 00:53:33,586 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,586 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 00:53:33,629 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:33,629 INFO : Inserting sp|Q9Y2T3|GUAD_HUMAN
15 Dec 2023 00:53:33,717 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:33,717 INFO : Inserting sp|Q9Y2V0|CDIN1_HUMAN
15 Dec 2023 00:53:33,729 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,729 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 00:53:33,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,739 INFO : Inserting sp|Q9Y2X0|MED16_HUMAN
15 Dec 2023 00:53:33,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,757 INFO : Inserting sp|Q9Y315|DEOC_HUMAN
15 Dec 2023 00:53:33,837 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:33,837 INFO : Inserting sp|Q9Y333|LSM2_HUMAN
15 Dec 2023 00:53:33,868 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:33,868 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 00:53:33,956 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:33,956 INFO : Inserting sp|Q9Y394|DHRS7_HUMAN
15 Dec 2023 00:53:34,001 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:34,001 INFO : Inserting sp|Q9Y3A3|PHOCN_HUMAN
15 Dec 2023 00:53:34,020 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,020 INFO : Inserting sp|Q9Y3B4|SF3B6_HUMAN
15 Dec 2023 00:53:34,032 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,032 INFO : Inserting sp|Q9Y3C6|PPIL1_HUMAN
15 Dec 2023 00:53:34,055 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:34,055 INFO : Inserting sp|Q9Y3C8|UFC1_HUMAN
15 Dec 2023 00:53:34,078 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,078 INFO : Inserting sp|Q9Y3F4|STRAP_HUMAN
15 Dec 2023 00:53:34,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,106 INFO : Inserting sp|Q9Y3I0|RTCB_HUMAN
15 Dec 2023 00:53:34,133 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,133 INFO : Inserting sp|Q9Y3L5|RAP2C_HUMAN
15 Dec 2023 00:53:34,151 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:34,152 INFO : Inserting sp|Q9Y3Z3|SAMH1_HUMAN
15 Dec 2023 00:53:34,179 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:34,179 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 00:53:35,246 DEBUG: Inserted 50 peptides
15 Dec 2023 00:53:35,450 DEBUG: Total peptides inserted: 61
15 Dec 2023 00:53:35,450 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 00:53:35,795 DEBUG: Total peptides inserted: 20
15 Dec 2023 00:53:35,795 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 00:53:35,964 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:35,964 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 00:53:36,099 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:36,099 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 00:53:36,269 INFO : 94% Done
15 Dec 2023 00:53:36,328 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:36,328 INFO : Inserting sp|Q9Y4Z0|LSM4_HUMAN
15 Dec 2023 00:53:36,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,340 INFO : Inserting sp|Q9Y5B9|SP16H_HUMAN
15 Dec 2023 00:53:36,351 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,351 INFO : Inserting sp|Q9Y5K8|VATD_HUMAN
15 Dec 2023 00:53:36,371 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:36,371 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 00:53:36,447 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:36,448 INFO : Inserting sp|Q9Y5Z4|HEBP2_HUMAN
15 Dec 2023 00:53:36,511 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:36,511 INFO : Inserting sp|Q9Y606|PUS1_HUMAN
15 Dec 2023 00:53:36,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,523 INFO : Inserting sp|Q9Y608|LRRF2_HUMAN
15 Dec 2023 00:53:36,545 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:36,545 INFO : Inserting sp|Q9Y617|SERC_HUMAN
15 Dec 2023 00:53:36,651 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:36,651 INFO : Inserting sp|Q9Y625|GPC6_HUMAN
15 Dec 2023 00:53:36,678 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,678 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 00:53:36,769 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:36,769 INFO : Inserting sp|Q9Y678|COPG1_HUMAN
15 Dec 2023 00:53:36,797 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,797 INFO : Inserting sp|Q9Y696|CLIC4_HUMAN
15 Dec 2023 00:53:36,860 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:36,860 INFO : Inserting sp|Q9Y6K9|NEMO_HUMAN
15 Dec 2023 00:53:36,919 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,919 INFO : Inserting sp|Q9Y6N5|SQOR_HUMAN
15 Dec 2023 00:53:36,974 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:36,974 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 00:53:36,988 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:36,988 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 00:53:38,127 DEBUG: Inserted 50 peptides
15 Dec 2023 00:53:39,121 INFO : 95% Done
15 Dec 2023 00:53:39,416 DEBUG: Inserted 100 peptides
15 Dec 2023 00:53:39,856 DEBUG: Total peptides inserted: 121
15 Dec 2023 00:53:39,856 INFO : Inserting sp|Q9Y6W5|WASF2_HUMAN
15 Dec 2023 00:53:39,918 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:39,918 INFO : Inserting sp|Q9Y6X5|ENPP4_HUMAN
15 Dec 2023 00:53:39,945 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:39,946 INFO : Inserting sp|Q9Y6Z7|COL10_HUMAN
15 Dec 2023 00:53:39,964 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:39,964 INFO : Inserting sp|A0A0A0MS14|HV145_HUMAN
15 Dec 2023 00:53:39,976 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:39,976 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 00:53:39,994 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:39,994 INFO : Inserting sp|A0A0B4J1V0|HV315_HUMAN
15 Dec 2023 00:53:40,062 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:40,063 INFO : Inserting sp|A0A0B4J1V6|HV373_HUMAN
15 Dec 2023 00:53:40,092 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:40,092 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 00:53:40,208 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:40,208 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 00:53:40,276 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:40,276 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 00:53:40,341 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:40,341 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 00:53:40,371 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:40,371 INFO : Inserting sp|A0A0C4DH29|HV103_HUMAN
15 Dec 2023 00:53:40,416 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:40,416 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 00:53:40,449 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:40,449 INFO : Inserting sp|A0A0C4DH32|HV320_HUMAN
15 Dec 2023 00:53:40,517 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:40,517 INFO : Inserting sp|A0A0C4DH34|HV428_HUMAN
15 Dec 2023 00:53:40,543 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:40,543 INFO : Inserting sp|A0A0C4DH35|HV335_HUMAN
15 Dec 2023 00:53:40,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:40,554 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 00:53:40,587 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:40,587 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 00:53:40,617 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:40,617 INFO : Inserting sp|A0A0J9YXX1|HV5X1_HUMAN
15 Dec 2023 00:53:40,661 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:40,661 INFO : Inserting sp|A0A8I5KQE6|RPSA2_HUMAN
15 Dec 2023 00:53:40,760 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:40,761 INFO : Inserting sp|A5A3E0|POTEF_HUMAN
15 Dec 2023 00:53:40,888 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:40,888 INFO : Inserting sp|A8MUK1|U17L5_HUMAN
15 Dec 2023 00:53:40,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:40,916 INFO : Inserting sp|B2RXH8|HNRC2_HUMAN
15 Dec 2023 00:53:40,986 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:40,986 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 00:53:41,136 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:41,136 INFO : Inserting sp|E9PAV3|NACAM_HUMAN
15 Dec 2023 00:53:41,172 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:41,172 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 00:53:41,300 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:41,300 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 00:53:41,387 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:41,387 INFO : Inserting sp|O75711|SCRG1_HUMAN
15 Dec 2023 00:53:41,443 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:41,443 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 00:53:41,474 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:41,474 INFO : Inserting sp|O94903|PLPHP_HUMAN
15 Dec 2023 00:53:41,513 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:41,513 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 00:53:41,683 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:41,683 INFO : Inserting sp|O95965|ITGBL_HUMAN
15 Dec 2023 00:53:41,734 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:41,734 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 00:53:41,752 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:41,752 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 00:53:41,800 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:41,800 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 00:53:41,842 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:41,842 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 00:53:41,870 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:41,870 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 00:53:41,896 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:41,896 INFO : Inserting sp|P0DOX3|IGD_HUMAN
15 Dec 2023 00:53:41,992 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:41,992 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 00:53:42,216 INFO : 96% Done
15 Dec 2023 00:53:42,313 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:42,313 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 00:53:42,397 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:42,397 INFO : Inserting sp|P0DP04|HV43D_HUMAN
15 Dec 2023 00:53:42,476 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:42,476 INFO : Inserting sp|P0DP08|HVD82_HUMAN
15 Dec 2023 00:53:42,552 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:42,552 INFO : Inserting sp|P19961|AMY2B_HUMAN
15 Dec 2023 00:53:42,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:42,566 INFO : Inserting sp|P22676|CALB2_HUMAN
15 Dec 2023 00:53:42,599 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:42,599 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 00:53:42,682 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:42,682 INFO : Inserting sp|P59768|GBG2_HUMAN
15 Dec 2023 00:53:42,734 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:42,735 INFO : Inserting sp|P60983|GMFB_HUMAN
15 Dec 2023 00:53:42,847 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:42,847 INFO : Inserting sp|P80748|LV321_HUMAN
15 Dec 2023 00:53:42,872 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:42,872 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 00:53:43,082 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:43,082 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 00:53:43,171 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:43,172 INFO : Inserting sp|Q14568|HS902_HUMAN
15 Dec 2023 00:53:43,271 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:43,271 INFO : Inserting sp|Q15404|RSU1_HUMAN
15 Dec 2023 00:53:43,293 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,293 INFO : Inserting sp|Q2M2H8|MGAL_HUMAN
15 Dec 2023 00:53:43,322 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:43,322 INFO : Imported 2000 peptide groups.
15 Dec 2023 00:53:43,322 INFO : Inserting sp|Q53T59|H1BP3_HUMAN
15 Dec 2023 00:53:43,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,363 INFO : Inserting sp|Q562R1|ACTBL_HUMAN
15 Dec 2023 00:53:43,578 DEBUG: Total peptides inserted: 13
15 Dec 2023 00:53:43,578 INFO : Inserting sp|Q58FF8|H90B2_HUMAN
15 Dec 2023 00:53:43,694 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:43,694 INFO : Inserting sp|Q58FG1|HS904_HUMAN
15 Dec 2023 00:53:43,751 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:43,751 INFO : Inserting sp|Q5GAN6|RNS10_HUMAN
15 Dec 2023 00:53:43,767 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,767 INFO : Inserting sp|Q5JXA9|SIRB2_HUMAN
15 Dec 2023 00:53:43,780 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,780 INFO : Inserting sp|Q5T013|HYI_HUMAN
15 Dec 2023 00:53:43,804 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,804 INFO : Inserting sp|Q5TBC7|B2L15_HUMAN
15 Dec 2023 00:53:43,823 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:43,823 INFO : Inserting sp|Q5TEC6|H37_HUMAN
15 Dec 2023 00:53:43,918 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:43,918 INFO : Inserting sp|Q5VTE0|EF1A3_HUMAN
15 Dec 2023 00:53:44,097 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:44,097 INFO : Inserting sp|Q5VU97|CAHD1_HUMAN
15 Dec 2023 00:53:44,134 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:44,134 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 00:53:44,158 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,158 INFO : Inserting sp|Q641Q3|METRL_HUMAN
15 Dec 2023 00:53:44,217 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,217 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 00:53:44,309 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:44,309 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 00:53:44,388 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:44,389 INFO : Inserting sp|Q6ZMR3|LDH6A_HUMAN
15 Dec 2023 00:53:44,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:44,433 INFO : Inserting sp|Q7Z4H3|HDDC2_HUMAN
15 Dec 2023 00:53:44,459 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,460 INFO : Inserting sp|Q86VR7|VS10L_HUMAN
15 Dec 2023 00:53:44,472 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,472 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 00:53:44,545 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:44,545 INFO : Inserting sp|Q8N1G4|LRC47_HUMAN
15 Dec 2023 00:53:44,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,568 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 00:53:44,683 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:44,683 INFO : Inserting sp|Q8N7B1|HORM2_HUMAN
15 Dec 2023 00:53:44,697 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:44,697 INFO : Inserting sp|Q8N8A2|ANR44_HUMAN
15 Dec 2023 00:53:44,761 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:44,761 INFO : Inserting sp|Q8N8K9|K1958_HUMAN
15 Dec 2023 00:53:44,799 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:44,799 INFO : Inserting sp|Q8NBX0|SCPDL_HUMAN
15 Dec 2023 00:53:44,873 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:44,873 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 00:53:45,006 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:45,006 INFO : Inserting sp|Q96CX2|KCD12_HUMAN
15 Dec 2023 00:53:45,247 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:45,247 INFO : Inserting sp|Q96S96|PEBP4_HUMAN
15 Dec 2023 00:53:45,299 INFO : 97% Done
15 Dec 2023 00:53:45,366 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:45,366 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 00:53:45,430 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:45,430 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 00:53:45,480 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:45,480 INFO : Inserting sp|Q9H1U4|MEGF9_HUMAN
15 Dec 2023 00:53:45,504 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:45,504 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 00:53:45,634 DEBUG: Total peptides inserted: 10
15 Dec 2023 00:53:45,634 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 00:53:45,871 DEBUG: Total peptides inserted: 12
15 Dec 2023 00:53:45,871 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 00:53:46,003 DEBUG: Total peptides inserted: 8
15 Dec 2023 00:53:46,003 INFO : Inserting sp|Q9HC56|PCDH9_HUMAN
15 Dec 2023 00:53:46,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,013 INFO : Inserting sp|Q9HCN8|SDF2L_HUMAN
15 Dec 2023 00:53:46,034 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,034 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 00:53:46,175 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:46,175 INFO : Inserting sp|Q9NRV9|HEBP1_HUMAN
15 Dec 2023 00:53:46,235 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:46,235 INFO : Inserting sp|Q9NS98|SEM3G_HUMAN
15 Dec 2023 00:53:46,258 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,258 INFO : Inserting sp|Q9NWV4|CZIB_HUMAN
15 Dec 2023 00:53:46,330 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:46,330 INFO : Inserting sp|Q9NYL9|TMOD3_HUMAN
15 Dec 2023 00:53:46,431 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:46,431 INFO : Inserting sp|Q9P1U1|ARP3B_HUMAN
15 Dec 2023 00:53:46,491 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:46,491 INFO : Inserting sp|A0A075B6H7|KV37_HUMAN
15 Dec 2023 00:53:46,536 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,536 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 00:53:46,564 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,564 INFO : Inserting sp|A0A075B6I9|LV746_HUMAN
15 Dec 2023 00:53:46,605 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:46,605 INFO : Inserting sp|A0A075B6K4|LV310_HUMAN
15 Dec 2023 00:53:46,644 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:46,644 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 00:53:46,667 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,667 INFO : Inserting sp|A0A075B6R9|KVD24_HUMAN
15 Dec 2023 00:53:46,684 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,684 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 00:53:46,723 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:46,723 INFO : Inserting sp|A0A0A0MRZ8|KVD11_HUMAN
15 Dec 2023 00:53:46,743 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,743 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 00:53:46,778 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,778 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 00:53:46,788 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,788 INFO : Inserting sp|A0A0C4DH68|KV224_HUMAN
15 Dec 2023 00:53:46,804 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,804 INFO : Inserting sp|A0A0C4DH72|KV106_HUMAN
15 Dec 2023 00:53:46,818 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,818 INFO : Inserting sp|A0A1B0GUS4|UB2L5_HUMAN
15 Dec 2023 00:53:46,833 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,833 INFO : Inserting sp|A2A3N6|PIPSL_HUMAN
15 Dec 2023 00:53:46,845 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:46,845 INFO : Inserting sp|A2NJV5|KV229_HUMAN
15 Dec 2023 00:53:46,908 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:46,908 INFO : Inserting sp|A2RUR9|C144A_HUMAN
15 Dec 2023 00:53:46,941 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,941 INFO : Inserting sp|A8MWD9|RUXGL_HUMAN
15 Dec 2023 00:53:46,984 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:46,984 INFO : Inserting sp|B5ME19|EIFCL_HUMAN
15 Dec 2023 00:53:47,029 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:47,029 INFO : Inserting sp|C9J2P7|U17LF_HUMAN
15 Dec 2023 00:53:47,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,056 INFO : Inserting sp|C9JLJ4|U17LD_HUMAN
15 Dec 2023 00:53:47,083 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,083 INFO : Inserting sp|C9JPN9|UL17C_HUMAN
15 Dec 2023 00:53:47,109 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,110 INFO : Inserting sp|C9JVI0|U17LB_HUMAN
15 Dec 2023 00:53:47,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,136 INFO : Inserting sp|D6R901|U17LL_HUMAN
15 Dec 2023 00:53:47,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,162 INFO : Inserting sp|D6R9N7|U17LI_HUMAN
15 Dec 2023 00:53:47,189 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,189 INFO : Inserting sp|D6RA61|U17LM_HUMAN
15 Dec 2023 00:53:47,215 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,215 INFO : Inserting sp|D6RBQ6|U17LH_HUMAN
15 Dec 2023 00:53:47,241 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,241 INFO : Inserting sp|D6RCP7|U17LJ_HUMAN
15 Dec 2023 00:53:47,268 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,268 INFO : Inserting sp|D6RJB6|U17LK_HUMAN
15 Dec 2023 00:53:47,294 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:47,294 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 00:53:47,497 DEBUG: Total peptides inserted: 9
15 Dec 2023 00:53:47,497 INFO : Inserting sp|O60739|EIF1B_HUMAN
15 Dec 2023 00:53:47,541 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:47,541 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 00:53:47,776 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:47,776 INFO : Inserting sp|P0CG39|POTEJ_HUMAN
15 Dec 2023 00:53:47,887 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:47,887 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 00:53:47,991 DEBUG: Total peptides inserted: 7
15 Dec 2023 00:53:47,992 INFO : Inserting sp|P0DOX7|IGK_HUMAN
15 Dec 2023 00:53:48,147 DEBUG: Total peptides inserted: 6
15 Dec 2023 00:53:48,147 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 00:53:48,179 INFO : 98% Done
15 Dec 2023 00:53:48,267 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:48,267 INFO : Inserting sp|Q15181|IPYR_HUMAN
15 Dec 2023 00:53:48,345 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:48,345 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 00:53:48,489 DEBUG: Total peptides inserted: 5
15 Dec 2023 00:53:48,489 INFO : Inserting sp|Q58FF6|H90B4_HUMAN
15 Dec 2023 00:53:48,544 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:48,544 INFO : Inserting sp|Q5HY98|ZN766_HUMAN
15 Dec 2023 00:53:48,560 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,560 INFO : Inserting sp|Q5JS37|NHLC3_HUMAN
15 Dec 2023 00:53:48,583 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,584 INFO : Inserting sp|Q6TFL3|CC171_HUMAN
15 Dec 2023 00:53:48,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,601 INFO : Inserting sp|Q6UWF7|NXPE4_HUMAN
15 Dec 2023 00:53:48,612 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,612 INFO : Inserting sp|Q7Z5L0|VMO1_HUMAN
15 Dec 2023 00:53:48,632 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,632 INFO : Inserting sp|Q8IZP2|ST134_HUMAN
15 Dec 2023 00:53:48,672 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:48,673 INFO : Inserting sp|Q8N7Z5|ANR31_HUMAN
15 Dec 2023 00:53:48,691 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,692 INFO : Inserting sp|Q8NHW5|RLA0L_HUMAN
15 Dec 2023 00:53:48,756 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:48,756 INFO : Inserting sp|Q8WZA0|LZIC_HUMAN
15 Dec 2023 00:53:48,795 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:48,795 INFO : Inserting sp|Q96R05|RET7_HUMAN
15 Dec 2023 00:53:48,814 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,814 INFO : Inserting sp|Q9H3W5|LRRN3_HUMAN
15 Dec 2023 00:53:48,833 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,833 INFO : Inserting sp|Q9H6N6|MYH16_HUMAN
15 Dec 2023 00:53:48,871 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:48,871 INFO : Inserting sp|Q9H7R5|ZN665_HUMAN
15 Dec 2023 00:53:48,889 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,890 INFO : Inserting sp|Q9H8J5|MANS1_HUMAN
15 Dec 2023 00:53:48,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:48,916 INFO : Inserting sp|Q9H9S4|CB39L_HUMAN
15 Dec 2023 00:53:48,967 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:48,967 INFO : Inserting sp|Q9NPD7|NRN1_HUMAN
15 Dec 2023 00:53:49,030 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:49,031 INFO : Inserting sp|Q9P1Z9|CC180_HUMAN
15 Dec 2023 00:53:49,060 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:49,060 INFO : Inserting sp|Q9UFN0|NPS3A_HUMAN
15 Dec 2023 00:53:49,079 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,079 INFO : Inserting sp|Q9UI15|TAGL3_HUMAN
15 Dec 2023 00:53:49,108 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:49,108 INFO : Inserting sp|A0A0J9YWL9|TX13C_HUMAN
15 Dec 2023 00:53:49,128 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,128 INFO : Imported 2100 peptide groups.
15 Dec 2023 00:53:49,128 INFO : Inserting sp|A4D1F6|LRRD1_HUMAN
15 Dec 2023 00:53:49,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,162 INFO : Inserting sp|A6NGN9|IGLO5_HUMAN
15 Dec 2023 00:53:49,212 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:49,212 INFO : Inserting sp|A6NHG4|DDTL_HUMAN
15 Dec 2023 00:53:49,254 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,254 INFO : Inserting sp|A6NLU5|VTM2B_HUMAN
15 Dec 2023 00:53:49,344 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:49,345 INFO : Inserting sp|B7ZW38|HNRC3_HUMAN
15 Dec 2023 00:53:49,418 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:49,418 INFO : Inserting sp|P0DMR1|HNRC4_HUMAN
15 Dec 2023 00:53:49,497 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:49,497 INFO : Inserting sp|Q5BLP8|CD048_HUMAN
15 Dec 2023 00:53:49,539 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:49,539 INFO : Inserting sp|Q67FW5|B3GNL_HUMAN
15 Dec 2023 00:53:49,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,572 INFO : Inserting sp|Q6GMV3|PTRD1_HUMAN
15 Dec 2023 00:53:49,597 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,597 INFO : Inserting sp|Q86U17|SPA11_HUMAN
15 Dec 2023 00:53:49,613 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,613 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 00:53:49,700 DEBUG: Total peptides inserted: 4
15 Dec 2023 00:53:49,701 INFO : Inserting sp|Q8NEE8|TTC16_HUMAN
15 Dec 2023 00:53:49,723 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,723 INFO : Inserting sp|Q9BPW8|NIPS1_HUMAN
15 Dec 2023 00:53:49,751 DEBUG: Total peptides inserted: 2
15 Dec 2023 00:53:49,751 INFO : Inserting sp|Q9H0Q0|CYRIA_HUMAN
15 Dec 2023 00:53:49,798 DEBUG: Total peptides inserted: 3
15 Dec 2023 00:53:49,798 INFO : Inserting sp|A6NGY3|CE052_HUMAN
15 Dec 2023 00:53:49,814 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,814 INFO : Inserting sp|Q5TEZ5|CF163_HUMAN
15 Dec 2023 00:53:49,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 00:53:49,825 INFO : None of the 1598017 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 00:57:10,124 INFO : Updated 528780 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 00:57:10,125 INFO : Done parsing Skyline document.
15 Dec 2023 00:57:10,156 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 00:57:15,811 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 00:57:39,523 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 00:57:46,725 INFO : Cleaning up temp tables
15 Dec 2023 00:57:47,091 INFO : Completed import of Skyline document from SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 00:57:47,094 INFO : 100% Done
15 Dec 2023 00:57:47,114 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179048/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip into the system
15 Dec 2023 00:57:47,116 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179051/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd into the system
15 Dec 2023 00:57:47,116 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179051/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd into the system
15 Dec 2023 00:57:47,117 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179051/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip into the system
15 Dec 2023 00:57:47,118 INFO : Starting import from SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 00:57:47,120 INFO : Starting to import Skyline document from SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 00:57:47,217 INFO : Expanding human.protdb
15 Dec 2023 00:57:50,120 INFO : Expanding CSF_P017_F3.imsdb
15 Dec 2023 00:57:50,140 INFO : Expanding SILK_P017_CSF_F3_a.blib
15 Dec 2023 00:57:50,810 INFO : Expanding SILK_P017_CSF_F3_a.redundant.blib
15 Dec 2023 00:57:54,542 INFO : Expanding SILK_P017_CSF_F3_a.skyd
15 Dec 2023 00:58:20,041 INFO : Expanding SILK_P017_CSF_F3_a.sky.view
15 Dec 2023 00:58:20,042 INFO : Expanding SILK_P017_CSF_F3_a.sky
15 Dec 2023 00:58:23,712 INFO : Expanding SILK_P017_CSF_F3_a.skyl
15 Dec 2023 01:00:16,154 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:00:17,512 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:00:18,422 INFO : Inserting sp|A0AVT1|UBA6_HUMAN
15 Dec 2023 01:00:18,431 WARN : 'SILK_P017_CSF_F3b' library was not found in settings.
15 Dec 2023 01:00:18,591 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:18,591 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 01:00:18,935 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:18,935 INFO : Inserting sp|A6NDG6|PGP_HUMAN
15 Dec 2023 01:00:19,177 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:19,177 INFO : Inserting sp|A6NHR9|SMHD1_HUMAN
15 Dec 2023 01:00:19,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:19,264 INFO : Inserting sp|B0I1T2|MYO1G_HUMAN
15 Dec 2023 01:00:19,305 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:19,305 INFO : Inserting sp|O00115|DNS2A_HUMAN
15 Dec 2023 01:00:19,394 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:19,394 INFO : Inserting sp|O00148|DX39A_HUMAN
15 Dec 2023 01:00:19,701 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:19,701 INFO : Inserting sp|O00160|MYO1F_HUMAN
15 Dec 2023 01:00:20,150 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:00:20,150 INFO : Inserting sp|O00182|LEG9_HUMAN
15 Dec 2023 01:00:20,235 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:20,235 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 01:00:20,277 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:20,277 INFO : Inserting sp|O00231|PSD11_HUMAN
15 Dec 2023 01:00:20,484 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:20,484 INFO : Inserting sp|O00232|PSD12_HUMAN
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.3_F3_S1-A6_1_3065.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.3_F3_S1-A11_1_2820.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.9_F3_S1-B11_1_2828.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.15_F3_S1-C11_1_2836.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.22_F3_S1-D11_1_2845.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.28_F3_S1-E11_1_2853.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.35_F3_S1-F11_1_2861.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.41_F3_S1-G11_1_2872.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6653.47_F3_S1-H11_1_2880.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6666.3_F3_S1-A12_1_2888.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6666.7_F3_S1-B12_1_2896.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6666.11_F3_S1-C12_1_2904.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6666.17_F3_S1-D12_1_2912.d
15 Dec 2023 01:00:20,582 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F3\CSF_6666.24_F3_S1-E12_1_2920.d
15 Dec 2023 01:00:20,686 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:20,686 INFO : Inserting sp|O00233|PSMD9_HUMAN
15 Dec 2023 01:00:20,773 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:20,773 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:00:21,518 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:00:21,518 INFO : Inserting sp|O00303|EIF3F_HUMAN
15 Dec 2023 01:00:21,579 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:21,579 INFO : Inserting sp|O00339|MATN2_HUMAN
15 Dec 2023 01:00:21,666 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:21,666 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:00:21,944 INFO : 1% Done
15 Dec 2023 01:00:22,424 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:00:22,424 INFO : Inserting sp|O00410|IPO5_HUMAN
15 Dec 2023 01:00:22,557 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:22,557 INFO : Inserting sp|O00442|RTCA_HUMAN
15 Dec 2023 01:00:22,629 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:22,629 INFO : Inserting sp|O00451|GFRA2_HUMAN
15 Dec 2023 01:00:22,666 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:22,666 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 01:00:23,227 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:00:23,227 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:00:24,333 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:00:24,334 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:00:25,564 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:00:25,564 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:00:25,872 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:25,872 INFO : Inserting sp|O00584|RNT2_HUMAN
15 Dec 2023 01:00:26,465 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:00:26,465 INFO : Inserting sp|O00629|IMA3_HUMAN
15 Dec 2023 01:00:26,558 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:26,558 INFO : Inserting sp|O00743|PPP6_HUMAN
15 Dec 2023 01:00:26,624 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:26,624 INFO : Inserting sp|O00754|MA2B1_HUMAN
15 Dec 2023 01:00:27,160 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:00:27,160 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:00:27,496 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:27,496 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 01:00:27,646 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:27,646 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 01:00:27,744 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:27,744 INFO : Inserting sp|O14727|APAF_HUMAN
15 Dec 2023 01:00:28,047 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:28,047 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 01:00:28,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:28,080 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:00:28,536 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:28,536 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 01:00:28,585 INFO : 2% Done
15 Dec 2023 01:00:28,927 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:00:28,927 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 01:00:29,085 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:29,085 INFO : Inserting sp|O14793|GDF8_HUMAN
15 Dec 2023 01:00:29,137 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:29,137 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 01:00:29,390 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:29,390 INFO : Inserting sp|O14933|UB2L6_HUMAN
15 Dec 2023 01:00:29,506 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:29,506 INFO : Inserting sp|O14949|QCR8_HUMAN
15 Dec 2023 01:00:29,547 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:29,547 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 01:00:29,764 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:29,764 INFO : Inserting sp|O14979|HNRDL_HUMAN
15 Dec 2023 01:00:29,807 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:29,807 INFO : Inserting sp|O14980|XPO1_HUMAN
15 Dec 2023 01:00:30,020 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:30,020 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 01:00:30,563 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:00:30,563 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 01:00:30,828 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:30,828 INFO : Inserting sp|O15116|LSM1_HUMAN
15 Dec 2023 01:00:30,973 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:30,974 INFO : Inserting sp|O15117|FYB1_HUMAN
15 Dec 2023 01:00:31,035 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:31,036 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 01:00:31,592 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:00:31,592 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:00:32,577 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:00:32,577 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:00:32,740 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:32,740 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 01:00:32,967 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:32,967 INFO : Inserting sp|O15240|VGF_HUMAN
15 Dec 2023 01:00:33,168 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:33,168 INFO : Inserting sp|O15354|GPR37_HUMAN
15 Dec 2023 01:00:33,206 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:33,206 INFO : Inserting sp|O15372|EIF3H_HUMAN
15 Dec 2023 01:00:33,282 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:33,282 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:00:33,679 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:00:33,679 INFO : Inserting sp|O15400|STX7_HUMAN
15 Dec 2023 01:00:33,735 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:33,735 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 01:00:33,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:33,828 INFO : Inserting sp|O43143|DHX15_HUMAN
15 Dec 2023 01:00:34,138 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:34,139 INFO : Inserting sp|O43157|PLXB1_HUMAN
15 Dec 2023 01:00:34,233 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:34,233 INFO : Inserting sp|O43242|PSMD3_HUMAN
15 Dec 2023 01:00:34,404 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:34,404 INFO : Inserting sp|O43286|B4GT5_HUMAN
15 Dec 2023 01:00:34,448 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:34,448 INFO : Inserting sp|O43390|HNRPR_HUMAN
15 Dec 2023 01:00:34,537 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:34,537 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 01:00:34,606 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:34,606 INFO : Inserting sp|O43405|COCH_HUMAN
15 Dec 2023 01:00:34,697 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:34,697 INFO : Inserting sp|O43447|PPIH_HUMAN
15 Dec 2023 01:00:34,762 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:34,762 INFO : Inserting sp|O43451|MGA_HUMAN
15 Dec 2023 01:00:35,236 INFO : 3% Done
15 Dec 2023 01:00:35,438 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:00:35,438 INFO : Inserting sp|O43491|E41L2_HUMAN
15 Dec 2023 01:00:35,516 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:35,516 INFO : Inserting sp|O43504|LTOR5_HUMAN
15 Dec 2023 01:00:35,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:35,626 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:00:36,396 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:00:36,396 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 01:00:36,582 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:36,582 INFO : Inserting sp|O43581|SYT7_HUMAN
15 Dec 2023 01:00:36,668 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:36,668 INFO : Inserting sp|O43592|XPOT_HUMAN
15 Dec 2023 01:00:36,718 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:36,718 INFO : Inserting sp|O43684|BUB3_HUMAN
15 Dec 2023 01:00:36,829 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:36,829 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:00:38,223 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:00:38,223 INFO : Inserting sp|O43776|SYNC_HUMAN
15 Dec 2023 01:00:38,369 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:38,369 INFO : Inserting sp|O43815|STRN_HUMAN
15 Dec 2023 01:00:38,582 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:38,582 INFO : Inserting sp|O43827|ANGL7_HUMAN
15 Dec 2023 01:00:38,666 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:38,666 INFO : Inserting sp|O43847|NRDC_HUMAN
15 Dec 2023 01:00:38,768 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:38,768 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 01:00:39,026 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:39,027 INFO : Inserting sp|O60231|DHX16_HUMAN
15 Dec 2023 01:00:39,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:39,081 INFO : Inserting sp|O60241|AGRB2_HUMAN
15 Dec 2023 01:00:39,157 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:39,157 INFO : Inserting sp|O60256|KPRB_HUMAN
15 Dec 2023 01:00:39,244 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:39,244 INFO : Inserting sp|O60346|PHLP1_HUMAN
15 Dec 2023 01:00:39,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:39,332 INFO : Inserting sp|O60449|LY75_HUMAN
15 Dec 2023 01:00:39,514 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:39,514 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 01:00:39,668 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:39,668 INFO : Inserting sp|O60488|ACSL4_HUMAN
15 Dec 2023 01:00:39,697 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:39,697 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 01:00:39,876 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:39,876 INFO : Inserting sp|O60551|NMT2_HUMAN
15 Dec 2023 01:00:39,979 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:39,979 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:00:40,354 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:40,354 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:00:40,774 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:40,774 INFO : Inserting sp|O60763|USO1_HUMAN
15 Dec 2023 01:00:40,880 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:40,880 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:00:41,366 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:00:41,366 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 01:00:41,465 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:41,465 INFO : Inserting sp|O60928|KCJ13_HUMAN
15 Dec 2023 01:00:41,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:41,523 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:00:41,762 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:41,762 INFO : Inserting sp|O75019|LIRA1_HUMAN
15 Dec 2023 01:00:41,819 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:41,819 INFO : Inserting sp|O75078|ADA11_HUMAN
15 Dec 2023 01:00:41,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:41,888 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:00:42,005 INFO : 4% Done
15 Dec 2023 01:00:43,038 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:00:43,038 INFO : Inserting sp|O75116|ROCK2_HUMAN
15 Dec 2023 01:00:43,202 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:43,202 INFO : Inserting sp|O75131|CPNE3_HUMAN
15 Dec 2023 01:00:43,431 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:43,431 INFO : Imported 100 peptide groups.
15 Dec 2023 01:00:43,431 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 01:00:43,689 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:43,689 INFO : Inserting sp|O75165|DJC13_HUMAN
15 Dec 2023 01:00:43,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:43,795 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 01:00:43,813 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:43,813 INFO : Inserting sp|O75323|NIPS2_HUMAN
15 Dec 2023 01:00:43,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:43,898 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 01:00:44,273 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:00:44,273 INFO : Inserting sp|O75340|PDCD6_HUMAN
15 Dec 2023 01:00:44,306 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:44,306 INFO : Inserting sp|O75348|VATG1_HUMAN
15 Dec 2023 01:00:44,344 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:44,344 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 01:00:44,854 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:00:44,854 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 01:00:45,160 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:45,160 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:00:45,334 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:45,334 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:00:45,635 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:45,635 INFO : Inserting sp|O75396|SC22B_HUMAN
15 Dec 2023 01:00:45,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:45,655 INFO : Inserting sp|O75436|VP26A_HUMAN
15 Dec 2023 01:00:45,818 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:45,818 INFO : Inserting sp|O75503|CLN5_HUMAN
15 Dec 2023 01:00:45,859 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:45,859 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 01:00:45,986 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:45,986 INFO : Inserting sp|O75534|CSDE1_HUMAN
15 Dec 2023 01:00:46,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:46,057 INFO : Inserting sp|O75563|SKAP2_HUMAN
15 Dec 2023 01:00:46,294 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:46,294 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:00:46,642 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:46,642 INFO : Inserting sp|O75608|LYPA1_HUMAN
15 Dec 2023 01:00:46,755 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:46,755 INFO : Inserting sp|O75629|CREG1_HUMAN
15 Dec 2023 01:00:46,814 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:46,814 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:00:47,406 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:00:47,407 INFO : Inserting sp|O75643|U520_HUMAN
15 Dec 2023 01:00:47,578 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:47,578 INFO : Inserting sp|O75695|XRP2_HUMAN
15 Dec 2023 01:00:47,684 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:47,684 INFO : Inserting sp|O75752|B3GL1_HUMAN
15 Dec 2023 01:00:47,742 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:47,742 INFO : Inserting sp|O75787|RENR_HUMAN
15 Dec 2023 01:00:47,879 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:47,879 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 01:00:48,328 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:00:48,328 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:00:48,639 INFO : 5% Done
15 Dec 2023 01:00:49,166 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:00:49,166 INFO : Inserting sp|O75884|RBBP9_HUMAN
15 Dec 2023 01:00:49,184 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:49,184 INFO : Inserting sp|O75888|TNF13_HUMAN
15 Dec 2023 01:00:49,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:49,288 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 01:00:49,920 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:00:49,920 INFO : Inserting sp|O75995|SASH3_HUMAN
15 Dec 2023 01:00:50,050 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:50,050 INFO : Inserting sp|O76061|STC2_HUMAN
15 Dec 2023 01:00:50,283 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:50,283 INFO : Inserting sp|O76071|CIAO1_HUMAN
15 Dec 2023 01:00:50,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:50,355 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 01:00:50,521 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:50,522 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:00:50,833 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:50,833 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 01:00:50,905 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:50,906 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 01:00:51,398 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:00:51,399 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 01:00:51,671 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:51,671 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 01:00:52,021 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:52,021 INFO : Inserting sp|O94973|AP2A2_HUMAN
15 Dec 2023 01:00:52,350 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:52,350 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:00:53,361 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:00:53,361 INFO : Inserting sp|O95202|LETM1_HUMAN
15 Dec 2023 01:00:53,402 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:53,402 INFO : Inserting sp|O95210|STBD1_HUMAN
15 Dec 2023 01:00:53,437 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:53,438 INFO : Inserting sp|O95319|CELF2_HUMAN
15 Dec 2023 01:00:53,467 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:53,467 INFO : Inserting sp|O95352|ATG7_HUMAN
15 Dec 2023 01:00:53,778 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:53,778 INFO : Inserting sp|O95428|PPN_HUMAN
15 Dec 2023 01:00:53,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:53,833 INFO : Inserting sp|O95433|AHSA1_HUMAN
15 Dec 2023 01:00:53,932 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:53,932 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 01:00:54,428 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:00:54,428 INFO : Inserting sp|O95466|FMNL1_HUMAN
15 Dec 2023 01:00:54,722 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:00:54,723 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 01:00:54,844 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:54,844 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:00:55,156 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:55,157 INFO : Inserting sp|O95498|VNN2_HUMAN
15 Dec 2023 01:00:55,301 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:00:55,301 INFO : Inserting sp|O95544|NADK_HUMAN
15 Dec 2023 01:00:55,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:55,340 INFO : Inserting sp|O95711|LY86_HUMAN
15 Dec 2023 01:00:55,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:55,435 INFO : Inserting sp|O95782|AP2A1_HUMAN
15 Dec 2023 01:00:55,674 INFO : 6% Done
15 Dec 2023 01:00:55,884 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:00:55,884 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:00:55,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:55,930 INFO : Inserting sp|O95831|AIFM1_HUMAN
15 Dec 2023 01:00:56,030 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:56,030 INFO : Inserting sp|O95834|EMAL2_HUMAN
15 Dec 2023 01:00:56,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:56,103 INFO : Inserting sp|O95861|BPNT1_HUMAN
15 Dec 2023 01:00:56,219 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:56,219 INFO : Inserting sp|O95897|NOE2_HUMAN
15 Dec 2023 01:00:56,353 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:56,353 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 01:00:56,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:56,478 INFO : Inserting sp|O95989|NUDT3_HUMAN
15 Dec 2023 01:00:56,537 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:56,537 INFO : Inserting sp|O96000|NDUBA_HUMAN
15 Dec 2023 01:00:56,607 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:00:56,608 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:00:57,468 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:00:57,468 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 01:00:57,662 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:00:57,662 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:00:58,275 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:00:58,275 INFO : Inserting sp|P00403|COX2_HUMAN
15 Dec 2023 01:00:58,357 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:00:58,357 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:00:58,614 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:00:58,614 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:01:00,571 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:01,858 DEBUG: Total peptides inserted: 73
15 Dec 2023 01:01:01,858 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:01:02,069 INFO : 7% Done
15 Dec 2023 01:01:02,129 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:02,129 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:01:02,627 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:01:02,627 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 01:01:02,914 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:01:02,914 INFO : Inserting sp|P00505|AATM_HUMAN
15 Dec 2023 01:01:03,074 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:01:03,074 INFO : Inserting sp|P00533|EGFR_HUMAN
15 Dec 2023 01:01:03,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:03,120 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:01:04,014 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:01:04,014 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 01:01:04,051 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:04,051 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:01:04,962 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:01:04,962 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:01:05,542 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:01:05,542 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 01:01:05,554 INFO : 8% Done
15 Dec 2023 01:01:06,033 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:01:06,033 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 01:01:06,356 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:01:06,356 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 01:01:06,478 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:01:06,478 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:01:06,549 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:01:06,549 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 01:01:06,975 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:01:06,975 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:01:07,856 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:07,900 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:01:07,900 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:01:08,305 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:08,305 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:01:08,507 INFO : 9% Done
15 Dec 2023 01:01:09,432 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:01:09,432 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:01:09,702 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:01:09,702 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 01:01:09,847 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:09,847 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:01:10,799 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:01:10,799 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:01:11,183 INFO : 10% Done
15 Dec 2023 01:01:11,494 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:01:11,494 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:01:12,440 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:01:12,440 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:01:12,896 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:01:12,896 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:01:13,942 INFO : 11% Done
15 Dec 2023 01:01:14,303 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:14,702 DEBUG: Total peptides inserted: 64
15 Dec 2023 01:01:14,702 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:01:16,209 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:16,738 INFO : 12% Done
15 Dec 2023 01:01:17,428 DEBUG: Inserted 100 peptides
15 Dec 2023 01:01:18,617 DEBUG: Inserted 150 peptides
15 Dec 2023 01:01:18,777 DEBUG: Total peptides inserted: 159
15 Dec 2023 01:01:18,777 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:01:19,526 INFO : 13% Done
15 Dec 2023 01:01:20,025 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:20,627 DEBUG: Total peptides inserted: 74
15 Dec 2023 01:01:20,627 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:01:20,873 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:01:20,873 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:01:21,205 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:01:21,205 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 01:01:21,218 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:21,218 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:01:21,752 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:01:21,752 INFO : Inserting sp|P01130|LDLR_HUMAN
15 Dec 2023 01:01:21,799 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:21,799 INFO : Imported 200 peptide groups.
15 Dec 2023 01:01:21,799 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 01:01:21,837 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:21,837 INFO : Inserting sp|P01236|PRL_HUMAN
15 Dec 2023 01:01:21,997 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:21,997 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 01:01:22,062 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:22,062 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 01:01:22,184 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:22,184 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 01:01:22,222 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,222 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 01:01:22,261 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,261 INFO : Inserting sp|P01597|KV139_HUMAN
15 Dec 2023 01:01:22,336 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:22,336 INFO : Inserting sp|P01615|KVD28_HUMAN
15 Dec 2023 01:01:22,357 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,357 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 01:01:22,424 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:22,424 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 01:01:22,511 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:22,511 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 01:01:22,552 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:22,552 INFO : Inserting sp|P01742|HV169_HUMAN
15 Dec 2023 01:01:22,565 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,565 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 01:01:22,571 INFO : 14% Done
15 Dec 2023 01:01:22,578 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,578 INFO : Inserting sp|P01764|HV323_HUMAN
15 Dec 2023 01:01:22,667 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:22,667 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 01:01:22,753 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:22,753 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 01:01:22,835 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:22,835 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 01:01:22,915 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:22,915 INFO : Inserting sp|P01824|HV439_HUMAN
15 Dec 2023 01:01:22,936 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,936 INFO : Inserting sp|P01825|HV459_HUMAN
15 Dec 2023 01:01:22,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:22,956 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:01:23,200 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:01:23,200 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:01:23,652 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:01:23,652 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:01:24,037 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:01:24,037 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:01:24,478 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:01:24,478 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:01:24,807 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:01:24,807 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:01:25,259 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:01:25,259 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:01:25,659 INFO : 15% Done
15 Dec 2023 01:01:25,749 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:01:25,749 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 01:01:25,979 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:25,979 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:01:26,105 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:26,105 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 01:01:26,200 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:26,200 INFO : Inserting sp|P01893|HLAH_HUMAN
15 Dec 2023 01:01:26,223 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:26,223 INFO : Inserting sp|P01903|DRA_HUMAN
15 Dec 2023 01:01:26,273 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:26,273 INFO : Inserting sp|P01909|DQA1_HUMAN
15 Dec 2023 01:01:26,325 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:26,325 INFO : Inserting sp|P01911|DRB1_HUMAN
15 Dec 2023 01:01:26,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:26,402 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:01:26,819 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:01:26,819 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:01:27,121 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:01:27,122 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 01:01:27,324 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:01:27,324 INFO : Inserting sp|P02462|CO4A1_HUMAN
15 Dec 2023 01:01:27,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:27,365 INFO : Inserting sp|P02511|CRYAB_HUMAN
15 Dec 2023 01:01:27,417 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:27,417 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 01:01:27,494 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:27,494 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 01:01:27,514 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:27,514 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:01:28,267 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:01:28,267 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:01:28,893 INFO : 16% Done
15 Dec 2023 01:01:28,975 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:01:28,976 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:01:29,067 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:29,068 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 01:01:29,146 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:29,146 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 01:01:29,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:29,167 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:01:29,834 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:01:29,834 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:01:30,608 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:01:30,608 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:01:31,277 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:01:31,277 INFO : Inserting sp|P02686|MBP_HUMAN
15 Dec 2023 01:01:31,290 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:31,291 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:01:31,409 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:31,409 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 01:01:31,507 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:01:31,507 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:01:31,572 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:31,572 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:01:31,701 INFO : 17% Done
15 Dec 2023 01:01:31,811 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:01:31,811 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:01:32,017 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:32,017 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:01:32,098 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:32,098 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:01:32,400 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:01:32,400 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:01:32,687 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:01:32,687 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:01:33,151 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:01:33,151 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:01:34,154 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:34,635 INFO : 18% Done
15 Dec 2023 01:01:35,380 DEBUG: Total peptides inserted: 95
15 Dec 2023 01:01:35,380 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:01:35,670 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:01:35,670 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:01:35,873 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:35,874 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:01:36,189 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:01:36,189 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:01:36,559 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:01:36,559 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:01:36,970 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:01:36,971 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:01:37,753 INFO : 19% Done
15 Dec 2023 01:01:38,457 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:38,717 DEBUG: Total peptides inserted: 62
15 Dec 2023 01:01:38,717 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:01:39,733 DEBUG: Total peptides inserted: 42
15 Dec 2023 01:01:39,735 INFO : Inserting sp|P02778|CXL10_HUMAN
15 Dec 2023 01:01:39,752 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:39,752 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 01:01:39,921 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:01:39,921 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:01:40,454 INFO : 20% Done
15 Dec 2023 01:01:41,170 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:01:41,170 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:01:42,399 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:01:42,399 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:01:43,295 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:01:43,295 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 01:01:43,510 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:43,510 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 01:01:43,531 INFO : 21% Done
15 Dec 2023 01:01:43,610 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:43,610 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:01:43,820 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:01:43,820 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:01:44,206 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:01:44,207 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:01:44,684 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:01:44,684 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:01:44,963 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:01:44,963 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 01:01:45,432 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:01:45,432 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:01:45,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:45,468 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 01:01:45,657 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:45,657 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:01:46,178 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:01:46,178 INFO : Inserting sp|P04080|CYTB_HUMAN
15 Dec 2023 01:01:46,257 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:46,257 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:01:46,512 INFO : 22% Done
15 Dec 2023 01:01:46,661 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:01:46,662 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:01:48,209 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:49,535 INFO : 23% Done
15 Dec 2023 01:01:49,687 DEBUG: Inserted 100 peptides
15 Dec 2023 01:01:51,044 DEBUG: Inserted 150 peptides
15 Dec 2023 01:01:51,165 DEBUG: Total peptides inserted: 155
15 Dec 2023 01:01:51,165 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 01:01:51,195 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:51,195 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:01:51,314 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:51,314 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:01:51,439 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:51,439 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:01:52,003 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:01:52,003 INFO : Inserting sp|P04216|THY1_HUMAN
15 Dec 2023 01:01:52,159 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:52,160 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:01:52,593 INFO : 24% Done
15 Dec 2023 01:01:52,798 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:01:52,798 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 01:01:53,242 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:01:53,243 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 01:01:53,463 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:01:53,463 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:01:53,605 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:53,605 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:01:54,197 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:01:54,197 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 01:01:54,300 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:54,300 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 01:01:54,369 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:54,369 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 01:01:54,447 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:54,447 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:01:54,630 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:01:54,630 INFO : Inserting sp|P04843|RPN1_HUMAN
15 Dec 2023 01:01:54,662 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:54,663 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 01:01:54,758 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:54,758 INFO : Imported 300 peptide groups.
15 Dec 2023 01:01:54,758 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:01:55,021 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:55,021 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 01:01:55,126 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:55,126 INFO : Inserting sp|P05019|IGF1_HUMAN
15 Dec 2023 01:01:55,140 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:55,140 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 01:01:55,237 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:55,237 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 01:01:55,295 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:55,295 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 01:01:55,435 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:01:55,435 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 01:01:55,606 INFO : 25% Done
15 Dec 2023 01:01:55,833 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:01:55,833 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:01:56,127 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:56,127 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 01:01:56,238 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:01:56,238 INFO : Inserting sp|P05091|ALDH2_HUMAN
15 Dec 2023 01:01:56,344 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:01:56,344 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 01:01:56,636 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:56,636 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:01:56,880 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:01:56,880 INFO : Inserting sp|P05120|PAI2_HUMAN
15 Dec 2023 01:01:56,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:56,899 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 01:01:56,973 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:56,974 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:01:57,131 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:01:57,132 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:01:57,707 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:01:57,708 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:01:58,084 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:01:58,084 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 01:01:58,295 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:01:58,295 INFO : Inserting sp|P05161|ISG15_HUMAN
15 Dec 2023 01:01:58,337 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:58,337 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:01:59,517 DEBUG: Inserted 50 peptides
15 Dec 2023 01:01:59,565 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:01:59,565 INFO : Inserting sp|P05198|IF2A_HUMAN
15 Dec 2023 01:01:59,590 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:59,590 INFO : Inserting sp|P05231|IL6_HUMAN
15 Dec 2023 01:01:59,675 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:01:59,675 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 01:01:59,772 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:01:59,772 INFO : Inserting sp|P05386|RLA1_HUMAN
15 Dec 2023 01:01:59,826 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:59,826 INFO : Inserting sp|P05388|RLA0_HUMAN
15 Dec 2023 01:01:59,875 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:01:59,875 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 01:01:59,892 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:59,892 INFO : Inserting sp|P05413|FABPH_HUMAN
15 Dec 2023 01:01:59,948 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:59,948 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 01:01:59,980 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:01:59,980 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 01:02:00,267 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:00,267 INFO : Inserting sp|P05455|LA_HUMAN
15 Dec 2023 01:02:00,401 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:00,401 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:02:00,689 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:02:00,689 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:02:00,725 INFO : 26% Done
15 Dec 2023 01:02:01,039 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:02:01,039 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 01:02:01,103 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:01,103 INFO : Inserting sp|P05771|KPCB_HUMAN
15 Dec 2023 01:02:01,150 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:01,150 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 01:02:01,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:01,223 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 01:02:01,285 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:01,285 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:02:01,478 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:01,478 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 01:02:01,522 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:01,522 INFO : Inserting sp|P06331|HV434_HUMAN
15 Dec 2023 01:02:01,543 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:01,543 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:02:02,427 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:02:02,427 INFO : Inserting sp|P06576|ATPB_HUMAN
15 Dec 2023 01:02:02,721 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:02:02,721 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:02:03,385 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:02:03,385 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:02:03,531 INFO : 27% Done
15 Dec 2023 01:02:03,732 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:03,733 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 01:02:04,241 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:02:04,241 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:02:04,970 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:02:04,970 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:02:05,527 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:02:05,527 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:02:06,094 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:02:06,094 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 01:02:06,161 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:06,161 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 01:02:06,289 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:06,290 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:02:06,353 INFO : 28% Done
15 Dec 2023 01:02:06,514 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:06,514 INFO : Inserting sp|P07108|ACBP_HUMAN
15 Dec 2023 01:02:06,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:06,533 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:02:06,781 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:06,781 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 01:02:06,820 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:06,820 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 01:02:06,983 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:06,983 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:02:07,351 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:02:07,351 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 01:02:07,497 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:07,497 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 01:02:07,733 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:07,734 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:02:08,218 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:02:08,218 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 01:02:08,390 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:08,390 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:02:08,931 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:02:08,931 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:02:09,113 INFO : 29% Done
15 Dec 2023 01:02:09,467 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:02:09,467 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 01:02:09,539 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:09,539 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 01:02:09,701 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:09,701 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 01:02:09,974 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:09,974 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:02:10,237 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:10,237 INFO : Inserting sp|P07451|CAH3_HUMAN
15 Dec 2023 01:02:10,286 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:10,287 INFO : Inserting sp|P07585|PGS2_HUMAN
15 Dec 2023 01:02:10,342 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:10,342 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:02:10,819 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:02:10,820 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 01:02:10,924 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:10,924 INFO : Inserting sp|P07711|CATL1_HUMAN
15 Dec 2023 01:02:11,019 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:11,019 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:02:11,260 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:02:11,261 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 01:02:11,323 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:11,323 INFO : Inserting sp|P07741|APT_HUMAN
15 Dec 2023 01:02:11,425 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:11,425 INFO : Inserting sp|P07814|SYEP_HUMAN
15 Dec 2023 01:02:11,528 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:11,528 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 01:02:11,860 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:02:11,861 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:02:12,156 INFO : 30% Done
15 Dec 2023 01:02:12,195 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:02:12,195 INFO : Inserting sp|P07902|GALT_HUMAN
15 Dec 2023 01:02:12,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:12,225 INFO : Inserting sp|P07910|HNRPC_HUMAN
15 Dec 2023 01:02:12,260 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:12,260 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 01:02:12,306 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:12,306 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 01:02:12,489 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:12,489 INFO : Inserting sp|P07954|FUMH_HUMAN
15 Dec 2023 01:02:12,619 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:12,619 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:02:12,821 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:12,821 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:02:12,861 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:12,862 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:02:13,118 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:02:13,118 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 01:02:13,438 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:02:13,438 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:02:13,891 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:02:13,891 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 01:02:14,012 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:14,012 INFO : Inserting sp|P08236|BGLR_HUMAN
15 Dec 2023 01:02:14,098 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:14,098 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:02:14,330 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:02:14,330 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:02:14,420 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:14,420 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:02:14,886 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:02:14,886 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:02:14,948 INFO : 31% Done
15 Dec 2023 01:02:15,117 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:15,117 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:02:15,430 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:15,431 INFO : Inserting sp|P08473|NEP_HUMAN
15 Dec 2023 01:02:15,460 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:15,460 INFO : Inserting sp|P08476|INHBA_HUMAN
15 Dec 2023 01:02:15,475 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:15,476 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 01:02:15,508 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:15,509 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 01:02:15,794 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:02:15,794 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 01:02:15,931 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:15,931 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:02:16,715 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:02:16,715 INFO : Inserting sp|P08572|CO4A2_HUMAN
15 Dec 2023 01:02:16,849 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:16,849 INFO : Imported 400 peptide groups.
15 Dec 2023 01:02:16,849 INFO : Inserting sp|P08574|CY1_HUMAN
15 Dec 2023 01:02:16,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:16,888 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:02:17,030 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:17,030 INFO : Inserting sp|P08579|RU2B_HUMAN
15 Dec 2023 01:02:17,043 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:17,043 INFO : Inserting sp|P08582|TRFM_HUMAN
15 Dec 2023 01:02:17,104 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:17,105 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:02:18,046 INFO : 32% Done
15 Dec 2023 01:02:18,046 DEBUG: Inserted 50 peptides
15 Dec 2023 01:02:18,281 DEBUG: Total peptides inserted: 67
15 Dec 2023 01:02:18,281 INFO : Inserting sp|P08631|HCK_HUMAN
15 Dec 2023 01:02:18,450 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:18,450 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 01:02:18,538 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:18,538 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 01:02:18,887 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:02:18,887 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:02:19,449 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:19,449 INFO : Inserting sp|P08708|RS17_HUMAN
15 Dec 2023 01:02:19,468 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:19,468 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 01:02:19,735 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:19,735 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:02:19,781 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:19,782 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:02:19,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:19,828 INFO : Inserting sp|P09012|SNRPA_HUMAN
15 Dec 2023 01:02:19,838 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:19,838 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 01:02:20,053 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:20,053 INFO : Inserting sp|P09110|THIK_HUMAN
15 Dec 2023 01:02:20,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:20,081 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 01:02:20,212 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:20,212 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:02:20,467 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:20,467 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 01:02:20,492 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:20,492 INFO : Inserting sp|P09327|VILI_HUMAN
15 Dec 2023 01:02:20,512 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:20,512 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 01:02:20,589 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:20,589 INFO : Inserting sp|P09417|DHPR_HUMAN
15 Dec 2023 01:02:20,659 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:20,659 INFO : Inserting sp|P09429|HMGB1_HUMAN
15 Dec 2023 01:02:20,708 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:20,708 INFO : Inserting sp|P09467|F16P1_HUMAN
15 Dec 2023 01:02:20,724 INFO : 33% Done
15 Dec 2023 01:02:20,942 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:20,943 INFO : Inserting sp|P09471|GNAO_HUMAN
15 Dec 2023 01:02:21,012 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:21,012 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:02:21,292 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:21,292 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 01:02:21,459 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:21,459 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 01:02:21,580 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:21,580 INFO : Inserting sp|P09603|CSF1_HUMAN
15 Dec 2023 01:02:21,761 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:21,762 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 01:02:21,890 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:21,890 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 01:02:22,028 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:22,028 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:02:22,203 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:22,203 INFO : Inserting sp|P09661|RU2A_HUMAN
15 Dec 2023 01:02:22,233 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:22,233 INFO : Inserting sp|P09668|CATH_HUMAN
15 Dec 2023 01:02:22,477 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:22,477 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 01:02:22,630 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:22,630 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:02:23,175 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:02:23,175 INFO : Inserting sp|P09874|PARP1_HUMAN
15 Dec 2023 01:02:23,202 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:23,202 INFO : Inserting sp|P09917|LOX5_HUMAN
15 Dec 2023 01:02:23,264 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:23,264 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:02:23,805 INFO : 34% Done
15 Dec 2023 01:02:24,103 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:02:24,103 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 01:02:24,376 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:24,376 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:02:25,671 DEBUG: Inserted 50 peptides
15 Dec 2023 01:02:26,485 INFO : 35% Done
15 Dec 2023 01:02:27,131 DEBUG: Inserted 100 peptides
15 Dec 2023 01:02:27,171 DEBUG: Total peptides inserted: 101
15 Dec 2023 01:02:27,171 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:02:28,552 DEBUG: Inserted 50 peptides
15 Dec 2023 01:02:29,217 INFO : 36% Done
15 Dec 2023 01:02:30,195 DEBUG: Inserted 100 peptides
15 Dec 2023 01:02:30,291 DEBUG: Total peptides inserted: 102
15 Dec 2023 01:02:30,291 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 01:02:30,411 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:30,411 INFO : Inserting sp|P0CF74|IGLC6_HUMAN
15 Dec 2023 01:02:30,637 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:30,637 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 01:02:31,316 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:02:31,316 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 01:02:32,280 INFO : 37% Done
15 Dec 2023 01:02:32,959 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:02:32,959 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 01:02:33,000 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:33,000 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:02:33,459 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:02:33,459 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:02:33,936 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:02:33,936 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:02:34,128 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:34,128 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:02:34,263 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:34,263 INFO : Inserting sp|P0DP58|LYNX1_HUMAN
15 Dec 2023 01:02:34,276 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:34,276 INFO : Inserting sp|P0DPK2|H3Y1_HUMAN
15 Dec 2023 01:02:34,290 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:34,290 INFO : Inserting sp|P0DPK5|H3Y2_HUMAN
15 Dec 2023 01:02:34,303 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:34,303 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 01:02:34,348 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:34,348 INFO : Inserting sp|P10155|RO60_HUMAN
15 Dec 2023 01:02:34,444 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:34,444 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 01:02:34,534 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:34,534 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 01:02:34,547 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:34,547 INFO : Inserting sp|P10412|H14_HUMAN
15 Dec 2023 01:02:34,661 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:34,661 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 01:02:34,836 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:34,836 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 01:02:34,956 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:34,956 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:02:35,099 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:35,099 INFO : Inserting sp|P10619|PPGB_HUMAN
15 Dec 2023 01:02:35,241 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:35,241 INFO : Inserting sp|P10636|TAU_HUMAN
15 Dec 2023 01:02:35,253 INFO : 38% Done
15 Dec 2023 01:02:35,289 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:35,289 INFO : Inserting sp|P10636-9|TAU_HUMAN
15 Dec 2023 01:02:35,328 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:35,328 INFO : Inserting sp|P10636-8|TAU_HUMAN
15 Dec 2023 01:02:35,368 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:35,368 INFO : Inserting sp|P10636-7|TAU_HUMAN
15 Dec 2023 01:02:35,407 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:35,407 INFO : Inserting sp|P10636-6|TAU_HUMAN
15 Dec 2023 01:02:35,446 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:35,446 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:02:36,350 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:02:36,350 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 01:02:36,455 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:36,455 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:02:36,589 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:36,589 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 01:02:36,700 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:36,700 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:02:37,249 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:02:37,249 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 01:02:37,491 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:37,491 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 01:02:37,588 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:37,589 INFO : Inserting sp|P11055|MYH3_HUMAN
15 Dec 2023 01:02:37,606 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:37,606 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:02:38,060 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:02:38,060 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:02:38,302 INFO : 39% Done
15 Dec 2023 01:02:38,558 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:02:38,558 INFO : Inserting sp|P11216|PYGB_HUMAN
15 Dec 2023 01:02:38,746 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:38,746 INFO : Inserting sp|P11217|PYGM_HUMAN
15 Dec 2023 01:02:38,859 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:38,859 INFO : Inserting sp|P11233|RALA_HUMAN
15 Dec 2023 01:02:38,891 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:38,891 INFO : Inserting sp|P11234|RALB_HUMAN
15 Dec 2023 01:02:38,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:38,922 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 01:02:38,983 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:38,983 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 01:02:39,020 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:39,020 INFO : Inserting sp|P11362|FGFR1_HUMAN
15 Dec 2023 01:02:39,134 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:39,134 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:02:39,409 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:39,409 INFO : Inserting sp|P11488|GNAT1_HUMAN
15 Dec 2023 01:02:39,457 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:39,457 INFO : Inserting sp|P11597|CETP_HUMAN
15 Dec 2023 01:02:39,487 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:39,487 INFO : Inserting sp|P11678|PERE_HUMAN
15 Dec 2023 01:02:39,568 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:39,568 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 01:02:39,769 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:39,769 INFO : Inserting sp|P11766|ADHX_HUMAN
15 Dec 2023 01:02:39,803 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:39,803 INFO : Inserting sp|P11908|PRPS2_HUMAN
15 Dec 2023 01:02:39,815 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:39,815 INFO : Inserting sp|P11940|PABP1_HUMAN
15 Dec 2023 01:02:39,869 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:39,869 INFO : Inserting sp|P12081|HARS1_HUMAN
15 Dec 2023 01:02:39,988 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:39,988 INFO : Inserting sp|P12107|COBA1_HUMAN
15 Dec 2023 01:02:40,043 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:40,043 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:02:40,680 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:02:40,680 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 01:02:40,776 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:40,777 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:02:41,094 INFO : 40% Done
15 Dec 2023 01:02:41,727 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:02:41,727 INFO : Inserting sp|P12235|ADT1_HUMAN
15 Dec 2023 01:02:41,791 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:41,791 INFO : Inserting sp|P12236|ADT3_HUMAN
15 Dec 2023 01:02:41,874 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:41,874 INFO : Imported 500 peptide groups.
15 Dec 2023 01:02:41,874 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:02:42,563 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:02:42,563 INFO : Inserting sp|P12277|KCRB_HUMAN
15 Dec 2023 01:02:42,617 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:42,617 INFO : Inserting sp|P12318|FCG2A_HUMAN
15 Dec 2023 01:02:42,732 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:42,733 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:02:42,996 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:42,996 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 01:02:43,074 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:43,074 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:02:44,160 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:02:44,160 INFO : Inserting sp|P12821|ACE_HUMAN
15 Dec 2023 01:02:44,201 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:44,202 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 01:02:44,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:44,214 INFO : Inserting sp|P12838|DEF4_HUMAN
15 Dec 2023 01:02:44,233 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:44,233 INFO : Inserting sp|P12882|MYH1_HUMAN
15 Dec 2023 01:02:44,249 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:44,249 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 01:02:44,336 INFO : 41% Done
15 Dec 2023 01:02:44,432 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:44,432 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 01:02:44,727 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:02:44,727 INFO : Inserting sp|P13284|GILT_HUMAN
15 Dec 2023 01:02:44,827 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:44,827 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 01:02:44,913 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:44,913 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:02:45,575 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:02:45,576 INFO : Inserting sp|P13521|SCG2_HUMAN
15 Dec 2023 01:02:45,661 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:45,662 INFO : Inserting sp|P13535|MYH8_HUMAN
15 Dec 2023 01:02:45,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:45,679 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:02:45,993 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:02:45,993 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 01:02:46,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:46,029 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 01:02:46,352 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:02:46,352 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 01:02:46,744 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:02:46,744 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:02:47,014 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:02:47,014 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:02:47,094 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:47,094 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 01:02:47,127 INFO : 42% Done
15 Dec 2023 01:02:47,154 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:47,154 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:02:47,767 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:02:47,767 INFO : Inserting sp|P13688|CEAM1_HUMAN
15 Dec 2023 01:02:47,810 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:47,810 INFO : Inserting sp|P13693|TCTP_HUMAN
15 Dec 2023 01:02:47,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:47,827 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 01:02:47,953 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:47,953 INFO : Inserting sp|P13727|PRG2_HUMAN
15 Dec 2023 01:02:47,976 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:47,976 INFO : Inserting sp|P13747|HLAE_HUMAN
15 Dec 2023 01:02:47,996 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:47,996 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:02:48,900 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:02:48,900 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 01:02:49,117 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:49,118 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 01:02:49,226 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:49,226 INFO : Inserting sp|P13807|GYS1_HUMAN
15 Dec 2023 01:02:49,287 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:49,287 INFO : Inserting sp|P13861|KAP2_HUMAN
15 Dec 2023 01:02:49,365 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:49,365 INFO : Inserting sp|P13929|ENOB_HUMAN
15 Dec 2023 01:02:49,499 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:49,499 INFO : Inserting sp|P13987|CD59_HUMAN
15 Dec 2023 01:02:49,587 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:49,587 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 01:02:49,626 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:49,626 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 01:02:49,656 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:49,656 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 01:02:49,700 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:49,701 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 01:02:49,803 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:49,803 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 01:02:49,858 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:49,859 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 01:02:49,869 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:49,869 INFO : Inserting sp|P14324|FPPS_HUMAN
15 Dec 2023 01:02:49,879 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:49,879 INFO : Inserting sp|P14384|CBPM_HUMAN
15 Dec 2023 01:02:49,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:49,923 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 01:02:49,992 INFO : 43% Done
15 Dec 2023 01:02:50,186 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:50,187 INFO : Inserting sp|P14550|AK1A1_HUMAN
15 Dec 2023 01:02:50,311 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:50,311 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 01:02:50,573 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:02:50,573 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:02:51,142 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:02:51,142 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:02:51,366 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:02:51,366 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:02:51,948 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:02:51,948 INFO : Inserting sp|P14854|CX6B1_HUMAN
15 Dec 2023 01:02:51,985 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:51,985 INFO : Inserting sp|P14866|HNRPL_HUMAN
15 Dec 2023 01:02:52,192 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:52,192 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 01:02:52,254 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:52,254 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 01:02:52,272 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:52,272 INFO : Inserting sp|P15121|ALDR_HUMAN
15 Dec 2023 01:02:52,329 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:52,329 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 01:02:52,527 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:52,527 INFO : Inserting sp|P15153|RAC2_HUMAN
15 Dec 2023 01:02:52,603 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:52,603 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 01:02:52,907 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:02:52,907 INFO : Inserting sp|P15170|ERF3A_HUMAN
15 Dec 2023 01:02:52,915 INFO : 44% Done
15 Dec 2023 01:02:52,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:52,931 INFO : Inserting sp|P15289|ARSA_HUMAN
15 Dec 2023 01:02:52,979 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:52,979 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:02:53,139 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:53,139 INFO : Inserting sp|P15309|PPAP_HUMAN
15 Dec 2023 01:02:53,250 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:53,250 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 01:02:53,623 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:02:53,623 INFO : Inserting sp|P15313|VATB1_HUMAN
15 Dec 2023 01:02:53,675 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:53,675 INFO : Inserting sp|P15328|FOLR1_HUMAN
15 Dec 2023 01:02:53,763 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:53,764 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 01:02:53,845 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:53,846 INFO : Inserting sp|P15498|VAV_HUMAN
15 Dec 2023 01:02:53,883 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:53,883 INFO : Inserting sp|P15509|CSF2R_HUMAN
15 Dec 2023 01:02:53,983 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:53,983 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 01:02:54,097 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:54,097 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 01:02:54,343 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:54,343 INFO : Inserting sp|P15814|IGLL1_HUMAN
15 Dec 2023 01:02:54,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:54,372 INFO : Inserting sp|P15848|ARSB_HUMAN
15 Dec 2023 01:02:54,446 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:54,446 INFO : Inserting sp|P15927|RFA2_HUMAN
15 Dec 2023 01:02:54,458 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:54,459 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:02:54,568 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:54,568 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 01:02:54,611 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:54,611 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:02:54,673 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:54,673 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 01:02:54,866 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:54,866 INFO : Inserting sp|P16401|H15_HUMAN
15 Dec 2023 01:02:54,930 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:54,930 INFO : Inserting sp|P16402|H13_HUMAN
15 Dec 2023 01:02:55,037 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:55,037 INFO : Inserting sp|P16403|H12_HUMAN
15 Dec 2023 01:02:55,145 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:55,145 INFO : Inserting sp|P16435|NCPR_HUMAN
15 Dec 2023 01:02:55,258 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:55,258 INFO : Inserting sp|P16671|CD36_HUMAN
15 Dec 2023 01:02:55,300 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:55,300 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:02:55,511 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:55,511 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 01:02:55,657 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:55,657 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 01:02:55,810 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:55,810 INFO : Inserting sp|P16949|STMN1_HUMAN
15 Dec 2023 01:02:55,843 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:55,843 INFO : Inserting sp|P17050|NAGAB_HUMAN
15 Dec 2023 01:02:55,899 INFO : 45% Done
15 Dec 2023 01:02:55,942 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:55,942 INFO : Inserting sp|P17066|HSP76_HUMAN
15 Dec 2023 01:02:56,130 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:56,130 INFO : Inserting sp|P17174|AATC_HUMAN
15 Dec 2023 01:02:56,353 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:02:56,353 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:02:56,485 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:56,485 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 01:02:56,518 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:56,519 INFO : Inserting sp|P17858|PFKAL_HUMAN
15 Dec 2023 01:02:56,639 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:56,639 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:02:56,816 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:56,816 INFO : Inserting sp|P17927|CR1_HUMAN
15 Dec 2023 01:02:56,924 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:56,925 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 01:02:56,977 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:56,977 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 01:02:57,025 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:57,025 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 01:02:57,160 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:57,160 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 01:02:57,509 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:57,509 INFO : Inserting sp|P18084|ITB5_HUMAN
15 Dec 2023 01:02:57,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:57,532 INFO : Imported 600 peptide groups.
15 Dec 2023 01:02:57,532 INFO : Inserting sp|P18085|ARF4_HUMAN
15 Dec 2023 01:02:57,642 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:02:57,642 INFO : Inserting sp|P18124|RL7_HUMAN
15 Dec 2023 01:02:57,662 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:57,662 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 01:02:58,341 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:02:58,341 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 01:02:58,633 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:02:58,634 INFO : Inserting sp|P18510|IL1RA_HUMAN
15 Dec 2023 01:02:58,698 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:58,698 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:02:58,965 INFO : 46% Done
15 Dec 2023 01:02:59,011 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:02:59,011 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 01:02:59,021 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:59,021 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 01:02:59,288 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:02:59,288 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 01:02:59,391 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:02:59,391 INFO : Inserting sp|P19087|GNAT2_HUMAN
15 Dec 2023 01:02:59,437 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:02:59,437 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 01:02:59,526 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:02:59,526 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 01:02:59,712 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:59,712 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 01:02:59,761 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:02:59,761 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 01:02:59,908 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:02:59,909 INFO : Inserting sp|P19438|TNR1A_HUMAN
15 Dec 2023 01:02:59,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:59,942 INFO : Inserting sp|P19525|E2AK2_HUMAN
15 Dec 2023 01:02:59,969 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:02:59,969 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 01:03:00,224 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:00,225 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:03:01,008 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:03:01,008 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:03:01,644 INFO : 47% Done
15 Dec 2023 01:03:01,801 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:03:01,801 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 01:03:01,967 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:01,967 INFO : Inserting sp|P19838|NFKB1_HUMAN
15 Dec 2023 01:03:01,993 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:01,993 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 01:03:02,171 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:02,171 INFO : Inserting sp|P19957|ELAF_HUMAN
15 Dec 2023 01:03:02,191 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:02,191 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:03:02,509 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:02,509 INFO : Inserting sp|P20036|DPA1_HUMAN
15 Dec 2023 01:03:02,529 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:02,529 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 01:03:02,710 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:02,710 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:03:02,901 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:02,901 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 01:03:02,986 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:02,986 INFO : Inserting sp|P20138|CD33_HUMAN
15 Dec 2023 01:03:03,018 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:03,018 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:03:03,240 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:03,240 INFO : Inserting sp|P20292|AL5AP_HUMAN
15 Dec 2023 01:03:03,286 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:03,286 INFO : Inserting sp|P20333|TNR1B_HUMAN
15 Dec 2023 01:03:03,308 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:03,309 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 01:03:03,341 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:03,341 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:03:03,450 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:03,450 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 01:03:03,547 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:03,547 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 01:03:03,692 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:03,692 INFO : Inserting sp|P20701|ITAL_HUMAN
15 Dec 2023 01:03:03,776 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:03,776 INFO : Inserting sp|P20702|ITAX_HUMAN
15 Dec 2023 01:03:03,904 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:03,904 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:03:04,360 INFO : 48% Done
15 Dec 2023 01:03:04,718 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:03:04,718 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:03:05,121 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:05,121 INFO : Inserting sp|P20839|IMDH1_HUMAN
15 Dec 2023 01:03:05,132 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,132 INFO : Inserting sp|P20849|CO9A1_HUMAN
15 Dec 2023 01:03:05,151 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,151 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 01:03:05,243 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:05,243 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 01:03:05,447 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:05,447 INFO : Inserting sp|P20916|MAG_HUMAN
15 Dec 2023 01:03:05,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,509 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:03:05,558 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:05,558 INFO : Inserting sp|P21108|PRPS3_HUMAN
15 Dec 2023 01:03:05,569 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,570 INFO : Inserting sp|P21246|PTN_HUMAN
15 Dec 2023 01:03:05,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,592 INFO : Inserting sp|P21281|VATB2_HUMAN
15 Dec 2023 01:03:05,640 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:05,640 INFO : Inserting sp|P21283|VATC1_HUMAN
15 Dec 2023 01:03:05,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:05,676 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:03:06,535 DEBUG: Inserted 50 peptides
15 Dec 2023 01:03:06,568 DEBUG: Total peptides inserted: 51
15 Dec 2023 01:03:06,568 INFO : Inserting sp|P21399|ACOHC_HUMAN
15 Dec 2023 01:03:06,673 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:06,673 INFO : Inserting sp|P21462|FPR1_HUMAN
15 Dec 2023 01:03:06,725 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:06,725 INFO : Inserting sp|P21579|SYT1_HUMAN
15 Dec 2023 01:03:06,972 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:06,972 INFO : Inserting sp|P21796|VDAC1_HUMAN
15 Dec 2023 01:03:07,004 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:07,004 INFO : Inserting sp|P21802|FGFR2_HUMAN
15 Dec 2023 01:03:07,041 INFO : 49% Done
15 Dec 2023 01:03:07,093 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:07,093 INFO : Inserting sp|P21926|CD9_HUMAN
15 Dec 2023 01:03:07,141 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:07,141 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 01:03:07,331 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:07,331 INFO : Inserting sp|P22102|PUR2_HUMAN
15 Dec 2023 01:03:07,421 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:07,421 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 01:03:08,441 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:03:08,442 INFO : Inserting sp|P22304|IDS_HUMAN
15 Dec 2023 01:03:08,508 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:08,508 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:03:08,896 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:08,896 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:03:09,055 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:09,055 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 01:03:09,197 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:09,197 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:03:09,333 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:09,333 INFO : Inserting sp|P22692|IBP4_HUMAN
15 Dec 2023 01:03:09,435 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:09,435 INFO : Inserting sp|P22748|CAH4_HUMAN
15 Dec 2023 01:03:09,446 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:09,447 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:03:09,656 INFO : 50% Done
15 Dec 2023 01:03:09,667 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:09,668 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 01:03:09,737 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:09,737 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 01:03:09,936 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:09,936 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:03:10,537 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:03:10,537 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 01:03:10,560 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:10,560 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 01:03:10,787 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:10,787 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:03:11,350 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:03:11,350 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:03:11,483 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:11,483 INFO : Inserting sp|P23368|MAOM_HUMAN
15 Dec 2023 01:03:11,560 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:11,560 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 01:03:11,720 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:11,721 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 01:03:11,861 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:11,861 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 01:03:12,008 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:12,008 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:03:12,321 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:03:12,321 INFO : Inserting sp|P23515|OMGP_HUMAN
15 Dec 2023 01:03:12,390 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:12,390 INFO : Inserting sp|P23526|SAHH_HUMAN
15 Dec 2023 01:03:12,456 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:12,456 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:03:12,692 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:12,693 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:03:12,843 INFO : 51% Done
15 Dec 2023 01:03:12,965 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:12,965 INFO : Inserting sp|P23634|AT2B4_HUMAN
15 Dec 2023 01:03:12,977 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:12,977 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 01:03:13,385 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:03:13,385 INFO : Inserting sp|P24071|FCAR_HUMAN
15 Dec 2023 01:03:13,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:13,408 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:03:13,495 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:13,495 INFO : Inserting sp|P24347|MMP11_HUMAN
15 Dec 2023 01:03:13,512 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:13,512 INFO : Inserting sp|P24387|CRHBP_HUMAN
15 Dec 2023 01:03:13,549 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:13,549 INFO : Inserting sp|P24534|EF1B_HUMAN
15 Dec 2023 01:03:13,595 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:13,595 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:03:13,796 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:13,797 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 01:03:13,834 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:13,834 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 01:03:13,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:13,858 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 01:03:14,153 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:03:14,153 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 01:03:14,277 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:14,277 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:03:14,662 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:03:14,662 INFO : Inserting sp|P25325|THTM_HUMAN
15 Dec 2023 01:03:14,708 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:14,709 INFO : Inserting sp|P25398|RS12_HUMAN
15 Dec 2023 01:03:14,734 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:14,734 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 01:03:14,803 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:14,804 INFO : Imported 700 peptide groups.
15 Dec 2023 01:03:14,804 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 01:03:14,968 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:14,968 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:03:15,143 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:15,143 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 01:03:15,267 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:15,267 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:03:15,346 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:15,346 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:03:15,382 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:15,382 INFO : Inserting sp|P26022|PTX3_HUMAN
15 Dec 2023 01:03:15,530 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:15,530 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:03:15,552 INFO : 52% Done
15 Dec 2023 01:03:16,062 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:03:16,062 INFO : Inserting sp|P26196|DDX6_HUMAN
15 Dec 2023 01:03:16,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:16,081 INFO : Inserting sp|P26368|U2AF2_HUMAN
15 Dec 2023 01:03:16,185 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:16,185 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 01:03:16,262 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:16,262 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 01:03:16,373 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:16,373 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 01:03:16,491 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:16,491 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:03:16,621 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:16,621 INFO : Inserting sp|P26639|SYTC_HUMAN
15 Dec 2023 01:03:16,767 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:16,767 INFO : Inserting sp|P26640|SYVC_HUMAN
15 Dec 2023 01:03:16,792 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:16,792 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:03:16,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:16,868 INFO : Inserting sp|P26885|FKBP2_HUMAN
15 Dec 2023 01:03:16,897 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:16,897 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 01:03:17,157 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:17,157 INFO : Inserting sp|P26992|CNTFR_HUMAN
15 Dec 2023 01:03:17,283 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:17,283 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 01:03:17,411 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:17,411 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:03:17,756 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:17,756 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 01:03:17,933 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:17,933 INFO : Inserting sp|P27694|RFA1_HUMAN
15 Dec 2023 01:03:18,034 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:18,034 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:03:18,161 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:18,162 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:03:18,331 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:18,331 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 01:03:18,427 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:18,427 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 01:03:18,438 INFO : 53% Done
15 Dec 2023 01:03:18,536 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:18,537 INFO : Inserting sp|P27986|P85A_HUMAN
15 Dec 2023 01:03:18,569 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:18,569 INFO : Inserting sp|P28062|PSB8_HUMAN
15 Dec 2023 01:03:18,673 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:18,674 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 01:03:18,777 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:18,777 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 01:03:18,897 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:18,897 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 01:03:18,955 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:18,955 INFO : Inserting sp|P28072|PSB6_HUMAN
15 Dec 2023 01:03:19,012 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:19,012 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 01:03:19,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:19,036 INFO : Inserting sp|P28161|GSTM2_HUMAN
15 Dec 2023 01:03:19,083 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:19,083 INFO : Inserting sp|P28300|LYOX_HUMAN
15 Dec 2023 01:03:19,114 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:19,114 INFO : Inserting sp|P28482|MK01_HUMAN
15 Dec 2023 01:03:19,188 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:19,188 INFO : Inserting sp|P28676|GRAN_HUMAN
15 Dec 2023 01:03:19,422 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:03:19,422 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 01:03:19,480 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:19,480 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:03:19,762 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:19,763 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 01:03:19,831 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:19,831 INFO : Inserting sp|P29218|IMPA1_HUMAN
15 Dec 2023 01:03:19,865 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:19,865 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:03:20,056 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:20,056 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:03:20,945 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:03:20,945 INFO : Inserting sp|P29466|CASP1_HUMAN
15 Dec 2023 01:03:21,015 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:21,015 INFO : Inserting sp|P29508|SPB3_HUMAN
15 Dec 2023 01:03:21,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:21,028 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:03:21,292 INFO : 54% Done
15 Dec 2023 01:03:21,598 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:03:21,598 INFO : Inserting sp|P29692|EF1D_HUMAN
15 Dec 2023 01:03:21,639 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:21,639 INFO : Inserting sp|P30040|ERP29_HUMAN
15 Dec 2023 01:03:21,714 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:21,714 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:03:21,932 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:21,932 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:03:22,045 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:22,045 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 01:03:22,287 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:22,287 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:03:22,396 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:22,396 INFO : Inserting sp|P30048|PRDX3_HUMAN
15 Dec 2023 01:03:22,512 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:22,512 INFO : Inserting sp|P30050|RL12_HUMAN
15 Dec 2023 01:03:22,552 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:22,552 INFO : Inserting sp|P30084|ECHM_HUMAN
15 Dec 2023 01:03:22,586 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:22,586 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 01:03:22,650 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:22,650 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 01:03:23,035 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:23,035 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 01:03:23,315 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:23,315 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 01:03:23,503 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:23,503 INFO : Inserting sp|P30419|NMT1_HUMAN
15 Dec 2023 01:03:23,549 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:23,550 INFO : Inserting sp|P30520|PURA2_HUMAN
15 Dec 2023 01:03:23,681 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:23,682 INFO : Inserting sp|P30530|UFO_HUMAN
15 Dec 2023 01:03:23,757 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:23,757 INFO : Inserting sp|P30566|PUR8_HUMAN
15 Dec 2023 01:03:23,801 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:23,801 INFO : Inserting sp|P30613|KPYR_HUMAN
15 Dec 2023 01:03:23,846 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:23,846 INFO : Inserting sp|P30626|SORCN_HUMAN
15 Dec 2023 01:03:23,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:23,872 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:03:24,154 INFO : 55% Done
15 Dec 2023 01:03:24,571 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:03:24,571 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:03:24,784 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:24,785 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:03:25,140 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:25,140 INFO : Inserting sp|P31153|METK2_HUMAN
15 Dec 2023 01:03:25,165 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:25,165 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 01:03:25,397 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:25,397 INFO : Inserting sp|P31942|HNRH3_HUMAN
15 Dec 2023 01:03:25,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:25,415 INFO : Inserting sp|P31943|HNRH1_HUMAN
15 Dec 2023 01:03:25,486 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:25,486 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:03:25,714 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:25,714 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 01:03:25,815 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:25,815 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:03:25,888 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:25,888 INFO : Inserting sp|P31997|CEAM8_HUMAN
15 Dec 2023 01:03:25,945 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:25,945 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 01:03:26,016 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:26,016 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:03:26,198 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:26,198 INFO : Inserting sp|P32121|ARRB2_HUMAN
15 Dec 2023 01:03:26,256 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:26,256 INFO : Inserting sp|P32320|CDD_HUMAN
15 Dec 2023 01:03:26,364 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:26,364 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:03:26,513 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:26,514 INFO : Inserting sp|P32456|GBP2_HUMAN
15 Dec 2023 01:03:26,600 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:26,600 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 01:03:26,706 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:26,707 INFO : Inserting sp|P32969|RL9_HUMAN
15 Dec 2023 01:03:26,738 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:26,738 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 01:03:26,761 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:26,761 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:03:26,870 INFO : 56% Done
15 Dec 2023 01:03:26,994 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:26,994 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:03:27,304 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:27,305 INFO : Inserting sp|P34059|GALNS_HUMAN
15 Dec 2023 01:03:27,370 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:27,370 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 01:03:27,433 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:27,433 INFO : Inserting sp|P34810|CD68_HUMAN
15 Dec 2023 01:03:27,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:27,463 INFO : Inserting sp|P34896|GLYC_HUMAN
15 Dec 2023 01:03:27,476 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:27,476 INFO : Inserting sp|P34897|GLYM_HUMAN
15 Dec 2023 01:03:27,489 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:27,490 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 01:03:27,789 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:03:27,789 INFO : Inserting sp|P34949|MPI_HUMAN
15 Dec 2023 01:03:27,843 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:27,843 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 01:03:27,860 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:27,860 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 01:03:28,009 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:28,009 INFO : Inserting sp|P35228|NOS2_HUMAN
15 Dec 2023 01:03:28,065 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:28,065 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 01:03:28,172 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:28,172 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 01:03:28,364 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:03:28,364 INFO : Imported 800 peptide groups.
15 Dec 2023 01:03:28,364 INFO : Inserting sp|P35244|RFA3_HUMAN
15 Dec 2023 01:03:28,410 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:28,410 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 01:03:28,462 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:28,462 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 01:03:28,505 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:28,505 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:03:28,632 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:28,632 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:03:28,856 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:28,856 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:03:29,610 INFO : 57% Done
15 Dec 2023 01:03:29,671 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:03:29,671 INFO : Inserting sp|P35609|ACTN2_HUMAN
15 Dec 2023 01:03:29,918 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:03:29,918 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 01:03:29,940 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:29,940 INFO : Inserting sp|P35749|MYH11_HUMAN
15 Dec 2023 01:03:30,080 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:30,080 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 01:03:30,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:30,102 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:03:30,939 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:03:30,939 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 01:03:31,095 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:31,095 INFO : Inserting sp|P35916|VGFR3_HUMAN
15 Dec 2023 01:03:31,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:31,136 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:03:31,670 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:03:31,670 INFO : Inserting sp|P36406|TRI23_HUMAN
15 Dec 2023 01:03:31,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:31,698 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:03:31,887 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:31,887 INFO : Inserting sp|P36897|TGFR1_HUMAN
15 Dec 2023 01:03:31,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:31,911 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:03:32,359 INFO : 58% Done
15 Dec 2023 01:03:32,465 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:03:32,465 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:03:32,585 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:32,585 INFO : Inserting sp|P37108|SRP14_HUMAN
15 Dec 2023 01:03:32,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:32,611 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 01:03:32,774 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:32,774 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:03:33,103 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:33,103 INFO : Inserting sp|P38159|RBMX_HUMAN
15 Dec 2023 01:03:33,161 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:33,161 INFO : Inserting sp|P38405|GNAL_HUMAN
15 Dec 2023 01:03:33,233 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:33,233 INFO : Inserting sp|P38571|LICH_HUMAN
15 Dec 2023 01:03:33,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:33,274 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 01:03:33,383 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:33,383 INFO : Inserting sp|P38919|IF4A3_HUMAN
15 Dec 2023 01:03:33,431 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:33,431 INFO : Inserting sp|P39023|RL3_HUMAN
15 Dec 2023 01:03:33,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:33,463 INFO : Inserting sp|P39059|COFA1_HUMAN
15 Dec 2023 01:03:33,607 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:33,607 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 01:03:33,793 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:33,793 INFO : Inserting sp|P39656|OST48_HUMAN
15 Dec 2023 01:03:33,851 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:33,851 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 01:03:34,077 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:34,077 INFO : Inserting sp|P39748|FEN1_HUMAN
15 Dec 2023 01:03:34,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:34,103 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 01:03:34,253 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:34,253 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 01:03:34,367 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:34,367 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 01:03:34,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:34,441 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 01:03:34,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:34,524 INFO : Inserting sp|P40763|STAT3_HUMAN
15 Dec 2023 01:03:34,670 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:34,670 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:03:34,797 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:34,797 INFO : Inserting sp|P40926|MDHM_HUMAN
15 Dec 2023 01:03:34,955 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:34,955 INFO : Inserting sp|P40939|ECHA_HUMAN
15 Dec 2023 01:03:35,089 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:35,089 INFO : Inserting sp|P41091|IF2G_HUMAN
15 Dec 2023 01:03:35,135 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:35,135 INFO : Inserting sp|P41217|OX2G_HUMAN
15 Dec 2023 01:03:35,164 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:35,164 INFO : Inserting sp|P41218|MNDA_HUMAN
15 Dec 2023 01:03:35,297 INFO : 59% Done
15 Dec 2023 01:03:35,470 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:03:35,471 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:03:35,736 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:35,736 INFO : Inserting sp|P41226|UBA7_HUMAN
15 Dec 2023 01:03:35,852 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:35,852 INFO : Inserting sp|P41240|CSK_HUMAN
15 Dec 2023 01:03:35,954 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:35,954 INFO : Inserting sp|P41250|GARS_HUMAN
15 Dec 2023 01:03:35,997 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:35,997 INFO : Inserting sp|P41252|SYIC_HUMAN
15 Dec 2023 01:03:36,072 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:36,072 INFO : Inserting sp|P42025|ACTY_HUMAN
15 Dec 2023 01:03:36,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:36,084 INFO : Inserting sp|P42166|LAP2A_HUMAN
15 Dec 2023 01:03:36,155 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:36,155 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 01:03:36,324 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:36,325 INFO : Inserting sp|P42331|RHG25_HUMAN
15 Dec 2023 01:03:36,400 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:36,401 INFO : Inserting sp|P42574|CASP3_HUMAN
15 Dec 2023 01:03:36,440 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:36,441 INFO : Inserting sp|P42765|THIM_HUMAN
15 Dec 2023 01:03:36,465 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:36,465 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 01:03:36,612 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:36,612 INFO : Inserting sp|P43003|EAA1_HUMAN
15 Dec 2023 01:03:36,637 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:36,637 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:03:36,754 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:36,754 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 01:03:37,103 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:37,103 INFO : Inserting sp|P43146|DCC_HUMAN
15 Dec 2023 01:03:37,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:37,119 INFO : Inserting sp|P43234|CATO_HUMAN
15 Dec 2023 01:03:37,145 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:37,145 INFO : Inserting sp|P43243|MATR3_HUMAN
15 Dec 2023 01:03:37,197 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:37,197 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 01:03:37,511 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:37,511 INFO : Inserting sp|P43405|KSYK_HUMAN
15 Dec 2023 01:03:37,601 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:37,602 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 01:03:38,006 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:03:38,006 INFO : Inserting sp|P43630|KI3L2_HUMAN
15 Dec 2023 01:03:38,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,024 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:03:38,190 INFO : 60% Done
15 Dec 2023 01:03:38,702 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:03:38,702 INFO : Inserting sp|P45877|PPIC_HUMAN
15 Dec 2023 01:03:38,719 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,719 INFO : Inserting sp|P45880|VDAC2_HUMAN
15 Dec 2023 01:03:38,761 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:38,761 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 01:03:38,806 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:38,806 INFO : Inserting sp|P46109|CRKL_HUMAN
15 Dec 2023 01:03:38,873 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:38,873 INFO : Inserting sp|P46459|NSF_HUMAN
15 Dec 2023 01:03:38,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,897 INFO : Inserting sp|P46736|BRCC3_HUMAN
15 Dec 2023 01:03:38,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,911 INFO : Inserting sp|P46776|RL27A_HUMAN
15 Dec 2023 01:03:38,952 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:38,952 INFO : Inserting sp|P46777|RL5_HUMAN
15 Dec 2023 01:03:38,984 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,984 INFO : Inserting sp|P46778|RL21_HUMAN
15 Dec 2023 01:03:38,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:38,999 INFO : Inserting sp|P46821|MAP1B_HUMAN
15 Dec 2023 01:03:39,074 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:39,074 INFO : Inserting sp|P46926|GNPI1_HUMAN
15 Dec 2023 01:03:39,243 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:39,243 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:03:39,976 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:03:39,976 INFO : Inserting sp|P46976|GLYG_HUMAN
15 Dec 2023 01:03:40,216 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:40,216 INFO : Inserting sp|P47755|CAZA2_HUMAN
15 Dec 2023 01:03:40,343 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:40,343 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:03:40,537 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:40,537 INFO : Inserting sp|P48047|ATPO_HUMAN
15 Dec 2023 01:03:40,849 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:40,850 INFO : Inserting sp|P48058|GRIA4_HUMAN
15 Dec 2023 01:03:40,878 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:40,878 INFO : Inserting sp|P48061|SDF1_HUMAN
15 Dec 2023 01:03:40,902 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:40,902 INFO : Inserting sp|P48147|PPCE_HUMAN
15 Dec 2023 01:03:41,186 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:41,186 INFO : Inserting sp|P48304|REG1B_HUMAN
15 Dec 2023 01:03:41,198 INFO : 61% Done
15 Dec 2023 01:03:41,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:41,225 INFO : Inserting sp|P48444|COPD_HUMAN
15 Dec 2023 01:03:41,299 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:41,299 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 01:03:41,343 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:41,344 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 01:03:41,389 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:41,390 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:03:41,703 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:41,703 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 01:03:41,829 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:41,829 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 01:03:41,902 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:41,902 INFO : Inserting sp|P48723|HSP13_HUMAN
15 Dec 2023 01:03:42,000 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:42,000 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 01:03:42,213 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:42,213 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 01:03:42,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:42,224 INFO : Inserting sp|P48960|AGRE5_HUMAN
15 Dec 2023 01:03:42,313 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:42,313 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 01:03:42,361 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:42,361 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 01:03:42,389 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:42,389 INFO : Inserting sp|P49257|LMAN1_HUMAN
15 Dec 2023 01:03:42,422 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:42,422 INFO : Imported 900 peptide groups.
15 Dec 2023 01:03:42,422 INFO : Inserting sp|P49354|FNTA_HUMAN
15 Dec 2023 01:03:42,516 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:42,516 INFO : Inserting sp|P49368|TCPG_HUMAN
15 Dec 2023 01:03:42,582 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:42,582 INFO : Inserting sp|P49411|EFTU_HUMAN
15 Dec 2023 01:03:42,618 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:42,618 INFO : Inserting sp|P49585|PCY1A_HUMAN
15 Dec 2023 01:03:42,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:42,648 INFO : Inserting sp|P49588|SYAC_HUMAN
15 Dec 2023 01:03:42,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:42,686 INFO : Inserting sp|P49591|SYSC_HUMAN
15 Dec 2023 01:03:42,728 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:42,728 INFO : Inserting sp|P49593|PPM1F_HUMAN
15 Dec 2023 01:03:42,792 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:42,792 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:03:43,062 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:43,062 INFO : Inserting sp|P49662|CASP4_HUMAN
15 Dec 2023 01:03:43,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:43,081 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 01:03:43,190 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:43,190 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:03:43,261 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:43,261 INFO : Inserting sp|P49773|HINT1_HUMAN
15 Dec 2023 01:03:43,317 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:43,317 INFO : Inserting sp|P49821|NDUV1_HUMAN
15 Dec 2023 01:03:43,340 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:43,340 INFO : Inserting sp|P49862|KLK7_HUMAN
15 Dec 2023 01:03:43,359 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:43,359 INFO : Inserting sp|P49902|5NTC_HUMAN
15 Dec 2023 01:03:43,519 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:43,519 INFO : Inserting sp|P49903|SPS1_HUMAN
15 Dec 2023 01:03:43,570 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:43,570 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:03:43,610 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:43,611 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 01:03:43,630 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:43,630 INFO : Inserting sp|P50225|ST1A1_HUMAN
15 Dec 2023 01:03:43,708 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:43,708 INFO : Inserting sp|P50226|ST1A2_HUMAN
15 Dec 2023 01:03:43,787 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:43,787 INFO : Inserting sp|P50281|MMP14_HUMAN
15 Dec 2023 01:03:43,825 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:43,825 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:03:44,111 INFO : 62% Done
15 Dec 2023 01:03:44,370 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:03:44,370 INFO : Inserting sp|P50452|SPB8_HUMAN
15 Dec 2023 01:03:44,481 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:44,481 INFO : Inserting sp|P50453|SPB9_HUMAN
15 Dec 2023 01:03:44,544 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:44,545 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 01:03:44,644 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:44,644 INFO : Inserting sp|P50570|DYN2_HUMAN
15 Dec 2023 01:03:44,699 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:44,699 INFO : Inserting sp|P50897|PPT1_HUMAN
15 Dec 2023 01:03:44,723 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:44,723 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 01:03:44,758 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:44,758 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 01:03:44,873 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:44,873 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 01:03:44,987 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:44,987 INFO : Inserting sp|P51148|RAB5C_HUMAN
15 Dec 2023 01:03:45,059 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:45,059 INFO : Inserting sp|P51149|RAB7A_HUMAN
15 Dec 2023 01:03:45,209 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:45,209 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 01:03:45,331 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:45,331 INFO : Inserting sp|P51580|TPMT_HUMAN
15 Dec 2023 01:03:45,350 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:45,350 INFO : Inserting sp|P51610|HCFC1_HUMAN
15 Dec 2023 01:03:45,369 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:45,369 INFO : Inserting sp|P51659|DHB4_HUMAN
15 Dec 2023 01:03:45,418 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:45,418 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 01:03:45,441 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:45,441 INFO : Inserting sp|P51668|UB2D1_HUMAN
15 Dec 2023 01:03:45,468 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:45,468 INFO : Inserting sp|P51692|STA5B_HUMAN
15 Dec 2023 01:03:45,566 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:45,566 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 01:03:45,840 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:45,840 INFO : Inserting sp|P51809|VAMP7_HUMAN
15 Dec 2023 01:03:45,890 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:45,890 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:03:46,071 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:46,071 INFO : Inserting sp|P51888|PRELP_HUMAN
15 Dec 2023 01:03:46,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:46,152 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 01:03:46,272 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:46,272 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:03:46,792 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:03:46,792 INFO : Inserting sp|P52272|HNRPM_HUMAN
15 Dec 2023 01:03:46,857 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:46,857 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 01:03:47,094 INFO : 63% Done
15 Dec 2023 01:03:47,127 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:47,127 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:03:47,537 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:03:47,537 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:03:47,598 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:47,598 INFO : Inserting sp|P52788|SPSY_HUMAN
15 Dec 2023 01:03:47,655 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:47,655 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:03:48,364 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:03:48,364 INFO : Inserting sp|P52799|EFNB2_HUMAN
15 Dec 2023 01:03:48,423 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:48,424 INFO : Inserting sp|P52888|THOP1_HUMAN
15 Dec 2023 01:03:48,481 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:48,481 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 01:03:48,597 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:48,597 INFO : Inserting sp|P52951|GBX2_HUMAN
15 Dec 2023 01:03:48,632 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:48,632 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 01:03:48,781 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:48,781 INFO : Inserting sp|P53365|ARFP2_HUMAN
15 Dec 2023 01:03:48,793 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:48,793 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:03:49,105 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:03:49,105 INFO : Inserting sp|P53609|PGTB1_HUMAN
15 Dec 2023 01:03:49,118 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:49,118 INFO : Inserting sp|P53618|COPB_HUMAN
15 Dec 2023 01:03:49,224 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:49,224 INFO : Inserting sp|P53621|COPA_HUMAN
15 Dec 2023 01:03:49,342 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:49,342 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 01:03:49,485 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:49,485 INFO : Inserting sp|P53675|CLH2_HUMAN
15 Dec 2023 01:03:49,722 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:49,722 INFO : Inserting sp|P53801|PTTG_HUMAN
15 Dec 2023 01:03:49,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:49,758 INFO : Inserting sp|P53999|TCP4_HUMAN
15 Dec 2023 01:03:49,782 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:49,782 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 01:03:49,817 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:49,817 INFO : Inserting sp|P54136|SYRC_HUMAN
15 Dec 2023 01:03:49,856 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:49,856 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 01:03:49,875 INFO : 64% Done
15 Dec 2023 01:03:50,105 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:03:50,105 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 01:03:50,177 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:50,177 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 01:03:50,334 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:50,334 INFO : Inserting sp|P54725|RD23A_HUMAN
15 Dec 2023 01:03:50,345 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:50,345 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 01:03:50,405 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:50,405 INFO : Inserting sp|P54756|EPHA5_HUMAN
15 Dec 2023 01:03:50,423 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:50,423 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 01:03:50,556 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:50,556 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 01:03:50,808 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:50,808 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 01:03:50,964 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:50,964 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 01:03:51,002 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:51,002 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 01:03:51,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:51,029 INFO : Inserting sp|P55010|IF5_HUMAN
15 Dec 2023 01:03:51,054 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:51,054 INFO : Inserting sp|P55011|S12A2_HUMAN
15 Dec 2023 01:03:51,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:51,074 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:03:51,650 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:03:51,650 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:03:51,907 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:51,907 INFO : Inserting sp|P55083|MFAP4_HUMAN
15 Dec 2023 01:03:51,999 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:51,999 INFO : Inserting sp|P55160|NCKPL_HUMAN
15 Dec 2023 01:03:52,064 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:52,064 INFO : Inserting sp|P55209|NP1L1_HUMAN
15 Dec 2023 01:03:52,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:52,084 INFO : Inserting sp|P55263|ADK_HUMAN
15 Dec 2023 01:03:52,170 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:52,170 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 01:03:52,257 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:52,257 INFO : Inserting sp|P55285|CADH6_HUMAN
15 Dec 2023 01:03:52,279 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:52,279 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 01:03:52,343 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:52,343 INFO : Inserting sp|P55290|CAD13_HUMAN
15 Dec 2023 01:03:52,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:52,371 INFO : Inserting sp|P55735|SEC13_HUMAN
15 Dec 2023 01:03:52,399 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:52,399 INFO : Inserting sp|P55774|CCL18_HUMAN
15 Dec 2023 01:03:52,449 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:52,449 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 01:03:52,537 INFO : 65% Done
15 Dec 2023 01:03:52,923 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:03:52,923 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 01:03:52,955 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:52,955 INFO : Inserting sp|P55854|SUMO3_HUMAN
15 Dec 2023 01:03:52,967 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:52,967 INFO : Inserting sp|P55884|EIF3B_HUMAN
15 Dec 2023 01:03:53,070 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:53,070 INFO : Inserting sp|P55899|FCGRN_HUMAN
15 Dec 2023 01:03:53,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:53,103 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 01:03:53,124 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:53,124 INFO : Inserting sp|P56134|ATPK_HUMAN
15 Dec 2023 01:03:53,137 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:53,138 INFO : Inserting sp|P56556|NDUA6_HUMAN
15 Dec 2023 01:03:53,180 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:53,180 INFO : Imported 1000 peptide groups.
15 Dec 2023 01:03:53,180 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:03:53,424 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:53,424 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 01:03:53,566 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:53,566 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 01:03:53,760 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:53,760 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:03:54,004 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:54,004 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:03:54,059 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:54,059 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:03:54,118 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:54,119 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 01:03:54,403 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:54,403 INFO : Inserting sp|P60033|CD81_HUMAN
15 Dec 2023 01:03:54,515 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:54,515 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:03:54,860 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:03:54,860 INFO : Inserting sp|P60201|MYPR_HUMAN
15 Dec 2023 01:03:54,890 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:54,891 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:03:54,979 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:54,979 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:03:55,455 INFO : 66% Done
15 Dec 2023 01:03:55,642 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:03:55,642 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 01:03:55,788 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:55,788 INFO : Inserting sp|P60891|PRPS1_HUMAN
15 Dec 2023 01:03:55,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:55,800 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 01:03:55,915 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:55,915 INFO : Inserting sp|P60953|CDC42_HUMAN
15 Dec 2023 01:03:55,955 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:55,956 INFO : Inserting sp|P61006|RAB8A_HUMAN
15 Dec 2023 01:03:56,019 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:56,019 INFO : Inserting sp|P61018|RAB4B_HUMAN
15 Dec 2023 01:03:56,091 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:56,091 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 01:03:56,165 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:56,165 INFO : Inserting sp|P61020|RAB5B_HUMAN
15 Dec 2023 01:03:56,259 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:56,259 INFO : Inserting sp|P61026|RAB10_HUMAN
15 Dec 2023 01:03:56,339 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:56,339 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 01:03:56,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:56,375 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 01:03:56,413 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:56,413 INFO : Inserting sp|P61106|RAB14_HUMAN
15 Dec 2023 01:03:56,498 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:56,498 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:03:56,793 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:03:56,793 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:03:57,040 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:03:57,040 INFO : Inserting sp|P61163|ACTZ_HUMAN
15 Dec 2023 01:03:57,053 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:57,053 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 01:03:57,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:57,081 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 01:03:57,274 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:57,274 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 01:03:57,348 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:57,348 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 01:03:57,365 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:57,365 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 01:03:57,513 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:57,513 INFO : Inserting sp|P61604|CH10_HUMAN
15 Dec 2023 01:03:57,606 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:03:57,606 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:03:57,757 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:57,757 INFO : Inserting sp|P61758|PFD3_HUMAN
15 Dec 2023 01:03:57,782 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:57,782 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:03:57,828 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:57,828 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:03:58,015 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:03:58,015 INFO : Inserting sp|P61812|TGFB2_HUMAN
15 Dec 2023 01:03:58,077 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:58,077 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:03:58,206 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:03:58,206 INFO : Inserting sp|P61956|SUMO2_HUMAN
15 Dec 2023 01:03:58,217 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:58,217 INFO : Inserting sp|P61960|UFM1_HUMAN
15 Dec 2023 01:03:58,240 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:58,240 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 01:03:58,258 INFO : 67% Done
15 Dec 2023 01:03:58,427 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:03:58,428 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 01:03:58,577 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:03:58,577 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:03:58,777 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:03:58,777 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:03:59,032 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:03:59,032 INFO : Inserting sp|P62241|RS8_HUMAN
15 Dec 2023 01:03:59,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:59,052 INFO : Inserting sp|P62249|RS16_HUMAN
15 Dec 2023 01:03:59,095 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:59,095 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 01:03:59,381 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:03:59,381 INFO : Inserting sp|P62269|RS18_HUMAN
15 Dec 2023 01:03:59,400 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:59,400 INFO : Inserting sp|P62304|RUXE_HUMAN
15 Dec 2023 01:03:59,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:59,415 INFO : Inserting sp|P62330|ARF6_HUMAN
15 Dec 2023 01:03:59,446 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:59,447 INFO : Inserting sp|P62333|PRS10_HUMAN
15 Dec 2023 01:03:59,493 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:59,493 INFO : Inserting sp|P62491|RB11A_HUMAN
15 Dec 2023 01:03:59,547 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:59,547 INFO : Inserting sp|P62495|ERF1_HUMAN
15 Dec 2023 01:03:59,585 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:03:59,585 INFO : Inserting sp|P62701|RS4X_HUMAN
15 Dec 2023 01:03:59,602 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:03:59,602 INFO : Inserting sp|P62714|PP2AB_HUMAN
15 Dec 2023 01:03:59,648 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:03:59,648 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:03:59,930 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:03:59,930 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:04:00,253 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:04:00,253 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:04:00,537 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:00,537 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:04:00,806 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:00,806 INFO : Inserting sp|P62834|RAP1A_HUMAN
15 Dec 2023 01:04:00,884 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:00,884 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 01:04:00,912 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:00,912 INFO : Inserting sp|P62873|GBB1_HUMAN
15 Dec 2023 01:04:01,068 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:01,068 INFO : Inserting sp|P62879|GBB2_HUMAN
15 Dec 2023 01:04:01,118 INFO : 68% Done
15 Dec 2023 01:04:01,216 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:01,216 INFO : Inserting sp|P62888|RL30_HUMAN
15 Dec 2023 01:04:01,287 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:01,288 INFO : Inserting sp|P62906|RL10A_HUMAN
15 Dec 2023 01:04:01,340 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:01,340 INFO : Inserting sp|P62913|RL11_HUMAN
15 Dec 2023 01:04:01,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:01,367 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 01:04:01,548 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:01,548 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 01:04:01,741 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:01,741 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 01:04:01,941 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:01,941 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 01:04:01,969 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:01,969 INFO : Inserting sp|P62995|TRA2B_HUMAN
15 Dec 2023 01:04:01,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:01,982 INFO : Inserting sp|P63000|RAC1_HUMAN
15 Dec 2023 01:04:02,106 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:02,106 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 01:04:02,249 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:02,249 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 01:04:02,335 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:02,335 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:04:02,644 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:04:02,644 INFO : Inserting sp|P63151|2ABA_HUMAN
15 Dec 2023 01:04:02,670 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:02,670 INFO : Inserting sp|P63167|DYL1_HUMAN
15 Dec 2023 01:04:02,701 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:02,701 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 01:04:02,862 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:02,862 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 01:04:03,053 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:03,053 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 01:04:03,784 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:04:03,784 INFO : Inserting sp|P63267|ACTH_HUMAN
15 Dec 2023 01:04:03,991 INFO : 69% Done
15 Dec 2023 01:04:04,057 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:04:04,057 INFO : Inserting sp|P63279|UBC9_HUMAN
15 Dec 2023 01:04:04,149 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:04,149 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 01:04:04,195 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:04,195 INFO : Inserting sp|P67812|SC11A_HUMAN
15 Dec 2023 01:04:04,227 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:04,227 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 01:04:04,535 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:04:04,535 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 01:04:04,608 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:04,608 INFO : Inserting sp|P68104|EF1A1_HUMAN
15 Dec 2023 01:04:04,858 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:04:04,858 INFO : Inserting sp|P68133|ACTS_HUMAN
15 Dec 2023 01:04:05,140 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:04:05,140 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:04:05,310 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:05,310 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 01:04:05,485 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:05,485 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 01:04:05,718 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:04:05,718 INFO : Inserting sp|P68400|CSK21_HUMAN
15 Dec 2023 01:04:05,800 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:05,800 INFO : Inserting sp|P68402|PA1B2_HUMAN
15 Dec 2023 01:04:05,836 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:05,836 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 01:04:05,940 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:05,940 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:04:06,445 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:04:06,445 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:04:06,512 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:06,512 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:04:06,565 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:06,566 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:04:06,773 INFO : 70% Done
15 Dec 2023 01:04:07,055 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:07,055 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 01:04:07,075 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:07,075 INFO : Imported 1100 peptide groups.
15 Dec 2023 01:04:07,076 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 01:04:07,283 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:07,283 INFO : Inserting sp|P78380|OLR1_HUMAN
15 Dec 2023 01:04:07,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:07,313 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 01:04:07,519 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:04:07,520 INFO : Inserting sp|P78509|RELN_HUMAN
15 Dec 2023 01:04:07,853 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:04:07,853 INFO : Inserting sp|P78527|PRKDC_HUMAN
15 Dec 2023 01:04:08,258 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:08,259 INFO : Inserting sp|P78536|ADA17_HUMAN
15 Dec 2023 01:04:08,312 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:08,313 INFO : Inserting sp|P78559|MAP1A_HUMAN
15 Dec 2023 01:04:08,395 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:08,395 INFO : Inserting sp|P79483|DRB3_HUMAN
15 Dec 2023 01:04:08,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:08,480 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 01:04:08,864 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:08,864 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:04:09,259 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:04:09,260 INFO : Inserting sp|P80217|IN35_HUMAN
15 Dec 2023 01:04:09,419 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:09,419 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 01:04:09,448 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:09,448 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:04:09,537 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:09,537 INFO : Inserting sp|P81172|HEPC_HUMAN
15 Dec 2023 01:04:09,559 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:09,559 INFO : Inserting sp|P83916|CBX1_HUMAN
15 Dec 2023 01:04:09,626 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:09,626 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 01:04:09,829 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:09,829 INFO : Inserting sp|P84095|RHOG_HUMAN
15 Dec 2023 01:04:09,863 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:09,864 INFO : Inserting sp|P84103|SRSF3_HUMAN
15 Dec 2023 01:04:09,884 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:09,884 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 01:04:09,942 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:09,942 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:04:09,987 INFO : 71% Done
15 Dec 2023 01:04:10,028 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:10,028 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:04:11,080 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:04:11,080 INFO : Inserting sp|P98171|RHG04_HUMAN
15 Dec 2023 01:04:11,185 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:11,185 INFO : Inserting sp|P98172|EFNB1_HUMAN
15 Dec 2023 01:04:11,317 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:11,317 INFO : Inserting sp|P99999|CYC_HUMAN
15 Dec 2023 01:04:11,380 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:11,380 INFO : Inserting sp|Q00587|BORG5_HUMAN
15 Dec 2023 01:04:11,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:11,408 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 01:04:12,118 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:04:12,118 INFO : Inserting sp|Q00688|FKBP3_HUMAN
15 Dec 2023 01:04:12,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:12,149 INFO : Inserting sp|Q00722|PLCB2_HUMAN
15 Dec 2023 01:04:12,278 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:12,278 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 01:04:12,342 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:12,342 INFO : Inserting sp|Q01081|U2AF1_HUMAN
15 Dec 2023 01:04:12,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:12,364 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:04:12,641 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:04:12,641 INFO : Inserting sp|Q01432|AMPD3_HUMAN
15 Dec 2023 01:04:12,708 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:12,708 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 01:04:12,763 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:12,763 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:04:12,943 INFO : 72% Done
15 Dec 2023 01:04:13,126 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:04:13,126 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 01:04:13,713 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:04:13,713 INFO : Inserting sp|Q02388|CO7A1_HUMAN
15 Dec 2023 01:04:13,805 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:13,805 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 01:04:14,026 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:14,026 INFO : Inserting sp|Q02750|MP2K1_HUMAN
15 Dec 2023 01:04:14,082 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:14,083 INFO : Inserting sp|Q02790|FKBP4_HUMAN
15 Dec 2023 01:04:14,147 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:14,147 INFO : Inserting sp|Q02809|PLOD1_HUMAN
15 Dec 2023 01:04:14,462 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:04:14,462 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 01:04:14,680 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:14,680 INFO : Inserting sp|Q02878|RL6_HUMAN
15 Dec 2023 01:04:14,708 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:14,708 INFO : Inserting sp|Q02880|TOP2B_HUMAN
15 Dec 2023 01:04:14,750 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:14,751 INFO : Inserting sp|Q03001|DYST_HUMAN
15 Dec 2023 01:04:14,813 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:14,814 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:04:14,947 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:14,947 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:04:15,167 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:15,167 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:04:15,350 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:15,350 INFO : Inserting sp|Q04721|NOTC2_HUMAN
15 Dec 2023 01:04:15,418 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:15,418 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 01:04:15,501 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:15,501 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 01:04:15,581 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:15,581 INFO : Inserting sp|Q04912|RON_HUMAN
15 Dec 2023 01:04:15,612 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:15,612 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 01:04:15,735 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:15,735 INFO : Inserting sp|Q05315|LEG10_HUMAN
15 Dec 2023 01:04:15,769 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:15,769 INFO : Inserting sp|Q05655|KPCD_HUMAN
15 Dec 2023 01:04:15,850 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:15,850 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:04:15,905 INFO : 73% Done
15 Dec 2023 01:04:16,176 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:04:16,177 INFO : Inserting sp|Q06124|PTN11_HUMAN
15 Dec 2023 01:04:16,213 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:16,213 INFO : Inserting sp|Q06141|REG3A_HUMAN
15 Dec 2023 01:04:16,249 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:16,249 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:04:16,495 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:16,495 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 01:04:16,555 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:16,555 INFO : Inserting sp|Q06828|FMOD_HUMAN
15 Dec 2023 01:04:16,765 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:16,765 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 01:04:16,856 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:16,856 INFO : Inserting sp|Q07666|KHDR1_HUMAN
15 Dec 2023 01:04:16,907 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:16,907 INFO : Inserting sp|Q07812|BAX_HUMAN
15 Dec 2023 01:04:16,941 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:16,941 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 01:04:17,265 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:04:17,265 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 01:04:17,293 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:17,293 INFO : Inserting sp|Q07960|RHG01_HUMAN
15 Dec 2023 01:04:17,474 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:17,474 INFO : Inserting sp|Q08043|ACTN3_HUMAN
15 Dec 2023 01:04:17,632 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:17,632 INFO : Inserting sp|Q08174|PCDH1_HUMAN
15 Dec 2023 01:04:17,661 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:17,661 INFO : Inserting sp|Q08209|PP2BA_HUMAN
15 Dec 2023 01:04:17,767 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:17,767 INFO : Inserting sp|Q08211|DHX9_HUMAN
15 Dec 2023 01:04:17,833 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:17,833 INFO : Inserting sp|Q08257|QOR_HUMAN
15 Dec 2023 01:04:17,855 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:17,855 INFO : Inserting sp|Q08345|DDR1_HUMAN
15 Dec 2023 01:04:17,925 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:17,925 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:04:18,448 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:04:18,449 INFO : Inserting sp|Q08431|MFGM_HUMAN
15 Dec 2023 01:04:18,484 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:18,484 INFO : Inserting sp|Q08477|CP4F3_HUMAN
15 Dec 2023 01:04:18,533 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:18,533 INFO : Inserting sp|Q08554|DSC1_HUMAN
15 Dec 2023 01:04:18,552 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:18,552 INFO : Inserting sp|Q08623|HDHD1_HUMAN
15 Dec 2023 01:04:18,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:18,572 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 01:04:18,695 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:18,695 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:04:18,846 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:18,846 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 01:04:18,877 INFO : 74% Done
15 Dec 2023 01:04:19,047 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:19,047 INFO : Inserting sp|Q09328|MGT5A_HUMAN
15 Dec 2023 01:04:19,086 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:19,086 INFO : Inserting sp|Q0VD83|APOBR_HUMAN
15 Dec 2023 01:04:19,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:19,104 INFO : Inserting sp|Q0VGL1|LTOR4_HUMAN
15 Dec 2023 01:04:19,143 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:19,143 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 01:04:19,332 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:04:19,332 INFO : Inserting sp|Q10567|AP1B1_HUMAN
15 Dec 2023 01:04:19,484 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:19,485 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 01:04:19,724 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:04:19,724 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 01:04:19,738 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:19,738 INFO : Inserting sp|Q12794|HYAL1_HUMAN
15 Dec 2023 01:04:19,798 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:19,798 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:04:20,134 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:04:20,134 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:04:20,276 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:20,276 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 01:04:20,782 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:04:20,782 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 01:04:20,827 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:20,828 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 01:04:20,913 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:20,913 INFO : Inserting sp|Q12905|ILF2_HUMAN
15 Dec 2023 01:04:21,045 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:21,045 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 01:04:21,113 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:21,113 INFO : Inserting sp|Q12907|LMAN2_HUMAN
15 Dec 2023 01:04:21,508 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:04:21,508 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 01:04:21,550 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:21,550 INFO : Inserting sp|Q12931|TRAP1_HUMAN
15 Dec 2023 01:04:21,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:21,572 INFO : Inserting sp|Q13011|ECH1_HUMAN
15 Dec 2023 01:04:21,620 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:21,620 INFO : Inserting sp|Q13043|STK4_HUMAN
15 Dec 2023 01:04:21,707 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:21,707 INFO : Imported 1200 peptide groups.
15 Dec 2023 01:04:21,707 INFO : Inserting sp|Q13045|FLII_HUMAN
15 Dec 2023 01:04:21,970 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:21,970 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 01:04:22,016 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:22,016 INFO : Inserting sp|Q13098|CSN1_HUMAN
15 Dec 2023 01:04:22,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,040 INFO : Inserting sp|Q13099|IFT88_HUMAN
15 Dec 2023 01:04:22,061 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,062 INFO : Inserting sp|Q13126|MTAP_HUMAN
15 Dec 2023 01:04:22,131 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:22,131 INFO : Inserting sp|Q13148|TADBP_HUMAN
15 Dec 2023 01:04:22,164 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,164 INFO : Inserting sp|Q13151|ROA0_HUMAN
15 Dec 2023 01:04:22,202 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,202 INFO : Inserting sp|Q13153|PAK1_HUMAN
15 Dec 2023 01:04:22,278 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:22,278 INFO : Inserting sp|Q13177|PAK2_HUMAN
15 Dec 2023 01:04:22,391 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:22,391 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 01:04:22,457 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:22,457 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 01:04:22,487 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,487 INFO : Inserting sp|Q13214|SEM3B_HUMAN
15 Dec 2023 01:04:22,516 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:22,516 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 01:04:22,595 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:22,595 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 01:04:22,801 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:22,802 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:04:23,163 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:23,163 INFO : Inserting sp|Q13247|SRSF6_HUMAN
15 Dec 2023 01:04:23,191 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:23,192 INFO : Inserting sp|Q13283|G3BP1_HUMAN
15 Dec 2023 01:04:23,237 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:23,237 INFO : Inserting sp|Q13303|KCAB2_HUMAN
15 Dec 2023 01:04:23,360 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:23,360 INFO : Inserting sp|Q13308|PTK7_HUMAN
15 Dec 2023 01:04:23,441 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:23,442 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 01:04:23,616 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:23,616 INFO : Inserting sp|Q13347|EIF3I_HUMAN
15 Dec 2023 01:04:23,673 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:23,673 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 01:04:23,705 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:23,705 INFO : Inserting sp|Q13409|DC1I2_HUMAN
15 Dec 2023 01:04:23,746 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:23,746 INFO : Inserting sp|Q13421|MSLN_HUMAN
15 Dec 2023 01:04:23,804 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:23,804 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 01:04:23,904 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:23,904 INFO : Inserting sp|Q13451|FKBP5_HUMAN
15 Dec 2023 01:04:23,920 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:23,920 INFO : Inserting sp|Q13488|VPP3_HUMAN
15 Dec 2023 01:04:23,968 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:23,968 INFO : Inserting sp|Q13492|PICAL_HUMAN
15 Dec 2023 01:04:24,125 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:24,125 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 01:04:24,183 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:24,183 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:04:24,321 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:24,321 INFO : Inserting sp|Q13547|HDAC1_HUMAN
15 Dec 2023 01:04:24,368 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,368 INFO : Inserting sp|Q13564|ULA1_HUMAN
15 Dec 2023 01:04:24,421 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:24,421 INFO : Inserting sp|Q13576|IQGA2_HUMAN
15 Dec 2023 01:04:24,490 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:24,490 INFO : Inserting sp|Q13616|CUL1_HUMAN
15 Dec 2023 01:04:24,535 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,535 INFO : Inserting sp|Q13618|CUL3_HUMAN
15 Dec 2023 01:04:24,556 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,557 INFO : Inserting sp|Q13636|RAB31_HUMAN
15 Dec 2023 01:04:24,610 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:24,610 INFO : Inserting sp|Q13637|RAB32_HUMAN
15 Dec 2023 01:04:24,623 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,623 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:04:24,883 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:24,883 INFO : Inserting sp|Q13765|NACA_HUMAN
15 Dec 2023 01:04:24,903 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,903 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 01:04:24,938 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:24,939 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 01:04:25,012 INFO : 75% Done
15 Dec 2023 01:04:25,187 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:25,187 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:04:26,123 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:04:26,123 INFO : Inserting sp|Q13838|DX39B_HUMAN
15 Dec 2023 01:04:26,237 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:26,237 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 01:04:26,392 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:26,392 INFO : Inserting sp|Q13885|TBB2A_HUMAN
15 Dec 2023 01:04:26,535 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:04:26,535 INFO : Inserting sp|Q14005|IL16_HUMAN
15 Dec 2023 01:04:26,597 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:26,597 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:04:26,626 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:26,626 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:04:26,739 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:26,740 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 01:04:27,056 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:04:27,056 INFO : Inserting sp|Q14118|DAG1_HUMAN
15 Dec 2023 01:04:27,381 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:27,381 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 01:04:27,400 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:27,400 INFO : Inserting sp|Q14141|SEPT6_HUMAN
15 Dec 2023 01:04:27,512 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:27,513 INFO : Inserting sp|Q14152|EIF3A_HUMAN
15 Dec 2023 01:04:27,601 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:27,602 INFO : Inserting sp|Q14155|ARHG7_HUMAN
15 Dec 2023 01:04:27,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:27,620 INFO : Inserting sp|Q14165|MLEC_HUMAN
15 Dec 2023 01:04:27,663 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:27,663 INFO : Inserting sp|Q14166|TTL12_HUMAN
15 Dec 2023 01:04:27,697 INFO : 76% Done
15 Dec 2023 01:04:27,775 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:27,775 INFO : Inserting sp|Q14194|DPYL1_HUMAN
15 Dec 2023 01:04:27,810 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:27,810 INFO : Inserting sp|Q14204|DYHC1_HUMAN
15 Dec 2023 01:04:28,010 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:28,010 INFO : Inserting sp|Q14213|IL27B_HUMAN
15 Dec 2023 01:04:28,060 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:28,061 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 01:04:28,200 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:28,200 INFO : Inserting sp|Q14258|TRI25_HUMAN
15 Dec 2023 01:04:28,277 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:28,277 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 01:04:28,325 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:28,325 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:04:28,404 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:28,404 INFO : Inserting sp|Q14331|FRG1_HUMAN
15 Dec 2023 01:04:28,431 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:28,431 INFO : Inserting sp|Q14344|GNA13_HUMAN
15 Dec 2023 01:04:28,483 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:28,483 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 01:04:28,644 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:28,644 INFO : Inserting sp|Q14444|CAPR1_HUMAN
15 Dec 2023 01:04:28,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:28,689 INFO : Inserting sp|Q14508|WFDC2_HUMAN
15 Dec 2023 01:04:28,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:28,736 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:04:29,376 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:04:29,377 INFO : Inserting sp|Q14517|FAT1_HUMAN
15 Dec 2023 01:04:29,440 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:29,440 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:04:29,571 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:29,571 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:04:30,646 INFO : 77% Done
15 Dec 2023 01:04:30,853 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:04:30,853 INFO : Inserting sp|Q14651|PLSI_HUMAN
15 Dec 2023 01:04:30,958 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:30,959 INFO : Inserting sp|Q14678|KANK1_HUMAN
15 Dec 2023 01:04:30,990 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:30,990 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:04:31,288 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:31,288 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 01:04:31,592 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:31,592 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 01:04:31,614 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:31,614 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 01:04:31,687 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:31,687 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:04:31,777 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:31,778 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:04:31,919 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:31,919 INFO : Inserting sp|Q14980|NUMA1_HUMAN
15 Dec 2023 01:04:31,997 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:31,997 INFO : Inserting sp|Q14982|OPCM_HUMAN
15 Dec 2023 01:04:32,081 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:32,081 INFO : Inserting sp|Q15008|PSMD6_HUMAN
15 Dec 2023 01:04:32,195 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:32,195 INFO : Inserting sp|Q15019|SEPT2_HUMAN
15 Dec 2023 01:04:32,254 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:32,254 INFO : Inserting sp|Q15027|ACAP1_HUMAN
15 Dec 2023 01:04:32,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:32,313 INFO : Inserting sp|Q15046|SYK_HUMAN
15 Dec 2023 01:04:32,369 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:32,369 INFO : Inserting sp|Q15051|IQCB1_HUMAN
15 Dec 2023 01:04:32,400 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:32,400 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 01:04:32,416 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:32,417 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 01:04:32,560 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:32,561 INFO : Inserting sp|Q15067|ACOX1_HUMAN
15 Dec 2023 01:04:32,631 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:32,631 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 01:04:32,715 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:32,715 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 01:04:32,817 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:32,818 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:04:33,262 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:33,262 INFO : Inserting sp|Q15121|PEA15_HUMAN
15 Dec 2023 01:04:33,369 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:33,370 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 01:04:33,609 INFO : 78% Done
15 Dec 2023 01:04:33,783 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:04:33,783 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 01:04:33,811 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:33,811 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 01:04:33,877 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:33,877 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 01:04:34,024 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:34,024 INFO : Inserting sp|Q15262|PTPRK_HUMAN
15 Dec 2023 01:04:34,042 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,042 INFO : Inserting sp|Q15286|RAB35_HUMAN
15 Dec 2023 01:04:34,083 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:34,083 INFO : Imported 1300 peptide groups.
15 Dec 2023 01:04:34,083 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 01:04:34,124 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:34,124 INFO : Inserting sp|Q15366|PCBP2_HUMAN
15 Dec 2023 01:04:34,166 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:34,166 INFO : Inserting sp|Q15369|ELOC_HUMAN
15 Dec 2023 01:04:34,178 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,178 INFO : Inserting sp|Q15370|ELOB_HUMAN
15 Dec 2023 01:04:34,210 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,210 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 01:04:34,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,225 INFO : Inserting sp|Q15393|SF3B3_HUMAN
15 Dec 2023 01:04:34,345 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:34,345 INFO : Inserting sp|Q15428|SF3A2_HUMAN
15 Dec 2023 01:04:34,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,374 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 01:04:34,531 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:34,531 INFO : Inserting sp|Q15436|SC23A_HUMAN
15 Dec 2023 01:04:34,586 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:34,586 INFO : Inserting sp|Q15459|SF3A1_HUMAN
15 Dec 2023 01:04:34,607 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,607 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 01:04:34,647 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,647 INFO : Inserting sp|Q15555|MARE2_HUMAN
15 Dec 2023 01:04:34,667 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:34,668 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:04:35,231 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:04:35,231 INFO : Inserting sp|Q15637|SF01_HUMAN
15 Dec 2023 01:04:35,288 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:35,288 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 01:04:35,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:35,302 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:04:35,750 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:04:35,751 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 01:04:36,011 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:36,011 INFO : Inserting sp|Q15819|UB2V2_HUMAN
15 Dec 2023 01:04:36,039 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:36,039 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 01:04:36,112 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:36,112 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:04:36,432 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:36,432 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 01:04:36,497 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:36,497 INFO : Inserting sp|Q15904|VAS1_HUMAN
15 Dec 2023 01:04:36,584 INFO : 79% Done
15 Dec 2023 01:04:36,721 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:36,721 INFO : Inserting sp|Q15907|RB11B_HUMAN
15 Dec 2023 01:04:36,790 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:36,790 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 01:04:36,839 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:36,839 INFO : Inserting sp|Q16143|SYUB_HUMAN
15 Dec 2023 01:04:36,866 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:36,866 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 01:04:36,967 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:36,967 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:04:37,280 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:37,281 INFO : Inserting sp|Q16288|NTRK3_HUMAN
15 Dec 2023 01:04:37,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:37,302 INFO : Inserting sp|Q16363|LAMA4_HUMAN
15 Dec 2023 01:04:37,398 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:37,399 INFO : Inserting sp|Q16394|EXT1_HUMAN
15 Dec 2023 01:04:37,421 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:37,421 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 01:04:37,489 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:37,489 INFO : Inserting sp|Q16512|PKN1_HUMAN
15 Dec 2023 01:04:37,521 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:37,521 INFO : Inserting sp|Q16531|DDB1_HUMAN
15 Dec 2023 01:04:37,862 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:04:37,862 INFO : Inserting sp|Q16539|MK14_HUMAN
15 Dec 2023 01:04:37,922 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:37,922 INFO : Inserting sp|Q16555|DPYL2_HUMAN
15 Dec 2023 01:04:38,077 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:38,077 INFO : Inserting sp|Q16576|RBBP7_HUMAN
15 Dec 2023 01:04:38,210 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:38,210 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 01:04:38,550 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:38,550 INFO : Inserting sp|Q16620|NTRK2_HUMAN
15 Dec 2023 01:04:38,583 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:38,583 INFO : Inserting sp|Q16627|CCL14_HUMAN
15 Dec 2023 01:04:38,595 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:38,595 INFO : Inserting sp|Q16629|SRSF7_HUMAN
15 Dec 2023 01:04:38,612 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:38,612 INFO : Inserting sp|Q16644|MAPK3_HUMAN
15 Dec 2023 01:04:38,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:38,648 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 01:04:38,685 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:38,685 INFO : Inserting sp|Q16658|FSCN1_HUMAN
15 Dec 2023 01:04:38,746 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:38,746 INFO : Inserting sp|Q16666|IF16_HUMAN
15 Dec 2023 01:04:38,838 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:38,838 INFO : Inserting sp|Q16674|MIA_HUMAN
15 Dec 2023 01:04:38,878 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:38,879 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 01:04:39,315 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:04:39,315 INFO : Inserting sp|Q16719|KYNU_HUMAN
15 Dec 2023 01:04:39,429 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:39,429 INFO : Inserting sp|Q16769|QPCT_HUMAN
15 Dec 2023 01:04:39,561 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:39,561 INFO : Inserting sp|Q16774|KGUA_HUMAN
15 Dec 2023 01:04:39,596 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:39,596 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 01:04:39,704 INFO : 80% Done
15 Dec 2023 01:04:39,756 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:39,756 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:04:39,914 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:39,914 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:04:40,181 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:40,181 INFO : Inserting sp|Q16836|HCDH_HUMAN
15 Dec 2023 01:04:40,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:40,228 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:04:40,423 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:40,423 INFO : Inserting sp|Q16853|AOC3_HUMAN
15 Dec 2023 01:04:40,442 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:40,442 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 01:04:40,757 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:40,757 INFO : Inserting sp|Q24JP5|T132A_HUMAN
15 Dec 2023 01:04:40,841 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:40,842 INFO : Inserting sp|Q2M389|WASC4_HUMAN
15 Dec 2023 01:04:40,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:40,865 INFO : Inserting sp|Q2TAY7|SMU1_HUMAN
15 Dec 2023 01:04:40,916 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:40,916 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 01:04:41,113 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:41,113 INFO : Inserting sp|Q3V6T2|GRDN_HUMAN
15 Dec 2023 01:04:41,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,130 INFO : Inserting sp|Q496F6|CLM2_HUMAN
15 Dec 2023 01:04:41,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,150 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:04:41,261 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:41,262 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:04:41,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,281 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 01:04:41,390 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:41,390 INFO : Inserting sp|Q53FA7|QORX_HUMAN
15 Dec 2023 01:04:41,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:41,441 INFO : Inserting sp|Q53GQ0|DHB12_HUMAN
15 Dec 2023 01:04:41,496 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:41,496 INFO : Inserting sp|Q53GS9|SNUT2_HUMAN
15 Dec 2023 01:04:41,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,525 INFO : Inserting sp|Q5JRA6|TGO1_HUMAN
15 Dec 2023 01:04:41,536 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,536 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 01:04:41,621 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:41,621 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 01:04:41,637 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,637 INFO : Inserting sp|Q5QGZ9|CL12A_HUMAN
15 Dec 2023 01:04:41,659 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:41,659 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:04:41,895 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:41,895 INFO : Inserting sp|Q5T1M5|FKB15_HUMAN
15 Dec 2023 01:04:41,942 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:41,942 INFO : Inserting sp|Q5TEJ8|THMS2_HUMAN
15 Dec 2023 01:04:41,999 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:41,999 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:04:42,045 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:42,046 INFO : Inserting sp|Q5VWZ2|LYPL1_HUMAN
15 Dec 2023 01:04:42,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,075 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 01:04:42,111 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:42,111 INFO : Inserting sp|Q68E01|INT3_HUMAN
15 Dec 2023 01:04:42,140 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,140 INFO : Inserting sp|Q6DD88|ATLA3_HUMAN
15 Dec 2023 01:04:42,177 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,177 INFO : Inserting sp|Q6EEV6|SUMO4_HUMAN
15 Dec 2023 01:04:42,189 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,189 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:04:42,285 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:42,285 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:04:42,386 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:42,386 INFO : Inserting sp|Q6IA69|NADE_HUMAN
15 Dec 2023 01:04:42,447 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:42,447 INFO : Inserting sp|Q6IAA8|LTOR1_HUMAN
15 Dec 2023 01:04:42,520 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:42,520 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 01:04:42,702 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:42,702 INFO : Inserting sp|Q6ICL3|TNG2_HUMAN
15 Dec 2023 01:04:42,780 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:42,780 INFO : Inserting sp|Q6NW40|RGMB_HUMAN
15 Dec 2023 01:04:42,871 INFO : 81% Done
15 Dec 2023 01:04:42,902 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:42,902 INFO : Inserting sp|Q6NXG1|ESRP1_HUMAN
15 Dec 2023 01:04:42,922 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,922 INFO : Inserting sp|Q6NZY4|ZCHC8_HUMAN
15 Dec 2023 01:04:42,950 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:42,951 INFO : Inserting sp|Q6P4A8|PLBL1_HUMAN
15 Dec 2023 01:04:43,082 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:43,082 INFO : Inserting sp|Q6P9A2|GLT18_HUMAN
15 Dec 2023 01:04:43,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:43,106 INFO : Inserting sp|Q6PCB0|VWA1_HUMAN
15 Dec 2023 01:04:43,224 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:43,225 INFO : Inserting sp|Q6PCE3|PGM2L_HUMAN
15 Dec 2023 01:04:43,250 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:43,250 INFO : Inserting sp|Q6UWE0|LRSM1_HUMAN
15 Dec 2023 01:04:43,289 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:43,289 INFO : Inserting sp|Q6UWY2|PRS57_HUMAN
15 Dec 2023 01:04:43,331 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:43,331 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:04:43,638 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:43,639 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 01:04:43,698 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:43,698 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 01:04:43,831 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:43,831 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 01:04:43,895 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:43,895 INFO : Imported 1400 peptide groups.
15 Dec 2023 01:04:43,895 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:04:44,212 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:44,212 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:04:44,422 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:44,422 INFO : Inserting sp|Q6ZMI3|GLDN_HUMAN
15 Dec 2023 01:04:44,456 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:44,456 INFO : Inserting sp|Q6ZRP7|QSOX2_HUMAN
15 Dec 2023 01:04:44,514 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:44,515 INFO : Inserting sp|Q6ZT62|BGIN_HUMAN
15 Dec 2023 01:04:44,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:44,551 INFO : Inserting sp|Q70J99|UN13D_HUMAN
15 Dec 2023 01:04:44,635 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:44,635 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 01:04:44,798 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:44,799 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 01:04:44,821 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:44,821 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 01:04:44,916 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:44,916 INFO : Inserting sp|Q7L1Q6|5MP2_HUMAN
15 Dec 2023 01:04:44,945 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:44,945 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 01:04:44,977 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:44,977 INFO : Inserting sp|Q7L576|CYFP1_HUMAN
15 Dec 2023 01:04:45,053 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:45,053 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 01:04:45,147 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:45,147 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 01:04:45,195 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:45,195 INFO : Inserting sp|Q7Z406|MYH14_HUMAN
15 Dec 2023 01:04:45,280 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:45,280 INFO : Inserting sp|Q7Z5R6|AB1IP_HUMAN
15 Dec 2023 01:04:45,328 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:45,328 INFO : Inserting sp|Q7Z6K1|THAP5_HUMAN
15 Dec 2023 01:04:45,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:45,356 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 01:04:45,395 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:45,396 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 01:04:45,481 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:45,482 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 01:04:45,760 INFO : 82% Done
15 Dec 2023 01:04:45,910 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:04:45,910 INFO : Inserting sp|Q86SE5|RALYL_HUMAN
15 Dec 2023 01:04:45,927 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:45,927 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 01:04:46,020 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:46,020 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 01:04:46,072 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:46,072 INFO : Inserting sp|Q86TH1|ATL2_HUMAN
15 Dec 2023 01:04:46,093 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:46,093 INFO : Inserting sp|Q86UW6|N4BP2_HUMAN
15 Dec 2023 01:04:46,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:46,104 INFO : Inserting sp|Q86UX2|ITIH5_HUMAN
15 Dec 2023 01:04:46,285 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:46,285 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:04:46,556 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:04:46,556 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:04:47,210 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:04:47,210 INFO : Inserting sp|Q86VI3|IQGA3_HUMAN
15 Dec 2023 01:04:47,262 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:47,262 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 01:04:47,512 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:47,512 INFO : Inserting sp|Q86YT9|JAML_HUMAN
15 Dec 2023 01:04:47,541 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:47,541 INFO : Inserting sp|Q8IUI8|CRLF3_HUMAN
15 Dec 2023 01:04:47,562 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:47,562 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:04:47,655 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:47,655 INFO : Inserting sp|Q8IWB7|WDFY1_HUMAN
15 Dec 2023 01:04:47,690 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:47,690 INFO : Inserting sp|Q8IWV2|CNTN4_HUMAN
15 Dec 2023 01:04:47,764 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:47,764 INFO : Inserting sp|Q8IWV7|UBR1_HUMAN
15 Dec 2023 01:04:47,781 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:47,781 INFO : Inserting sp|Q8IWY4|SCUB1_HUMAN
15 Dec 2023 01:04:47,798 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:47,798 INFO : Inserting sp|Q8IX12|CCAR1_HUMAN
15 Dec 2023 01:04:47,829 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:47,829 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 01:04:48,000 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:48,000 INFO : Inserting sp|Q8IYD1|ERF3B_HUMAN
15 Dec 2023 01:04:48,023 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,023 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:04:48,092 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,092 INFO : Inserting sp|Q8IYT4|KATL2_HUMAN
15 Dec 2023 01:04:48,124 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,124 INFO : Inserting sp|Q8IZF0|NALCN_HUMAN
15 Dec 2023 01:04:48,135 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,135 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 01:04:48,243 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:48,243 INFO : Inserting sp|Q8N149|LIRA2_HUMAN
15 Dec 2023 01:04:48,293 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,293 INFO : Inserting sp|Q8N1K5|THMS1_HUMAN
15 Dec 2023 01:04:48,311 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,311 INFO : Inserting sp|Q8N386|LRC25_HUMAN
15 Dec 2023 01:04:48,335 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,335 INFO : Inserting sp|Q8N3J6|CADM2_HUMAN
15 Dec 2023 01:04:48,385 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,385 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:04:48,471 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:48,472 INFO : Inserting sp|Q8N6Q3|CD177_HUMAN
15 Dec 2023 01:04:48,476 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,476 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 01:04:48,497 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,497 INFO : Inserting sp|Q8NBS9|TXND5_HUMAN
15 Dec 2023 01:04:48,607 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:48,607 INFO : Inserting sp|Q8NCC3|PAG15_HUMAN
15 Dec 2023 01:04:48,649 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,649 INFO : Inserting sp|Q8NCL4|GALT6_HUMAN
15 Dec 2023 01:04:48,688 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,688 INFO : Inserting sp|Q8NCW5|NNRE_HUMAN
15 Dec 2023 01:04:48,802 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:48,802 INFO : Inserting sp|Q8NES3|LFNG_HUMAN
15 Dec 2023 01:04:48,825 INFO : 83% Done
15 Dec 2023 01:04:48,842 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:48,842 INFO : Inserting sp|Q8NF50|DOCK8_HUMAN
15 Dec 2023 01:04:48,866 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:48,866 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 01:04:48,966 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:48,966 INFO : Inserting sp|Q8NFT8|DNER_HUMAN
15 Dec 2023 01:04:49,001 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,001 INFO : Inserting sp|Q8NFY4|SEM6D_HUMAN
15 Dec 2023 01:04:49,031 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,031 INFO : Inserting sp|Q8NFZ8|CADM4_HUMAN
15 Dec 2023 01:04:49,162 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:49,162 INFO : Inserting sp|Q8NG11|TSN14_HUMAN
15 Dec 2023 01:04:49,198 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,198 INFO : Inserting sp|Q8NHJ6|LIRB4_HUMAN
15 Dec 2023 01:04:49,250 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,250 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 01:04:49,312 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,312 INFO : Inserting sp|Q8TAQ2|SMRC2_HUMAN
15 Dec 2023 01:04:49,378 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,379 INFO : Inserting sp|Q8TCT8|SPP2A_HUMAN
15 Dec 2023 01:04:49,406 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,406 INFO : Inserting sp|Q8TCU6|PREX1_HUMAN
15 Dec 2023 01:04:49,565 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:49,565 INFO : Inserting sp|Q8TD19|NEK9_HUMAN
15 Dec 2023 01:04:49,614 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,614 INFO : Inserting sp|Q8TDP1|RNH2C_HUMAN
15 Dec 2023 01:04:49,664 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,664 INFO : Inserting sp|Q8TDQ0|HAVR2_HUMAN
15 Dec 2023 01:04:49,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,716 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 01:04:49,737 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:49,737 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 01:04:49,790 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:49,790 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 01:04:49,801 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,802 INFO : Inserting sp|Q8WTP8|AEN_HUMAN
15 Dec 2023 01:04:49,839 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,839 INFO : Inserting sp|Q8WU79|SMAP2_HUMAN
15 Dec 2023 01:04:49,864 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:49,864 INFO : Inserting sp|Q8WUJ3|CEMIP_HUMAN
15 Dec 2023 01:04:49,956 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:49,956 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 01:04:50,082 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:50,082 INFO : Inserting sp|Q8WUW1|BRK1_HUMAN
15 Dec 2023 01:04:50,105 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,105 INFO : Inserting sp|Q8WVN6|SCTM1_HUMAN
15 Dec 2023 01:04:50,273 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:50,274 INFO : Inserting sp|Q8WVQ1|CANT1_HUMAN
15 Dec 2023 01:04:50,342 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:50,342 INFO : Inserting sp|Q8WVY7|UBCP1_HUMAN
15 Dec 2023 01:04:50,385 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,385 INFO : Inserting sp|Q8WWX9|SELM_HUMAN
15 Dec 2023 01:04:50,406 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,407 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 01:04:50,558 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:50,558 INFO : Inserting sp|Q8WXI8|CLC4D_HUMAN
15 Dec 2023 01:04:50,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,571 INFO : Inserting sp|Q8WXX5|DNJC9_HUMAN
15 Dec 2023 01:04:50,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,584 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 01:04:50,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,604 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 01:04:50,675 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:50,675 INFO : Inserting sp|Q92484|ASM3A_HUMAN
15 Dec 2023 01:04:50,722 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:50,722 INFO : Inserting sp|Q92485|ASM3B_HUMAN
15 Dec 2023 01:04:50,795 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:50,795 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:04:50,965 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:50,965 INFO : Inserting sp|Q92530|PSMF1_HUMAN
15 Dec 2023 01:04:50,988 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:50,988 INFO : Inserting sp|Q92556|ELMO1_HUMAN
15 Dec 2023 01:04:51,078 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:51,078 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 01:04:51,091 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,091 INFO : Inserting sp|Q92597|NDRG1_HUMAN
15 Dec 2023 01:04:51,111 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,112 INFO : Inserting sp|Q92598|HS105_HUMAN
15 Dec 2023 01:04:51,195 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:51,196 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 01:04:51,326 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:51,326 INFO : Inserting sp|Q92614|MY18A_HUMAN
15 Dec 2023 01:04:51,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,372 INFO : Inserting sp|Q92619|HMHA1_HUMAN
15 Dec 2023 01:04:51,396 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,396 INFO : Inserting sp|Q92626|PXDN_HUMAN
15 Dec 2023 01:04:51,425 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,425 INFO : Inserting sp|Q92673|SORL_HUMAN
15 Dec 2023 01:04:51,638 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:51,638 INFO : Imported 1500 peptide groups.
15 Dec 2023 01:04:51,638 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:04:51,809 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:51,809 INFO : Inserting sp|Q92692|NECT2_HUMAN
15 Dec 2023 01:04:51,850 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:51,850 INFO : Inserting sp|Q92734|TFG_HUMAN
15 Dec 2023 01:04:51,881 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:51,881 INFO : Inserting sp|Q92743|HTRA1_HUMAN
15 Dec 2023 01:04:51,932 INFO : 84% Done
15 Dec 2023 01:04:51,959 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:51,959 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 01:04:52,105 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:52,105 INFO : Inserting sp|Q92769|HDAC2_HUMAN
15 Dec 2023 01:04:52,148 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:52,148 INFO : Inserting sp|Q92777|SYN2_HUMAN
15 Dec 2023 01:04:52,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:52,167 INFO : Inserting sp|Q92804|RBP56_HUMAN
15 Dec 2023 01:04:52,188 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:52,188 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:04:52,328 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:52,328 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:04:53,036 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:04:53,036 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 01:04:53,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:53,132 INFO : Inserting sp|Q92841|DDX17_HUMAN
15 Dec 2023 01:04:53,186 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:53,186 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 01:04:53,240 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:53,241 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 01:04:53,620 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:04:53,621 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:04:53,824 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:53,824 INFO : Inserting sp|Q92882|OSTF1_HUMAN
15 Dec 2023 01:04:54,015 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:54,015 INFO : Inserting sp|Q92888|ARHG1_HUMAN
15 Dec 2023 01:04:54,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:54,056 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 01:04:54,165 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:54,165 INFO : Inserting sp|Q92905|CSN5_HUMAN
15 Dec 2023 01:04:54,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:54,196 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:04:54,278 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:54,278 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 01:04:54,381 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:54,381 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:04:54,614 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:04:54,614 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:04:54,684 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:54,684 INFO : Inserting sp|Q969H8|MYDGF_HUMAN
15 Dec 2023 01:04:54,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:54,705 INFO : Inserting sp|Q969P0|IGSF8_HUMAN
15 Dec 2023 01:04:54,820 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:54,820 INFO : Inserting sp|Q96AE4|FUBP1_HUMAN
15 Dec 2023 01:04:54,833 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:54,833 INFO : Inserting sp|Q96AG4|LRC59_HUMAN
15 Dec 2023 01:04:54,857 INFO : 85% Done
15 Dec 2023 01:04:54,941 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:54,941 INFO : Inserting sp|Q96AP7|ESAM_HUMAN
15 Dec 2023 01:04:54,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:54,981 INFO : Inserting sp|Q96AT9|RPE_HUMAN
15 Dec 2023 01:04:55,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:55,024 INFO : Inserting sp|Q96B97|SH3K1_HUMAN
15 Dec 2023 01:04:55,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:55,039 INFO : Inserting sp|Q96BM9|ARL8A_HUMAN
15 Dec 2023 01:04:55,135 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:55,135 INFO : Inserting sp|Q96BZ4|PLD4_HUMAN
15 Dec 2023 01:04:55,176 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:55,176 INFO : Inserting sp|Q96C23|GALM_HUMAN
15 Dec 2023 01:04:55,209 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:55,209 INFO : Inserting sp|Q96C86|DCPS_HUMAN
15 Dec 2023 01:04:55,298 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:55,298 INFO : Inserting sp|Q96CG8|CTHR1_HUMAN
15 Dec 2023 01:04:55,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:55,344 INFO : Inserting sp|Q96CW1|AP2M1_HUMAN
15 Dec 2023 01:04:55,396 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:55,396 INFO : Inserting sp|Q96D96|HVCN1_HUMAN
15 Dec 2023 01:04:55,407 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:55,407 INFO : Inserting sp|Q96DI7|SNR40_HUMAN
15 Dec 2023 01:04:55,418 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:55,418 INFO : Inserting sp|Q96E17|RAB3C_HUMAN
15 Dec 2023 01:04:55,449 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:55,450 INFO : Inserting sp|Q96EP5|DAZP1_HUMAN
15 Dec 2023 01:04:55,503 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:55,503 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 01:04:55,615 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:04:55,615 INFO : Inserting sp|Q96FJ2|DYL2_HUMAN
15 Dec 2023 01:04:55,643 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:55,643 INFO : Inserting sp|Q96FN4|CPNE2_HUMAN
15 Dec 2023 01:04:55,729 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:55,729 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 01:04:55,897 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:55,897 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 01:04:56,085 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:04:56,085 INFO : Inserting sp|Q96GG9|DCNL1_HUMAN
15 Dec 2023 01:04:56,154 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:56,154 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:04:56,303 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:56,303 INFO : Inserting sp|Q96HD1|CREL1_HUMAN
15 Dec 2023 01:04:56,377 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:56,377 INFO : Inserting sp|Q96HE7|ERO1A_HUMAN
15 Dec 2023 01:04:56,480 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:56,480 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 01:04:56,601 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:56,602 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 01:04:56,904 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:04:56,904 INFO : Inserting sp|Q96K76|UBP47_HUMAN
15 Dec 2023 01:04:56,924 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:56,925 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 01:04:57,039 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:57,039 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:04:57,470 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:04:57,470 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 01:04:57,642 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:04:57,642 INFO : Inserting sp|Q96L92|SNX27_HUMAN
15 Dec 2023 01:04:57,675 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:57,675 INFO : Inserting sp|Q96LB3|IFT74_HUMAN
15 Dec 2023 01:04:57,699 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:57,699 INFO : Inserting sp|Q96NY7|CLIC6_HUMAN
15 Dec 2023 01:04:57,767 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:57,767 INFO : Inserting sp|Q96NZ9|PRAP1_HUMAN
15 Dec 2023 01:04:57,810 INFO : 86% Done
15 Dec 2023 01:04:57,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:57,833 INFO : Inserting sp|Q96P48|ARAP1_HUMAN
15 Dec 2023 01:04:57,862 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:57,862 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:04:58,237 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:04:58,237 INFO : Inserting sp|Q96PP8|GBP5_HUMAN
15 Dec 2023 01:04:58,280 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:58,280 INFO : Inserting sp|Q96PX8|SLIK1_HUMAN
15 Dec 2023 01:04:58,345 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:58,345 INFO : Inserting sp|Q96Q15|SMG1_HUMAN
15 Dec 2023 01:04:58,410 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:58,410 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:04:58,594 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:58,594 INFO : Inserting sp|Q96QV6|H2A1A_HUMAN
15 Dec 2023 01:04:58,683 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:58,683 INFO : Inserting sp|Q96S97|MYADM_HUMAN
15 Dec 2023 01:04:58,721 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:58,721 INFO : Inserting sp|Q96T51|RUFY1_HUMAN
15 Dec 2023 01:04:58,797 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:58,797 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:04:59,149 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:04:59,149 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 01:04:59,195 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:04:59,195 INFO : Inserting sp|Q99439|CNN2_HUMAN
15 Dec 2023 01:04:59,289 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:04:59,290 INFO : Inserting sp|Q99460|PSMD1_HUMAN
15 Dec 2023 01:04:59,310 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:59,310 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 01:04:59,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:59,331 INFO : Inserting sp|Q99519|NEUR1_HUMAN
15 Dec 2023 01:04:59,351 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:59,351 INFO : Inserting sp|Q99536|VAT1_HUMAN
15 Dec 2023 01:04:59,554 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:04:59,554 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 01:04:59,826 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:04:59,826 INFO : Inserting sp|Q99542|MMP19_HUMAN
15 Dec 2023 01:04:59,847 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:04:59,847 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:04:59,907 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:59,907 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 01:04:59,985 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:04:59,985 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 01:05:00,025 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:00,025 INFO : Inserting sp|Q99653|CHP1_HUMAN
15 Dec 2023 01:05:00,040 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,040 INFO : Inserting sp|Q99715|COCA1_HUMAN
15 Dec 2023 01:05:00,130 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:00,130 INFO : Inserting sp|Q99719|SEPT5_HUMAN
15 Dec 2023 01:05:00,176 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,176 INFO : Inserting sp|Q99729|ROAA_HUMAN
15 Dec 2023 01:05:00,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,196 INFO : Inserting sp|Q99731|CCL19_HUMAN
15 Dec 2023 01:05:00,217 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,217 INFO : Inserting sp|Q99733|NP1L4_HUMAN
15 Dec 2023 01:05:00,240 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,240 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 01:05:00,282 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,282 INFO : Inserting sp|Q99798|ACON_HUMAN
15 Dec 2023 01:05:00,349 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:00,349 INFO : Inserting sp|Q99829|CPNE1_HUMAN
15 Dec 2023 01:05:00,420 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:00,420 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 01:05:00,556 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:00,556 INFO : Inserting sp|Q99873|ANM1_HUMAN
15 Dec 2023 01:05:00,583 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:00,583 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:05:00,598 INFO : 87% Done
15 Dec 2023 01:05:00,815 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:05:00,815 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 01:05:00,917 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:00,917 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:05:01,147 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:05:01,147 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 01:05:01,175 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:01,175 INFO : Inserting sp|Q99983|OMD_HUMAN
15 Dec 2023 01:05:01,238 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:01,238 INFO : Inserting sp|Q99986|VRK1_HUMAN
15 Dec 2023 01:05:01,281 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:01,281 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 01:05:01,318 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:01,318 INFO : Inserting sp|Q9BRA2|TXD17_HUMAN
15 Dec 2023 01:05:01,361 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:01,362 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:05:01,450 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:01,451 INFO : Imported 1600 peptide groups.
15 Dec 2023 01:05:01,451 INFO : Inserting sp|Q9BRR6|ADPGK_HUMAN
15 Dec 2023 01:05:01,489 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:01,490 INFO : Inserting sp|Q9BS26|ERP44_HUMAN
15 Dec 2023 01:05:01,551 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:01,551 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 01:05:01,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,572 INFO : Inserting sp|Q9BSJ8|ESYT1_HUMAN
15 Dec 2023 01:05:01,596 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,596 INFO : Inserting sp|Q9BTT0|AN32E_HUMAN
15 Dec 2023 01:05:01,639 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,639 INFO : Inserting sp|Q9BTV5|FSD1_HUMAN
15 Dec 2023 01:05:01,659 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,659 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 01:05:01,702 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,703 INFO : Inserting sp|Q9BUD6|SPON2_HUMAN
15 Dec 2023 01:05:01,748 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:01,748 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:05:01,839 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:01,839 INFO : Inserting sp|Q9BUJ2|HNRL1_HUMAN
15 Dec 2023 01:05:01,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:01,865 INFO : Inserting sp|Q9BVA1|TBB2B_HUMAN
15 Dec 2023 01:05:02,010 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:05:02,010 INFO : Inserting sp|Q9BWD1|THIC_HUMAN
15 Dec 2023 01:05:02,068 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:02,068 INFO : Inserting sp|Q9BWJ5|SF3B5_HUMAN
15 Dec 2023 01:05:02,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:02,092 INFO : Inserting sp|Q9BWS9|CHID1_HUMAN
15 Dec 2023 01:05:02,110 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:02,110 INFO : Inserting sp|Q9BWV1|BOC_HUMAN
15 Dec 2023 01:05:02,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:02,136 INFO : Inserting sp|Q9BX67|JAM3_HUMAN
15 Dec 2023 01:05:02,160 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:02,160 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 01:05:02,193 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:02,193 INFO : Inserting sp|Q9BXS5|AP1M1_HUMAN
15 Dec 2023 01:05:02,284 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:02,284 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:05:02,399 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:02,399 INFO : Inserting sp|Q9BY32|ITPA_HUMAN
15 Dec 2023 01:05:02,459 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:02,459 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 01:05:02,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:02,477 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:05:02,650 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:02,650 INFO : Inserting sp|Q9BY79|MFRP_HUMAN
15 Dec 2023 01:05:02,839 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:02,839 INFO : Inserting sp|Q9BYH1|SE6L1_HUMAN
15 Dec 2023 01:05:02,989 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:02,989 INFO : Inserting sp|Q9BYV7|BCDO2_HUMAN
15 Dec 2023 01:05:03,003 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,003 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 01:05:03,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:03,056 INFO : Inserting sp|Q9BZR6|RTN4R_HUMAN
15 Dec 2023 01:05:03,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,104 INFO : Inserting sp|Q9C0A0|CNTP4_HUMAN
15 Dec 2023 01:05:03,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:03,152 INFO : Inserting sp|Q9GZQ8|MLP3B_HUMAN
15 Dec 2023 01:05:03,184 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,184 INFO : Inserting sp|Q9GZS3|SKI8_HUMAN
15 Dec 2023 01:05:03,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,221 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 01:05:03,329 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:03,330 INFO : Inserting sp|Q9H008|LHPP_HUMAN
15 Dec 2023 01:05:03,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,378 INFO : Inserting sp|Q9H0E2|TOLIP_HUMAN
15 Dec 2023 01:05:03,454 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:03,454 INFO : Inserting sp|Q9H0U4|RAB1B_HUMAN
15 Dec 2023 01:05:03,568 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:03,568 INFO : Inserting sp|Q9H0W9|CK054_HUMAN
15 Dec 2023 01:05:03,708 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:03,709 INFO : Inserting sp|Q9H173|SIL1_HUMAN
15 Dec 2023 01:05:03,728 INFO : 88% Done
15 Dec 2023 01:05:03,803 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:03,803 INFO : Inserting sp|Q9H299|SH3L3_HUMAN
15 Dec 2023 01:05:03,884 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:03,884 INFO : Inserting sp|Q9H2K8|TAOK3_HUMAN
15 Dec 2023 01:05:03,921 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:03,921 INFO : Inserting sp|Q9H2U2|IPYR2_HUMAN
15 Dec 2023 01:05:03,945 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:03,945 INFO : Inserting sp|Q9H2X0|CHRD_HUMAN
15 Dec 2023 01:05:04,061 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:04,061 INFO : Inserting sp|Q9H361|PABP3_HUMAN
15 Dec 2023 01:05:04,119 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:04,119 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:05:04,401 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:04,402 INFO : Inserting sp|Q9H3T3|SEM6B_HUMAN
15 Dec 2023 01:05:04,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,424 INFO : Inserting sp|Q9H4A9|DPEP2_HUMAN
15 Dec 2023 01:05:04,475 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,475 INFO : Inserting sp|Q9H4G4|GAPR1_HUMAN
15 Dec 2023 01:05:04,506 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,506 INFO : Inserting sp|Q9H4L7|SMRCD_HUMAN
15 Dec 2023 01:05:04,534 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,534 INFO : Inserting sp|Q9H4M9|EHD1_HUMAN
15 Dec 2023 01:05:04,594 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:04,594 INFO : Inserting sp|Q9H6T0|ESRP2_HUMAN
15 Dec 2023 01:05:04,610 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,610 INFO : Inserting sp|Q9H6X2|ANTR1_HUMAN
15 Dec 2023 01:05:04,621 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,622 INFO : Inserting sp|Q9H7Z6|KAT8_HUMAN
15 Dec 2023 01:05:04,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,626 INFO : Inserting sp|Q9H892|TTC12_HUMAN
15 Dec 2023 01:05:04,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,646 INFO : Inserting sp|Q9HAB8|PPCS_HUMAN
15 Dec 2023 01:05:04,674 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,674 INFO : Inserting sp|Q9HAR2|AGRL3_HUMAN
15 Dec 2023 01:05:04,721 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,721 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:05:04,813 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:04,813 INFO : Inserting sp|Q9HAV0|GBB4_HUMAN
15 Dec 2023 01:05:04,873 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:04,873 INFO : Inserting sp|Q9HB07|MYG1_HUMAN
15 Dec 2023 01:05:04,902 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:04,902 INFO : Inserting sp|Q9HB71|CYBP_HUMAN
15 Dec 2023 01:05:04,945 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,945 INFO : Inserting sp|Q9HB90|RRAGC_HUMAN
15 Dec 2023 01:05:04,973 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:04,973 INFO : Inserting sp|Q9HBI0|PARVG_HUMAN
15 Dec 2023 01:05:05,069 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:05,069 INFO : Inserting sp|Q9HBW1|LRRC4_HUMAN
15 Dec 2023 01:05:05,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,108 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 01:05:05,240 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:05:05,240 INFO : Inserting sp|Q9HCU0|CD248_HUMAN
15 Dec 2023 01:05:05,258 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,258 INFO : Inserting sp|Q9HCU4|CELR2_HUMAN
15 Dec 2023 01:05:05,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,291 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 01:05:05,355 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:05,355 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 01:05:05,494 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:05,494 INFO : Inserting sp|Q9NNX6|CD209_HUMAN
15 Dec 2023 01:05:05,526 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,526 INFO : Inserting sp|Q9NP84|TNR12_HUMAN
15 Dec 2023 01:05:05,552 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,553 INFO : Inserting sp|Q9NPA0|EMC7_HUMAN
15 Dec 2023 01:05:05,581 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:05,581 INFO : Inserting sp|Q9NPA2|MMP25_HUMAN
15 Dec 2023 01:05:05,616 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:05,616 INFO : Inserting sp|Q9NPP4|NLRC4_HUMAN
15 Dec 2023 01:05:05,645 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:05,645 INFO : Inserting sp|Q9NPR2|SEM4B_HUMAN
15 Dec 2023 01:05:05,796 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:05,796 INFO : Inserting sp|Q9NPY3|C1QR1_HUMAN
15 Dec 2023 01:05:05,878 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:05,878 INFO : Inserting sp|Q9NQ66|PLCB1_HUMAN
15 Dec 2023 01:05:05,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:05,893 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 01:05:06,126 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:06,126 INFO : Inserting sp|Q9NQG5|RPR1B_HUMAN
15 Dec 2023 01:05:06,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:06,150 INFO : Inserting sp|Q9NQR4|NIT2_HUMAN
15 Dec 2023 01:05:06,298 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:06,298 INFO : Inserting sp|Q9NQW7|XPP1_HUMAN
15 Dec 2023 01:05:06,350 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:06,350 INFO : Inserting sp|Q9NQX7|ITM2C_HUMAN
15 Dec 2023 01:05:06,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:06,374 INFO : Inserting sp|Q9NR34|MA1C1_HUMAN
15 Dec 2023 01:05:06,476 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:06,476 INFO : Inserting sp|Q9NR45|SIAS_HUMAN
15 Dec 2023 01:05:06,534 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:06,534 INFO : Inserting sp|Q9NR46|SHLB2_HUMAN
15 Dec 2023 01:05:06,578 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:06,578 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 01:05:06,618 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:06,618 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 01:05:06,641 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:06,641 INFO : Inserting sp|Q9NS15|LTBP3_HUMAN
15 Dec 2023 01:05:06,664 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:06,664 INFO : Inserting sp|Q9NSD9|SYFB_HUMAN
15 Dec 2023 01:05:06,794 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:06,794 INFO : Inserting sp|Q9NSE4|SYIM_HUMAN
15 Dec 2023 01:05:06,823 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:06,824 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 01:05:06,832 INFO : 89% Done
15 Dec 2023 01:05:06,864 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:06,865 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 01:05:07,106 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:07,106 INFO : Inserting sp|Q9NTI5|PDS5B_HUMAN
15 Dec 2023 01:05:07,127 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:07,127 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 01:05:07,203 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:07,203 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:05:07,544 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:07,544 INFO : Inserting sp|Q9NVD3|SETD4_HUMAN
15 Dec 2023 01:05:07,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:07,611 INFO : Inserting sp|Q9NVJ2|ARL8B_HUMAN
15 Dec 2023 01:05:07,772 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:07,772 INFO : Inserting sp|Q9NX46|ADPRS_HUMAN
15 Dec 2023 01:05:07,854 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:07,854 INFO : Inserting sp|Q9NX62|IMPA3_HUMAN
15 Dec 2023 01:05:07,959 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:07,961 INFO : Inserting sp|Q9NY33|DPP3_HUMAN
15 Dec 2023 01:05:08,185 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:08,185 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 01:05:08,342 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:08,342 INFO : Inserting sp|Q9NYU2|UGGG1_HUMAN
15 Dec 2023 01:05:08,387 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:08,387 INFO : Inserting sp|Q9NYX4|CALY_HUMAN
15 Dec 2023 01:05:08,411 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:08,411 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 01:05:08,614 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:08,614 INFO : Imported 1700 peptide groups.
15 Dec 2023 01:05:08,614 INFO : Inserting sp|Q9NZ53|PDXL2_HUMAN
15 Dec 2023 01:05:08,652 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:08,652 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:05:09,054 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:05:09,054 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 01:05:09,094 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:09,094 INFO : Inserting sp|Q9NZN3|EHD3_HUMAN
15 Dec 2023 01:05:09,158 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:09,159 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:05:09,258 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:09,258 INFO : Inserting sp|Q9P035|HACD3_HUMAN
15 Dec 2023 01:05:09,284 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:09,284 INFO : Inserting sp|Q9P0K9|FRS1L_HUMAN
15 Dec 2023 01:05:09,314 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:09,314 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 01:05:09,465 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:05:09,465 INFO : Inserting sp|Q9P1W8|SIRPG_HUMAN
15 Dec 2023 01:05:09,484 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:09,484 INFO : Inserting sp|Q9P258|RCC2_HUMAN
15 Dec 2023 01:05:09,716 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:09,716 INFO : Inserting sp|Q9P2J5|SYLC_HUMAN
15 Dec 2023 01:05:09,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:09,757 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 01:05:09,905 INFO : 90% Done
15 Dec 2023 01:05:09,938 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:09,939 INFO : Inserting sp|Q9P2T1|GMPR2_HUMAN
15 Dec 2023 01:05:09,975 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:09,975 INFO : Inserting sp|Q9UBE0|SAE1_HUMAN
15 Dec 2023 01:05:10,024 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:10,024 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 01:05:10,292 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:05:10,293 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:05:10,630 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:05:10,630 INFO : Inserting sp|Q9UBQ0|VPS29_HUMAN
15 Dec 2023 01:05:10,696 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:10,697 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 01:05:10,830 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:10,830 INFO : Inserting sp|Q9UBQ7|GRHPR_HUMAN
15 Dec 2023 01:05:10,932 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:10,932 INFO : Inserting sp|Q9UBR2|CATZ_HUMAN
15 Dec 2023 01:05:10,953 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:10,953 INFO : Inserting sp|Q9UBT2|SAE2_HUMAN
15 Dec 2023 01:05:11,022 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,022 INFO : Inserting sp|Q9UBV8|PEF1_HUMAN
15 Dec 2023 01:05:11,050 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,050 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 01:05:11,213 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:11,213 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 01:05:11,241 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,241 INFO : Inserting sp|Q9UBX7|KLK11_HUMAN
15 Dec 2023 01:05:11,404 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:11,404 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 01:05:11,432 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,432 INFO : Inserting sp|Q9UFH2|DYH17_HUMAN
15 Dec 2023 01:05:11,466 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,466 INFO : Inserting sp|Q9UGJ0|AAKG2_HUMAN
15 Dec 2023 01:05:11,495 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,495 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 01:05:11,590 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:11,590 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 01:05:11,612 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,612 INFO : Inserting sp|Q9UH03|SEPT3_HUMAN
15 Dec 2023 01:05:11,635 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,635 INFO : Inserting sp|Q9UH65|SWP70_HUMAN
15 Dec 2023 01:05:11,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,655 INFO : Inserting sp|Q9UHA4|LTOR3_HUMAN
15 Dec 2023 01:05:11,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:11,716 INFO : Inserting sp|Q9UHD8|SEPT9_HUMAN
15 Dec 2023 01:05:11,789 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:11,789 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 01:05:11,858 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:11,858 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 01:05:11,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,876 INFO : Inserting sp|Q9UHI8|ATS1_HUMAN
15 Dec 2023 01:05:11,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:11,942 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 01:05:12,081 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:12,081 INFO : Inserting sp|Q9UHV9|PFD2_HUMAN
15 Dec 2023 01:05:12,107 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:12,107 INFO : Inserting sp|Q9UHY1|NRBP_HUMAN
15 Dec 2023 01:05:12,184 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:12,184 INFO : Inserting sp|Q9UHY7|ENOPH_HUMAN
15 Dec 2023 01:05:12,282 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:12,282 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 01:05:12,402 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:12,402 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 01:05:12,475 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:12,476 INFO : Inserting sp|Q9UJ68|MSRA_HUMAN
15 Dec 2023 01:05:12,527 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:12,527 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 01:05:12,734 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:05:12,735 INFO : Inserting sp|Q9UJJ9|GNPTG_HUMAN
15 Dec 2023 01:05:12,772 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:12,772 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 01:05:12,859 INFO : 91% Done
15 Dec 2023 01:05:12,866 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:12,867 INFO : Inserting sp|Q9UJW0|DCTN4_HUMAN
15 Dec 2023 01:05:12,891 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:12,891 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:05:13,228 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:05:13,228 INFO : Inserting sp|Q9UKG1|DP13A_HUMAN
15 Dec 2023 01:05:13,299 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:13,299 INFO : Inserting sp|Q9UKK3|PARP4_HUMAN
15 Dec 2023 01:05:13,319 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:13,319 INFO : Inserting sp|Q9UKK9|NUDT5_HUMAN
15 Dec 2023 01:05:13,363 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:13,363 INFO : Inserting sp|Q9UKX2|MYH2_HUMAN
15 Dec 2023 01:05:13,379 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:13,379 INFO : Inserting sp|Q9UKX3|MYH13_HUMAN
15 Dec 2023 01:05:13,395 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:13,395 INFO : Inserting sp|Q9UL18|AGO1_HUMAN
15 Dec 2023 01:05:13,472 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:13,472 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 01:05:13,526 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:13,526 INFO : Inserting sp|Q9ULB1|NRX1A_HUMAN
15 Dec 2023 01:05:13,641 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:13,641 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 01:05:13,731 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:13,731 INFO : Inserting sp|Q9ULI3|HEG1_HUMAN
15 Dec 2023 01:05:13,805 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:13,806 INFO : Inserting sp|Q9ULM3|YETS2_HUMAN
15 Dec 2023 01:05:13,834 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:13,834 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:05:13,935 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:13,935 INFO : Inserting sp|Q9ULX7|CAH14_HUMAN
15 Dec 2023 01:05:13,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:13,998 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:05:14,055 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:14,055 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:05:14,498 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:05:14,498 INFO : Inserting sp|Q9UM22|EPDR1_HUMAN
15 Dec 2023 01:05:14,516 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:14,516 INFO : Inserting sp|Q9UM47|NOTC3_HUMAN
15 Dec 2023 01:05:14,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:14,538 INFO : Inserting sp|Q9UMF0|ICAM5_HUMAN
15 Dec 2023 01:05:14,603 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:14,604 INFO : Inserting sp|Q9UMS4|PRP19_HUMAN
15 Dec 2023 01:05:14,665 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:14,665 INFO : Inserting sp|Q9UMX0|UBQL1_HUMAN
15 Dec 2023 01:05:14,711 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:14,711 INFO : Inserting sp|Q9UN36|NDRG2_HUMAN
15 Dec 2023 01:05:14,740 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:14,740 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 01:05:14,876 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:14,876 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 01:05:14,981 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:14,981 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:05:15,108 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:15,108 INFO : Inserting sp|Q9UQM7|KCC2A_HUMAN
15 Dec 2023 01:05:15,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,120 INFO : Inserting sp|Q9Y224|RTRAF_HUMAN
15 Dec 2023 01:05:15,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,156 INFO : Inserting sp|Q9Y237|PIN4_HUMAN
15 Dec 2023 01:05:15,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,167 INFO : Inserting sp|Q9Y240|CLC11_HUMAN
15 Dec 2023 01:05:15,203 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,203 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 01:05:15,270 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:15,270 INFO : Inserting sp|Q9Y265|RUVB1_HUMAN
15 Dec 2023 01:05:15,301 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,301 INFO : Inserting sp|Q9Y266|NUDC_HUMAN
15 Dec 2023 01:05:15,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,328 INFO : Inserting sp|Q9Y275|TN13B_HUMAN
15 Dec 2023 01:05:15,357 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,357 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 01:05:15,406 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:15,406 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:05:15,546 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:15,546 INFO : Inserting sp|Q9Y287|ITM2B_HUMAN
15 Dec 2023 01:05:15,590 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:15,590 INFO : Inserting sp|Q9Y2E5|MA2B2_HUMAN
15 Dec 2023 01:05:15,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,601 INFO : Inserting sp|Q9Y2I2|NTNG1_HUMAN
15 Dec 2023 01:05:15,666 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:15,667 INFO : Inserting sp|Q9Y2J8|PADI2_HUMAN
15 Dec 2023 01:05:15,802 INFO : 92% Done
15 Dec 2023 01:05:15,840 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:15,840 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 01:05:15,867 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:15,867 INFO : Inserting sp|Q9Y2T3|GUAD_HUMAN
15 Dec 2023 01:05:15,915 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:15,915 INFO : Inserting sp|Q9Y2V0|CDIN1_HUMAN
15 Dec 2023 01:05:15,927 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,927 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 01:05:15,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:15,972 INFO : Inserting sp|Q9Y2X8|UB2D4_HUMAN
15 Dec 2023 01:05:16,001 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,001 INFO : Inserting sp|Q9Y315|DEOC_HUMAN
15 Dec 2023 01:05:16,085 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:16,085 INFO : Inserting sp|Q9Y316|MEMO1_HUMAN
15 Dec 2023 01:05:16,099 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,099 INFO : Inserting sp|Q9Y333|LSM2_HUMAN
15 Dec 2023 01:05:16,134 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,134 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 01:05:16,319 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:05:16,319 INFO : Inserting sp|Q9Y3B3|TMED7_HUMAN
15 Dec 2023 01:05:16,333 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,333 INFO : Inserting sp|Q9Y3F4|STRAP_HUMAN
15 Dec 2023 01:05:16,368 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:16,368 INFO : Inserting sp|Q9Y3I0|RTCB_HUMAN
15 Dec 2023 01:05:16,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,400 INFO : Inserting sp|Q9Y3L3|3BP1_HUMAN
15 Dec 2023 01:05:16,439 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:16,439 INFO : Imported 1800 peptide groups.
15 Dec 2023 01:05:16,439 INFO : Inserting sp|Q9Y3Z3|SAMH1_HUMAN
15 Dec 2023 01:05:16,521 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:16,522 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:05:17,384 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:05:17,384 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 01:05:17,698 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:05:17,698 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 01:05:17,766 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:17,767 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 01:05:17,908 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:17,908 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 01:05:17,936 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:17,936 INFO : Inserting sp|Q9Y4W6|AFG32_HUMAN
15 Dec 2023 01:05:17,961 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:17,961 INFO : Inserting sp|Q9Y5K8|VATD_HUMAN
15 Dec 2023 01:05:18,002 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:18,002 INFO : Inserting sp|Q9Y5L0|TNPO3_HUMAN
15 Dec 2023 01:05:18,065 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:18,065 INFO : Inserting sp|Q9Y5P4|CERT_HUMAN
15 Dec 2023 01:05:18,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,081 INFO : Inserting sp|Q9Y5P6|GMPPB_HUMAN
15 Dec 2023 01:05:18,109 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,109 INFO : Inserting sp|Q9Y5S9|RBM8A_HUMAN
15 Dec 2023 01:05:18,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,156 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:05:18,345 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:18,345 INFO : Inserting sp|Q9Y5Z4|HEBP2_HUMAN
15 Dec 2023 01:05:18,411 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:18,411 INFO : Inserting sp|Q9Y617|SERC_HUMAN
15 Dec 2023 01:05:18,548 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:18,548 INFO : Inserting sp|Q9Y623|MYH4_HUMAN
15 Dec 2023 01:05:18,564 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,564 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 01:05:18,700 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:18,700 INFO : Inserting sp|Q9Y678|COPG1_HUMAN
15 Dec 2023 01:05:18,827 INFO : 93% Done
15 Dec 2023 01:05:18,848 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:18,848 INFO : Inserting sp|Q9Y6K9|NEMO_HUMAN
15 Dec 2023 01:05:18,883 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,883 INFO : Inserting sp|Q9Y6N5|SQOR_HUMAN
15 Dec 2023 01:05:18,895 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,895 INFO : Inserting sp|Q9Y6N6|LAMC3_HUMAN
15 Dec 2023 01:05:18,919 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:18,919 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 01:05:18,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:18,931 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:05:20,178 DEBUG: Inserted 50 peptides
15 Dec 2023 01:05:21,470 DEBUG: Inserted 100 peptides
15 Dec 2023 01:05:21,664 INFO : 94% Done
15 Dec 2023 01:05:22,699 DEBUG: Inserted 150 peptides
15 Dec 2023 01:05:22,875 DEBUG: Total peptides inserted: 157
15 Dec 2023 01:05:22,875 INFO : Inserting sp|Q9Y6Y9|LY96_HUMAN
15 Dec 2023 01:05:22,901 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:22,901 INFO : Inserting sp|A0A075B6Q5|HV364_HUMAN
15 Dec 2023 01:05:22,954 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:22,954 INFO : Inserting sp|A0A075B6R2|HV404_HUMAN
15 Dec 2023 01:05:22,978 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:22,978 INFO : Inserting sp|A0A087WSY4|HV432_HUMAN
15 Dec 2023 01:05:22,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:22,998 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 01:05:23,047 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:23,047 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 01:05:23,138 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:23,138 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 01:05:23,221 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:23,221 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 01:05:23,281 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:23,281 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 01:05:23,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,292 INFO : Inserting sp|A0A0C4DH29|HV103_HUMAN
15 Dec 2023 01:05:23,303 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,303 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 01:05:23,322 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:23,322 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 01:05:23,387 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:23,387 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 01:05:23,428 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:23,428 INFO : Inserting sp|A0A0C4DH41|HV461_HUMAN
15 Dec 2023 01:05:23,449 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,449 INFO : Inserting sp|A0A0J9YX35|HV64D_HUMAN
15 Dec 2023 01:05:23,492 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:23,492 INFO : Inserting sp|A5D6W6|FITM1_HUMAN
15 Dec 2023 01:05:23,536 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,536 INFO : Inserting sp|A6NCE7|MP3B2_HUMAN
15 Dec 2023 01:05:23,567 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,567 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:05:23,758 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:23,759 INFO : Inserting sp|E9PAV3|NACAM_HUMAN
15 Dec 2023 01:05:23,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,779 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 01:05:23,824 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:23,824 INFO : Inserting sp|O60245|PCDH7_HUMAN
15 Dec 2023 01:05:23,860 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,861 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 01:05:23,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,897 INFO : Inserting sp|O75711|SCRG1_HUMAN
15 Dec 2023 01:05:23,958 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:23,958 INFO : Inserting sp|O75964|ATP5L_HUMAN
15 Dec 2023 01:05:23,992 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:23,992 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:05:24,004 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,004 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:05:24,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:24,132 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 01:05:24,155 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,155 INFO : Inserting sp|P01601|KVD16_HUMAN
15 Dec 2023 01:05:24,180 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,181 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 01:05:24,200 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,200 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 01:05:24,238 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:24,238 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 01:05:24,285 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:24,285 INFO : Inserting sp|P01714|LV319_HUMAN
15 Dec 2023 01:05:24,304 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,304 INFO : Inserting sp|P04430|KV116_HUMAN
15 Dec 2023 01:05:24,330 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,330 INFO : Inserting sp|P04432|KVD39_HUMAN
15 Dec 2023 01:05:24,391 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:24,391 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 01:05:24,463 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:24,463 INFO : Inserting sp|P06310|KV230_HUMAN
15 Dec 2023 01:05:24,482 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:24,482 INFO : Inserting sp|P07311|ACYP1_HUMAN
15 Dec 2023 01:05:24,515 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:24,515 INFO : Inserting sp|P0DOX3|IGD_HUMAN
15 Dec 2023 01:05:24,597 INFO : 95% Done
15 Dec 2023 01:05:24,645 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:24,645 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:05:25,084 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:05:25,084 INFO : Inserting sp|P0DP01|HV108_HUMAN
15 Dec 2023 01:05:25,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:25,097 INFO : Inserting sp|P0DP02|HVC33_HUMAN
15 Dec 2023 01:05:25,172 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,172 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 01:05:25,247 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,247 INFO : Inserting sp|P0DP04|HV43D_HUMAN
15 Dec 2023 01:05:25,317 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,317 INFO : Inserting sp|P0DP06|HVD34_HUMAN
15 Dec 2023 01:05:25,336 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:25,336 INFO : Inserting sp|P0DP07|HV431_HUMAN
15 Dec 2023 01:05:25,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:25,355 INFO : Inserting sp|P0DP08|HVD82_HUMAN
15 Dec 2023 01:05:25,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:25,374 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 01:05:25,441 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,441 INFO : Inserting sp|P60983|GMFB_HUMAN
15 Dec 2023 01:05:25,472 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:25,472 INFO : Inserting sp|P80748|LV321_HUMAN
15 Dec 2023 01:05:25,511 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:25,511 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 01:05:25,670 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:05:25,670 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 01:05:25,792 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,792 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 01:05:25,816 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:25,816 INFO : Inserting sp|Q15404|RSU1_HUMAN
15 Dec 2023 01:05:25,893 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:25,893 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 01:05:25,998 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:25,998 INFO : Inserting sp|Q2VIR3|IF2GL_HUMAN
15 Dec 2023 01:05:26,046 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:26,047 INFO : Inserting sp|Q53RD9|FBLN7_HUMAN
15 Dec 2023 01:05:26,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:26,080 INFO : Inserting sp|Q562R1|ACTBL_HUMAN
15 Dec 2023 01:05:26,260 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:05:26,260 INFO : Inserting sp|Q58FF8|H90B2_HUMAN
15 Dec 2023 01:05:26,358 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:26,358 INFO : Inserting sp|Q5T013|HYI_HUMAN
15 Dec 2023 01:05:26,373 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:26,373 INFO : Inserting sp|Q5TBC7|B2L15_HUMAN
15 Dec 2023 01:05:26,391 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:26,392 INFO : Inserting sp|Q5TEC6|H37_HUMAN
15 Dec 2023 01:05:26,523 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:26,523 INFO : Inserting sp|Q5TFQ8|SIRBL_HUMAN
15 Dec 2023 01:05:26,541 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:26,542 INFO : Inserting sp|Q5VTE0|EF1A3_HUMAN
15 Dec 2023 01:05:26,814 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:05:26,814 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 01:05:26,866 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:26,866 INFO : Inserting sp|Q66LE6|2ABD_HUMAN
15 Dec 2023 01:05:26,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:26,893 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 01:05:26,985 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:26,985 INFO : Inserting sp|Q6MZW2|FSTL4_HUMAN
15 Dec 2023 01:05:27,009 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:27,009 INFO : Inserting sp|Q6PI73|LIRA6_HUMAN
15 Dec 2023 01:05:27,091 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:27,091 INFO : Inserting sp|Q6S8J3|POTEE_HUMAN
15 Dec 2023 01:05:27,310 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:05:27,311 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:05:27,410 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:27,410 INFO : Inserting sp|Q6ZMR3|LDH6A_HUMAN
15 Dec 2023 01:05:27,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:27,441 INFO : Inserting sp|Q86X76|NIT1_HUMAN
15 Dec 2023 01:05:27,490 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:27,490 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 01:05:27,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:27,509 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 01:05:27,516 INFO : 96% Done
15 Dec 2023 01:05:27,555 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:27,555 INFO : Inserting sp|Q8NBX0|SCPDL_HUMAN
15 Dec 2023 01:05:27,594 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:27,594 INFO : Inserting sp|Q92747|ARC1A_HUMAN
15 Dec 2023 01:05:27,669 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:27,669 INFO : Inserting sp|Q92928|RAB1C_HUMAN
15 Dec 2023 01:05:27,755 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:27,755 INFO : Imported 1900 peptide groups.
15 Dec 2023 01:05:27,755 INFO : Inserting sp|Q96A23|CPNE4_HUMAN
15 Dec 2023 01:05:27,802 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:27,802 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 01:05:27,888 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:27,888 INFO : Inserting sp|Q96CX2|KCD12_HUMAN
15 Dec 2023 01:05:27,982 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:27,983 INFO : Inserting sp|Q96M27|PRRC1_HUMAN
15 Dec 2023 01:05:28,025 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:28,025 INFO : Inserting sp|Q96S96|PEBP4_HUMAN
15 Dec 2023 01:05:28,188 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:28,188 INFO : Inserting sp|Q96SE7|ZN347_HUMAN
15 Dec 2023 01:05:28,202 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:28,202 INFO : Inserting sp|Q9BPX5|ARP5L_HUMAN
15 Dec 2023 01:05:28,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:28,225 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 01:05:28,321 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:28,321 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 01:05:28,383 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:28,383 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:05:28,543 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:28,543 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:05:28,696 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:28,696 INFO : Inserting sp|Q9HBR0|S38AA_HUMAN
15 Dec 2023 01:05:28,729 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:28,729 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 01:05:28,817 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:28,817 INFO : Inserting sp|Q9HC56|PCDH9_HUMAN
15 Dec 2023 01:05:28,850 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:28,850 INFO : Inserting sp|Q9NPH6|OBP2B_HUMAN
15 Dec 2023 01:05:28,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:28,882 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 01:05:28,959 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:28,959 INFO : Inserting sp|Q9NRR1|CYTL1_HUMAN
15 Dec 2023 01:05:28,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:28,999 INFO : Inserting sp|Q9NRY5|F1142_HUMAN
15 Dec 2023 01:05:29,063 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,063 INFO : Inserting sp|Q9NYL9|TMOD3_HUMAN
15 Dec 2023 01:05:29,092 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,093 INFO : Inserting sp|Q9NZT2|OGFR_HUMAN
15 Dec 2023 01:05:29,161 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,161 INFO : Inserting sp|Q9UKU9|ANGL2_HUMAN
15 Dec 2023 01:05:29,181 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,182 INFO : Inserting sp|Q9Y5G0|PCDGH_HUMAN
15 Dec 2023 01:05:29,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,246 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 01:05:29,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,264 INFO : Inserting sp|A0A075B6K4|LV310_HUMAN
15 Dec 2023 01:05:29,284 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,284 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 01:05:29,317 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,317 INFO : Inserting sp|A0A075B6P5|KV228_HUMAN
15 Dec 2023 01:05:29,336 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,336 INFO : Inserting sp|A0A075B6S2|KVD29_HUMAN
15 Dec 2023 01:05:29,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,354 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:05:29,425 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,425 INFO : Inserting sp|A0A075B6S6|KVD30_HUMAN
15 Dec 2023 01:05:29,452 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,452 INFO : Inserting sp|A0A087WSY6|KVD15_HUMAN
15 Dec 2023 01:05:29,502 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,502 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 01:05:29,528 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,529 INFO : Inserting sp|A0A0A0MRZ7|KVD26_HUMAN
15 Dec 2023 01:05:29,552 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,552 INFO : Inserting sp|A0A0B4J1U3|LV136_HUMAN
15 Dec 2023 01:05:29,600 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,600 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 01:05:29,646 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:29,646 INFO : Inserting sp|A2NJV5|KV229_HUMAN
15 Dec 2023 01:05:29,671 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:29,671 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:05:29,911 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:29,911 INFO : Inserting sp|O75526|RMXL2_HUMAN
15 Dec 2023 01:05:29,967 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:29,967 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 01:05:30,165 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:30,165 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 01:05:30,428 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:05:30,428 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 01:05:30,599 INFO : 97% Done
15 Dec 2023 01:05:30,658 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:05:30,658 INFO : Inserting sp|P16562|CRIS2_HUMAN
15 Dec 2023 01:05:30,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:30,676 INFO : Inserting sp|Q14549|GBX1_HUMAN
15 Dec 2023 01:05:30,719 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:30,719 INFO : Inserting sp|Q15181|IPYR_HUMAN
15 Dec 2023 01:05:30,815 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:30,816 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 01:05:30,886 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:30,886 INFO : Inserting sp|Q5JS37|NHLC3_HUMAN
15 Dec 2023 01:05:30,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:30,911 INFO : Inserting sp|Q5VSG8|MANEL_HUMAN
15 Dec 2023 01:05:30,925 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:30,925 INFO : Inserting sp|Q6P589|TP8L2_HUMAN
15 Dec 2023 01:05:30,970 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:30,970 INFO : Inserting sp|Q86YQ8|CPNE8_HUMAN
15 Dec 2023 01:05:31,008 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,008 INFO : Inserting sp|Q8N5W9|RFLB_HUMAN
15 Dec 2023 01:05:31,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,028 INFO : Inserting sp|Q96MF6|CQ10A_HUMAN
15 Dec 2023 01:05:31,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,052 INFO : Inserting sp|Q9BT73|PSMG3_HUMAN
15 Dec 2023 01:05:31,087 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,087 INFO : Inserting sp|Q9BZK3|NACP4_HUMAN
15 Dec 2023 01:05:31,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,108 INFO : Inserting sp|Q9GZN8|CT027_HUMAN
15 Dec 2023 01:05:31,154 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,154 INFO : Inserting sp|Q9H0R4|HDHD2_HUMAN
15 Dec 2023 01:05:31,221 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:31,221 INFO : Inserting sp|Q9H8J5|MANS1_HUMAN
15 Dec 2023 01:05:31,238 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,238 INFO : Inserting sp|Q9H8M1|CQ10B_HUMAN
15 Dec 2023 01:05:31,260 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,260 INFO : Inserting sp|Q9NPD7|NRN1_HUMAN
15 Dec 2023 01:05:31,282 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,282 INFO : Inserting sp|Q9P016|THYN1_HUMAN
15 Dec 2023 01:05:31,316 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,316 INFO : Inserting sp|Q9UFN0|NPS3A_HUMAN
15 Dec 2023 01:05:31,413 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:31,414 INFO : Inserting sp|Q9Y485|DMXL1_HUMAN
15 Dec 2023 01:05:31,469 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,469 INFO : Inserting sp|A0A3B3IRV3|MCTS2_HUMAN
15 Dec 2023 01:05:31,552 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:31,552 INFO : Inserting sp|A6NGN9|IGLO5_HUMAN
15 Dec 2023 01:05:31,592 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,592 INFO : Inserting sp|O75071|EFC14_HUMAN
15 Dec 2023 01:05:31,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,636 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 01:05:31,682 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:31,682 INFO : Inserting sp|Q8N7X1|RMXL3_HUMAN
15 Dec 2023 01:05:31,704 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,704 INFO : Inserting sp|Q8N9C0|IGS22_HUMAN
15 Dec 2023 01:05:31,723 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,723 INFO : Inserting sp|Q96CN7|ISOC1_HUMAN
15 Dec 2023 01:05:31,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,737 INFO : Inserting sp|Q9BPW8|NIPS1_HUMAN
15 Dec 2023 01:05:31,774 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,774 INFO : Inserting sp|Q9P1F3|ABRAL_HUMAN
15 Dec 2023 01:05:31,874 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:05:31,874 INFO : Inserting sp|Q56UQ5|TPT1L_HUMAN
15 Dec 2023 01:05:31,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:05:31,893 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:05:31,944 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:31,944 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:05:32,026 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:05:32,027 INFO : Inserting P35908v2
15 Dec 2023 01:05:32,172 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:05:32,172 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:05:32,449 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:05:32,449 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:05:32,598 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:05:32,598 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 01:05:32,668 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:32,668 INFO : Inserting Q2KJC7
15 Dec 2023 01:05:32,827 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:05:32,827 INFO : Inserting P02769
15 Dec 2023 01:05:33,225 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:05:33,225 INFO : Inserting P02768-1
15 Dec 2023 01:05:33,603 INFO : 98% Done
15 Dec 2023 01:05:34,678 DEBUG: Inserted 50 peptides
15 Dec 2023 01:05:34,936 DEBUG: Total peptides inserted: 62
15 Dec 2023 01:05:34,936 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 01:05:34,976 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:05:34,976 INFO : None of the 1516524 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:09:04,605 INFO : Updated 471758 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:09:04,606 INFO : Done parsing Skyline document.
15 Dec 2023 01:09:04,638 WARN : Missed importing 8508 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.22_F3_S1-D11_1_2845.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8485 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6666.7_F3_S1-B12_1_2896.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8492 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.3_F3_S1-A11_1_2820.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8497 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6666.11_F3_S1-C12_1_2904.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8510 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.9_F3_S1-B11_1_2828.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8390 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.3_F3_S1-A6_1_3065.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8501 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.41_F3_S1-G11_1_2872.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8424 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6666.24_F3_S1-E12_1_2920.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8540 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.47_F3_S1-H11_1_2880.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8483 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.28_F3_S1-E11_1_2853.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8406 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6666.17_F3_S1-D12_1_2912.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8516 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.15_F3_S1-C11_1_2836.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8530 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6666.3_F3_S1-A12_1_2888.d
15 Dec 2023 01:09:04,638 WARN : Missed importing 8571 chromatograms from sample file D:\SILK\P017\CSF\Data\F3\CSF_6653.35_F3_S1-F11_1_2861.d
15 Dec 2023 01:09:04,638 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:09:09,977 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 01:09:31,591 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 01:09:37,222 INFO : Cleaning up temp tables
15 Dec 2023 01:09:37,596 INFO : Completed import of Skyline document from SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 01:09:37,598 INFO : 100% Done
15 Dec 2023 01:09:37,615 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179051/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip into the system
15 Dec 2023 01:09:37,616 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179056/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd into the system
15 Dec 2023 01:09:37,617 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179056/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd into the system
15 Dec 2023 01:09:37,617 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179056/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip into the system
15 Dec 2023 01:09:37,620 INFO : Starting import from SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 01:09:37,622 INFO : Starting to import Skyline document from SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 01:09:37,722 INFO : Expanding human.protdb
15 Dec 2023 01:09:40,558 INFO : Expanding CSF_P017_F4.imsdb
15 Dec 2023 01:09:40,609 INFO : Expanding SILK_P017_CSF_F4_a.blib
15 Dec 2023 01:09:41,283 INFO : Expanding SILK_P017_CSF_F4_a.redundant.blib
15 Dec 2023 01:09:43,746 INFO : Expanding SILK_P017_CSF_F4_a.skyd
15 Dec 2023 01:10:34,000 INFO : Expanding SILK_P017_CSF_F4_a.sky.view
15 Dec 2023 01:10:34,035 INFO : Expanding SILK_P017_CSF_F4_a.sky
15 Dec 2023 01:10:36,936 INFO : Expanding SILK_P017_CSF_F4_a.skyl
15 Dec 2023 01:11:50,176 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:11:51,709 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:11:53,450 INFO : Inserting sp|A0AVT1|UBA6_HUMAN
15 Dec 2023 01:11:53,459 WARN : 'SILK_P017_CSF_F3b' library was not found in settings.
15 Dec 2023 01:11:53,545 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:11:53,545 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 01:11:53,555 WARN : 'SILK_P017_CSF_F4' library was not found in settings.
15 Dec 2023 01:11:53,751 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:11:53,751 INFO : Inserting sp|A6NDG6|PGP_HUMAN
15 Dec 2023 01:11:53,889 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:11:53,889 INFO : Inserting sp|A6NHR9|SMHD1_HUMAN
15 Dec 2023 01:11:53,965 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:53,965 INFO : Inserting sp|A7KAX9|RHG32_HUMAN
15 Dec 2023 01:11:54,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:54,056 INFO : Inserting sp|B0I1T2|MYO1G_HUMAN
15 Dec 2023 01:11:54,174 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:11:54,174 INFO : Inserting sp|O00115|DNS2A_HUMAN
15 Dec 2023 01:11:54,219 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:54,219 INFO : Inserting sp|O00160|MYO1F_HUMAN
15 Dec 2023 01:11:54,554 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:11:54,554 INFO : Inserting sp|O00182|LEG9_HUMAN
15 Dec 2023 01:11:54,614 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:54,614 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 01:11:54,661 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:54,661 INFO : Inserting sp|O00231|PSD11_HUMAN
15 Dec 2023 01:11:54,793 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:11:54,793 INFO : Inserting sp|O00232|PSD12_HUMAN
15 Dec 2023 01:11:54,895 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:11:54,895 INFO : Inserting sp|O00233|PSMD9_HUMAN
15 Dec 2023 01:11:54,934 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:54,934 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:11:55,293 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:11:55,293 INFO : Inserting sp|O00303|EIF3F_HUMAN
15 Dec 2023 01:11:55,363 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:55,363 INFO : Inserting sp|O00329|PK3CD_HUMAN
15 Dec 2023 01:11:55,426 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:55,426 INFO : Inserting sp|O00339|MATN2_HUMAN
15 Dec 2023 01:11:55,491 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:55,491 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:11:55,916 INFO : 1% Done
15 Dec 2023 01:11:56,225 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:11:56,225 INFO : Inserting sp|O00410|IPO5_HUMAN
15 Dec 2023 01:11:56,407 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:11:56,407 INFO : Inserting sp|O00442|RTCA_HUMAN
15 Dec 2023 01:11:56,466 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:56,466 INFO : Inserting sp|O00451|GFRA2_HUMAN
15 Dec 2023 01:11:56,497 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:56,497 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 01:11:56,924 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:11:56,924 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:11:57,366 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:11:57,366 INFO : Inserting sp|O00506|STK25_HUMAN
15 Dec 2023 01:11:57,405 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:57,405 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:11:58,119 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:11:58,119 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:11:58,353 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:11:58,353 INFO : Inserting sp|O00571|DDX3X_HUMAN
15 Dec 2023 01:11:58,392 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:58,392 INFO : Inserting sp|O00584|RNT2_HUMAN
15 Dec 2023 01:11:58,768 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:11:58,768 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 01:11:58,841 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:58,841 INFO : Inserting sp|O00629|IMA3_HUMAN
15 Dec 2023 01:11:58,929 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:11:58,929 INFO : Inserting sp|O00743|PPP6_HUMAN
15 Dec 2023 01:11:58,990 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:58,990 INFO : Inserting sp|O00754|MA2B1_HUMAN
15 Dec 2023 01:11:59,284 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.3_F4_S1-A8_1_3066.d. SKYD file may be out of sync with primary Skyline document. Transition M - 799.4494, DLPPSVHLLTLASWGPEM[+16.0]VLLR, 3
15 Dec 2023 01:11:59,284 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6666.17_F4_S2-D4_1_2913.d. SKYD file may be out of sync with primary Skyline document. Transition M - 799.4494, DLPPSVHLLTLASWGPEM[+16.0]VLLR, 3
15 Dec 2023 01:11:59,341 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:11:59,341 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:11:59,518 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:11:59,518 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 01:11:59,617 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:11:59,617 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 01:11:59,675 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:11:59,675 INFO : Inserting sp|O14727|APAF_HUMAN
15 Dec 2023 01:11:59,908 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:11:59,908 INFO : Inserting sp|O14744|ANM5_HUMAN
15 Dec 2023 01:11:59,947 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:59,947 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 01:11:59,978 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:11:59,979 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:12:00,474 INFO : 2% Done
15 Dec 2023 01:12:00,530 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:12:00,530 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 01:12:00,942 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:00,942 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 01:12:01,082 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:01,082 INFO : Inserting sp|O14793|GDF8_HUMAN
15 Dec 2023 01:12:01,126 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:01,127 INFO : Inserting sp|O14817|TSN4_HUMAN
15 Dec 2023 01:12:01,177 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:01,177 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 01:12:01,422 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:01,422 INFO : Inserting sp|O14933|UB2L6_HUMAN
15 Dec 2023 01:12:01,507 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:01,508 INFO : Inserting sp|O14949|QCR8_HUMAN
15 Dec 2023 01:12:01,580 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:01,580 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 01:12:01,733 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:01,733 INFO : Inserting sp|O14979|HNRDL_HUMAN
15 Dec 2023 01:12:01,829 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:01,829 INFO : Inserting sp|O14980|XPO1_HUMAN
15 Dec 2023 01:12:01,976 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:01,976 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 01:12:02,402 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:12:02,402 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 01:12:02,595 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:02,595 INFO : Inserting sp|O15116|LSM1_HUMAN
15 Dec 2023 01:12:02,657 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:02,657 INFO : Inserting sp|O15117|FYB1_HUMAN
15 Dec 2023 01:12:02,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:02,686 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 01:12:02,989 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:12:02,989 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:12:03,573 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:12:03,573 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:12:03,683 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:03,683 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 01:12:03,835 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:03,835 INFO : Inserting sp|O15240|VGF_HUMAN
15 Dec 2023 01:12:03,951 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:03,951 INFO : Inserting sp|O15297|PPM1D_HUMAN
15 Dec 2023 01:12:03,966 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:03,966 INFO : Inserting sp|O15354|GPR37_HUMAN
15 Dec 2023 01:12:03,998 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:03,998 INFO : Inserting sp|O15371|EIF3D_HUMAN
15 Dec 2023 01:12:04,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:04,031 INFO : Inserting sp|O15372|EIF3H_HUMAN
15 Dec 2023 01:12:04,067 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:04,068 INFO : Inserting sp|O15389|SIGL5_HUMAN
15 Dec 2023 01:12:04,215 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:04,215 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:12:04,580 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:04,580 INFO : Inserting sp|O15400|STX7_HUMAN
15 Dec 2023 01:12:04,615 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:04,615 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 01:12:04,674 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:04,674 INFO : Inserting sp|O43143|DHX15_HUMAN
15 Dec 2023 01:12:04,895 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:04,895 INFO : Inserting sp|O43157|PLXB1_HUMAN
15 Dec 2023 01:12:04,953 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:04,953 INFO : Inserting sp|O43242|PSMD3_HUMAN
15 Dec 2023 01:12:05,002 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:05,002 INFO : Inserting sp|O43252|PAPS1_HUMAN
15 Dec 2023 01:12:05,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,036 INFO : Inserting sp|O43286|B4GT5_HUMAN
15 Dec 2023 01:12:05,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,065 INFO : Inserting sp|O43390|HNRPR_HUMAN
15 Dec 2023 01:12:05,097 INFO : 3% Done
15 Dec 2023 01:12:05,132 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:05,132 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 01:12:05,200 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:05,200 INFO : Inserting sp|O43405|COCH_HUMAN
15 Dec 2023 01:12:05,249 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:05,249 INFO : Inserting sp|O43447|PPIH_HUMAN
15 Dec 2023 01:12:05,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,281 INFO : Inserting sp|O43451|MGA_HUMAN
15 Dec 2023 01:12:05,537 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:05,537 INFO : Inserting sp|O43488|ARK72_HUMAN
15 Dec 2023 01:12:05,576 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,576 INFO : Inserting sp|O43491|E41L2_HUMAN
15 Dec 2023 01:12:05,609 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,609 INFO : Inserting sp|O43504|LTOR5_HUMAN
15 Dec 2023 01:12:05,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:05,649 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:12:05,953 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.3_F4_S2-A3_1_2821.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1143.5737, EGANYALVIDVDM[+16.0]VPSEGLWR, 2
15 Dec 2023 01:12:05,953 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6666.24_F4_S2-E4_1_2921.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1143.5737, EGANYALVIDVDM[+16.0]VPSEGLWR, 2
15 Dec 2023 01:12:06,146 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:06,146 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 01:12:06,242 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:06,242 INFO : Inserting sp|O43581|SYT7_HUMAN
15 Dec 2023 01:12:06,358 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:06,358 INFO : Inserting sp|O43592|XPOT_HUMAN
15 Dec 2023 01:12:06,461 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:06,461 INFO : Inserting sp|O43684|BUB3_HUMAN
15 Dec 2023 01:12:06,531 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:06,531 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:12:06,862 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.22_F4_S2-D3_1_2846.d. SKYD file may be out of sync with primary Skyline document. Transition M - 980.4836, AIM[+16.0]TYVSSFYHAFSGAQK, 2
15 Dec 2023 01:12:07,348 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:12:07,348 INFO : Inserting sp|O43747|AP1G1_HUMAN
15 Dec 2023 01:12:07,419 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:07,419 INFO : Inserting sp|O43761|SNG3_HUMAN
15 Dec 2023 01:12:07,455 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:07,455 INFO : Inserting sp|O43776|SYNC_HUMAN
15 Dec 2023 01:12:07,609 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:07,609 INFO : Inserting sp|O43809|CPSF5_HUMAN
15 Dec 2023 01:12:07,684 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:07,684 INFO : Inserting sp|O43815|STRN_HUMAN
15 Dec 2023 01:12:07,762 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:07,762 INFO : Inserting sp|O43827|ANGL7_HUMAN
15 Dec 2023 01:12:07,834 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:07,834 INFO : Inserting sp|O43847|NRDC_HUMAN
15 Dec 2023 01:12:07,900 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:07,901 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 01:12:08,128 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:08,128 INFO : Inserting sp|O60216|RAD21_HUMAN
15 Dec 2023 01:12:08,202 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:08,202 INFO : Inserting sp|O60231|DHX16_HUMAN
15 Dec 2023 01:12:08,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,236 INFO : Inserting sp|O60241|AGRB2_HUMAN
15 Dec 2023 01:12:08,275 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,275 INFO : Inserting sp|O60243|H6ST1_HUMAN
15 Dec 2023 01:12:08,314 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,314 INFO : Inserting sp|O60256|KPRB_HUMAN
15 Dec 2023 01:12:08,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,352 INFO : Inserting sp|O60346|PHLP1_HUMAN
15 Dec 2023 01:12:08,393 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,393 INFO : Inserting sp|O60449|LY75_HUMAN
15 Dec 2023 01:12:08,500 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:08,500 INFO : Imported 100 peptide groups.
15 Dec 2023 01:12:08,500 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 01:12:08,662 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:08,662 INFO : Inserting sp|O60488|ACSL4_HUMAN
15 Dec 2023 01:12:08,692 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:08,693 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 01:12:08,820 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:08,821 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:12:09,154 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:12:09,154 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:12:09,345 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:09,345 INFO : Inserting sp|O60664|PLIN3_HUMAN
15 Dec 2023 01:12:09,379 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:09,379 INFO : Inserting sp|O60763|USO1_HUMAN
15 Dec 2023 01:12:09,514 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:09,514 INFO : Inserting sp|O60784|TOM1_HUMAN
15 Dec 2023 01:12:09,555 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:09,555 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:12:09,716 INFO : 4% Done
15 Dec 2023 01:12:09,850 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:12:09,850 INFO : Inserting sp|O60825|F262_HUMAN
15 Dec 2023 01:12:09,883 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:09,883 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 01:12:10,013 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:10,013 INFO : Inserting sp|O60928|KCJ13_HUMAN
15 Dec 2023 01:12:10,046 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:10,046 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:12:10,205 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:10,205 INFO : Inserting sp|O75019|LIRA1_HUMAN
15 Dec 2023 01:12:10,250 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:10,250 INFO : Inserting sp|O75022|LIRB3_HUMAN
15 Dec 2023 01:12:10,314 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:10,314 INFO : Inserting sp|O75078|ADA11_HUMAN
15 Dec 2023 01:12:10,345 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:10,345 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:12:10,931 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:12:10,931 INFO : Inserting sp|O75116|ROCK2_HUMAN
15 Dec 2023 01:12:11,004 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:11,004 INFO : Inserting sp|O75131|CPNE3_HUMAN
15 Dec 2023 01:12:11,158 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:11,158 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 01:12:11,378 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:11,379 INFO : Inserting sp|O75165|DJC13_HUMAN
15 Dec 2023 01:12:11,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:11,414 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 01:12:11,440 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:11,440 INFO : Inserting sp|O75251|NDUS7_HUMAN
15 Dec 2023 01:12:11,472 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:11,472 INFO : Inserting sp|O75323|NIPS2_HUMAN
15 Dec 2023 01:12:11,537 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:11,537 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 01:12:11,805 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:11,805 INFO : Inserting sp|O75340|PDCD6_HUMAN
15 Dec 2023 01:12:11,829 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:11,829 INFO : Inserting sp|O75348|VATG1_HUMAN
15 Dec 2023 01:12:11,858 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:11,858 INFO : Inserting sp|O75351|VPS4B_HUMAN
15 Dec 2023 01:12:11,891 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:11,891 INFO : Inserting sp|O75354|ENTP6_HUMAN
15 Dec 2023 01:12:11,930 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:11,931 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 01:12:12,113 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:12,113 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 01:12:12,240 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:12,240 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:12:12,444 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:12,445 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:12:12,635 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:12,636 INFO : Inserting sp|O75396|SC22B_HUMAN
15 Dec 2023 01:12:12,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:12,649 INFO : Inserting sp|O75436|VP26A_HUMAN
15 Dec 2023 01:12:12,757 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:12,757 INFO : Inserting sp|O75503|CLN5_HUMAN
15 Dec 2023 01:12:12,787 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:12,787 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 01:12:12,850 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:12,850 INFO : Inserting sp|O75531|BAF_HUMAN
15 Dec 2023 01:12:12,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:12,889 INFO : Inserting sp|O75534|CSDE1_HUMAN
15 Dec 2023 01:12:12,925 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:12,925 INFO : Inserting sp|O75563|SKAP2_HUMAN
15 Dec 2023 01:12:13,069 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:13,070 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:12:13,283 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:13,283 INFO : Inserting sp|O75608|LYPA1_HUMAN
15 Dec 2023 01:12:13,419 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:13,419 INFO : Inserting sp|O75629|CREG1_HUMAN
15 Dec 2023 01:12:13,502 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:13,502 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:12:13,749 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:13,749 INFO : Inserting sp|O75643|U520_HUMAN
15 Dec 2023 01:12:13,833 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:13,833 INFO : Inserting sp|O75695|XRP2_HUMAN
15 Dec 2023 01:12:13,940 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:13,940 INFO : Inserting sp|O75746|S2512_HUMAN
15 Dec 2023 01:12:14,012 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:14,012 INFO : Inserting sp|O75752|B3GL1_HUMAN
15 Dec 2023 01:12:14,084 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:14,084 INFO : Inserting sp|O75787|RENR_HUMAN
15 Dec 2023 01:12:14,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:14,152 INFO : Inserting sp|O75821|EIF3G_HUMAN
15 Dec 2023 01:12:14,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:14,168 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 01:12:14,176 INFO : 5% Done
15 Dec 2023 01:12:14,627 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:12:14,627 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:12:15,195 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:12:15,195 INFO : Inserting sp|O75884|RBBP9_HUMAN
15 Dec 2023 01:12:15,226 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:15,227 INFO : Inserting sp|O75888|TNF13_HUMAN
15 Dec 2023 01:12:15,387 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:15,388 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 01:12:15,737 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:12:15,737 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 01:12:15,849 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:15,849 INFO : Inserting sp|O75995|SASH3_HUMAN
15 Dec 2023 01:12:15,895 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:15,895 INFO : Inserting sp|O76003|GLRX3_HUMAN
15 Dec 2023 01:12:15,932 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:15,932 INFO : Inserting sp|O76061|STC2_HUMAN
15 Dec 2023 01:12:16,018 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:16,018 INFO : Inserting sp|O76071|CIAO1_HUMAN
15 Dec 2023 01:12:16,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:16,052 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 01:12:16,127 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:16,128 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:12:16,410 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:16,410 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 01:12:16,440 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:16,440 INFO : Inserting sp|O94811|TPPP_HUMAN
15 Dec 2023 01:12:16,503 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:16,503 INFO : Inserting sp|O94826|TOM70_HUMAN
15 Dec 2023 01:12:16,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:16,533 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 01:12:16,748 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:16,748 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 01:12:16,892 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:16,892 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 01:12:17,107 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:17,107 INFO : Inserting sp|O94973|AP2A2_HUMAN
15 Dec 2023 01:12:17,261 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:17,262 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:12:17,832 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:12:17,832 INFO : Inserting sp|O95166|GBRAP_HUMAN
15 Dec 2023 01:12:17,868 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:17,868 INFO : Inserting sp|O95168|NDUB4_HUMAN
15 Dec 2023 01:12:17,911 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:17,912 INFO : Inserting sp|O95202|LETM1_HUMAN
15 Dec 2023 01:12:17,969 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:17,969 INFO : Inserting sp|O95210|STBD1_HUMAN
15 Dec 2023 01:12:17,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:17,999 INFO : Inserting sp|O95319|CELF2_HUMAN
15 Dec 2023 01:12:18,022 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:18,022 INFO : Inserting sp|O95342|ABCBB_HUMAN
15 Dec 2023 01:12:18,063 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:18,063 INFO : Inserting sp|O95352|ATG7_HUMAN
15 Dec 2023 01:12:18,239 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:18,239 INFO : Inserting sp|O95372|LYPA2_HUMAN
15 Dec 2023 01:12:18,276 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:18,276 INFO : Inserting sp|O95428|PPN_HUMAN
15 Dec 2023 01:12:18,330 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:18,330 INFO : Inserting sp|O95433|AHSA1_HUMAN
15 Dec 2023 01:12:18,391 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:18,391 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 01:12:18,459 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.28_F4_S2-E3_1_2854.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1013.5062, EELATFDPVDNIVFNMAAGSAPM[+16.0]QLHLR, 3
15 Dec 2023 01:12:18,643 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:18,643 INFO : Inserting sp|O95466|FMNL1_HUMAN
15 Dec 2023 01:12:18,650 INFO : 6% Done
15 Dec 2023 01:12:18,831 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:18,832 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 01:12:18,991 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:18,991 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:12:19,185 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:19,185 INFO : Inserting sp|O95498|VNN2_HUMAN
15 Dec 2023 01:12:19,274 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:19,274 INFO : Inserting sp|O95544|NADK_HUMAN
15 Dec 2023 01:12:19,307 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:19,308 INFO : Inserting sp|O95670|VATG2_HUMAN
15 Dec 2023 01:12:19,366 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:19,366 INFO : Inserting sp|O95711|LY86_HUMAN
15 Dec 2023 01:12:19,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:19,401 INFO : Inserting sp|O95777|LSM8_HUMAN
15 Dec 2023 01:12:19,462 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:19,462 INFO : Inserting sp|O95782|AP2A1_HUMAN
15 Dec 2023 01:12:19,760 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:12:19,760 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:12:19,796 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:19,796 INFO : Inserting sp|O95831|AIFM1_HUMAN
15 Dec 2023 01:12:19,900 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:19,900 INFO : Inserting sp|O95834|EMAL2_HUMAN
15 Dec 2023 01:12:20,176 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:20,176 INFO : Inserting sp|O95861|BPNT1_HUMAN
15 Dec 2023 01:12:20,239 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:20,239 INFO : Inserting sp|O95897|NOE2_HUMAN
15 Dec 2023 01:12:20,279 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:20,280 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 01:12:20,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:20,332 INFO : Inserting sp|O95989|NUDT3_HUMAN
15 Dec 2023 01:12:20,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:20,364 INFO : Inserting sp|O95998|I18BP_HUMAN
15 Dec 2023 01:12:20,422 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:20,423 INFO : Inserting sp|O96000|NDUBA_HUMAN
15 Dec 2023 01:12:20,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:20,468 INFO : Inserting sp|O96019|ACL6A_HUMAN
15 Dec 2023 01:12:20,508 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:20,508 INFO : Imported 200 peptide groups.
15 Dec 2023 01:12:20,508 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:12:20,971 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.9_F4_S2-B3_1_2829.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1032.5360, GYTSWAIGLSVADLAESIM[+16.0]K, 2
15 Dec 2023 01:12:21,165 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:12:21,165 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 01:12:21,299 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:21,299 INFO : Inserting sp|P00367|DHE3_HUMAN
15 Dec 2023 01:12:21,441 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:21,441 INFO : Inserting sp|P00387|NB5R3_HUMAN
15 Dec 2023 01:12:21,529 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:21,529 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:12:21,947 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:21,947 INFO : Inserting sp|P00403|COX2_HUMAN
15 Dec 2023 01:12:21,987 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:21,988 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:12:22,181 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:22,181 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:12:22,935 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.47_F4_S2-H3_1_2881.d. SKYD file may be out of sync with primary Skyline document. Transition M - 935.4575, WYLFGM[+16.0]GNEVDVHAAFFHGQALTNK, 3
15 Dec 2023 01:12:23,359 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.15_F4_S2-C3_1_2837.d. SKYD file may be out of sync with primary Skyline document. Transition M - 767.0608, M[+16.0]YYSAVDPTKDIFTGLIGPMK, 3
15 Dec 2023 01:12:23,359 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.41_F4_S2-G3_1_2873.d. SKYD file may be out of sync with primary Skyline document. Transition M - 767.0608, M[+16.0]YYSAVDPTKDIFTGLIGPMK, 3
15 Dec 2023 01:12:23,359 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6666.11_F4_S2-C4_1_2905.d. SKYD file may be out of sync with primary Skyline document. Transition M - 767.0608, M[+16.0]YYSAVDPTKDIFTGLIGPMK, 3
15 Dec 2023 01:12:23,361 INFO : 7% Done
15 Dec 2023 01:12:23,758 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:24,636 DEBUG: Total peptides inserted: 82
15 Dec 2023 01:12:24,636 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:12:24,863 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:24,864 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:12:25,379 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6666.7_F4_S2-B4_1_2897.d. SKYD file may be out of sync with primary Skyline document. Transition M - 927.0246, LEQFVSILM[+16.0]ASIPLPDK, 2
15 Dec 2023 01:12:25,398 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:25,398 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 01:12:25,721 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:12:25,721 INFO : Inserting sp|P00505|AATM_HUMAN
15 Dec 2023 01:12:26,118 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:26,118 INFO : Inserting sp|P00533|EGFR_HUMAN
15 Dec 2023 01:12:26,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:26,156 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:12:27,433 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:12:27,433 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 01:12:27,473 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:27,473 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:12:28,004 INFO : 8% Done
15 Dec 2023 01:12:28,654 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:12:28,654 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:12:29,686 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:12:29,686 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 01:12:30,332 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:12:30,332 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 01:12:30,758 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:30,758 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 01:12:30,902 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:30,902 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:12:30,994 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:30,994 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 01:12:31,214 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:31,214 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:12:31,467 INFO : 9% Done
15 Dec 2023 01:12:31,871 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:31,947 DEBUG: Total peptides inserted: 55
15 Dec 2023 01:12:31,947 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:12:32,179 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:12:32,179 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:12:32,968 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:33,013 DEBUG: Total peptides inserted: 51
15 Dec 2023 01:12:33,013 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:12:33,256 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:12:33,257 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 01:12:33,424 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:33,424 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:12:33,545 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6666.3_F4_S2-A4_1_2889.d. SKYD file may be out of sync with primary Skyline document. Transition M - 940.9678, FATTFYQHLADSKNDNDNIFLSPLSISTAFAM[+16.0]TK, 4
15 Dec 2023 01:12:33,681 INFO : 10% Done
15 Dec 2023 01:12:34,286 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:12:34,286 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:12:34,842 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\CSF\Data\F4\CSF_6653.35_F4_S2-F3_1_2862.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1106.0719, GTEAAGAM[+16.0]FLEAIPMSIPPEVK, 2
15 Dec 2023 01:12:34,970 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:12:34,970 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:12:35,922 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:12:35,922 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:12:36,273 INFO : 11% Done
15 Dec 2023 01:12:36,474 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:12:36,474 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:12:37,405 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:37,973 DEBUG: Total peptides inserted: 81
15 Dec 2023 01:12:37,973 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:12:38,698 INFO : 12% Done
15 Dec 2023 01:12:38,926 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:39,756 DEBUG: Inserted 100 peptides
15 Dec 2023 01:12:40,642 DEBUG: Inserted 150 peptides
15 Dec 2023 01:12:40,827 INFO : 13% Done
15 Dec 2023 01:12:41,066 DEBUG: Total peptides inserted: 177
15 Dec 2023 01:12:41,066 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:12:41,876 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:42,489 DEBUG: Total peptides inserted: 82
15 Dec 2023 01:12:42,489 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:12:42,668 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:42,668 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:12:42,938 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:42,938 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 01:12:42,972 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:42,972 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:12:43,130 INFO : 14% Done
15 Dec 2023 01:12:43,400 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:12:43,400 INFO : Inserting sp|P01130|LDLR_HUMAN
15 Dec 2023 01:12:43,430 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:43,430 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 01:12:43,470 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,470 INFO : Inserting sp|P01236|PRL_HUMAN
15 Dec 2023 01:12:43,583 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:43,583 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 01:12:43,617 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,617 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 01:12:43,698 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:43,698 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 01:12:43,717 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:43,717 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 01:12:43,735 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:43,735 INFO : Inserting sp|P01597|KV139_HUMAN
15 Dec 2023 01:12:43,793 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,793 INFO : Inserting sp|P01602|KV105_HUMAN
15 Dec 2023 01:12:43,819 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:43,819 INFO : Inserting sp|P01611|KVD12_HUMAN
15 Dec 2023 01:12:43,865 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,865 INFO : Inserting sp|P01615|KVD28_HUMAN
15 Dec 2023 01:12:43,880 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:43,880 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 01:12:43,921 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,921 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 01:12:43,978 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:43,978 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 01:12:43,994 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:43,994 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 01:12:44,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:44,019 INFO : Inserting sp|P01742|HV169_HUMAN
15 Dec 2023 01:12:44,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:44,028 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 01:12:44,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:44,038 INFO : Inserting sp|P01762|HV311_HUMAN
15 Dec 2023 01:12:44,105 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:44,105 INFO : Inserting sp|P01764|HV323_HUMAN
15 Dec 2023 01:12:44,165 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:44,165 INFO : Inserting sp|P01767|HV353_HUMAN
15 Dec 2023 01:12:44,226 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:44,226 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 01:12:44,299 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:44,299 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 01:12:44,356 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:44,356 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 01:12:44,409 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:44,409 INFO : Inserting sp|P01817|HV205_HUMAN
15 Dec 2023 01:12:44,428 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:44,428 INFO : Inserting sp|P01824|HV439_HUMAN
15 Dec 2023 01:12:44,444 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:44,444 INFO : Inserting sp|P01825|HV459_HUMAN
15 Dec 2023 01:12:44,459 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:44,459 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:12:44,601 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:44,601 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:12:44,881 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:12:44,881 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:12:45,157 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:12:45,157 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:12:45,259 INFO : 15% Done
15 Dec 2023 01:12:45,423 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:12:45,423 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:12:45,631 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:45,631 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:12:45,927 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:12:45,927 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:12:46,208 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:46,208 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 01:12:46,323 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:46,323 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:12:46,427 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:46,427 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 01:12:46,489 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:46,490 INFO : Inserting sp|P01893|HLAH_HUMAN
15 Dec 2023 01:12:46,509 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:46,509 INFO : Inserting sp|P01903|DRA_HUMAN
15 Dec 2023 01:12:46,563 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:46,563 INFO : Inserting sp|P01909|DQA1_HUMAN
15 Dec 2023 01:12:46,606 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:46,606 INFO : Inserting sp|P01911|DRB1_HUMAN
15 Dec 2023 01:12:46,647 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:46,647 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:12:46,981 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:46,981 INFO : Inserting sp|P02100|HBE_HUMAN
15 Dec 2023 01:12:47,017 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:47,017 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:12:47,261 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:47,262 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 01:12:47,423 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:12:47,424 INFO : Inserting sp|P02462|CO4A1_HUMAN
15 Dec 2023 01:12:47,479 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:12:47,479 INFO : Inserting sp|P02511|CRYAB_HUMAN
15 Dec 2023 01:12:47,502 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:47,502 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 01:12:47,614 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:12:47,615 INFO : Inserting sp|P02538|K2C6A_HUMAN
15 Dec 2023 01:12:47,749 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:47,749 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 01:12:47,756 INFO : 16% Done
15 Dec 2023 01:12:47,769 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:47,769 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:12:48,249 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:12:48,249 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:12:48,703 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:12:48,703 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:12:48,828 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:48,828 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 01:12:48,890 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:48,891 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 01:12:48,908 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:48,908 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 01:12:48,924 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:48,925 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:12:49,492 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:12:49,492 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:12:49,975 INFO : 17% Done
15 Dec 2023 01:12:50,041 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:12:50,041 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:12:50,566 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:12:50,566 INFO : Inserting sp|P02686|MBP_HUMAN
15 Dec 2023 01:12:50,657 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:50,657 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:12:50,777 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:50,777 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 01:12:50,859 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:50,859 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:12:50,940 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:12:50,940 INFO : Imported 300 peptide groups.
15 Dec 2023 01:12:50,940 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:12:51,122 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:12:51,123 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:12:51,324 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:12:51,324 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:12:51,388 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:12:51,389 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:12:51,669 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:12:51,669 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:12:51,997 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:12:51,997 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:12:52,208 INFO : 18% Done
15 Dec 2023 01:12:52,279 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:12:52,279 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:12:53,059 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:53,844 DEBUG: Inserted 100 peptides
15 Dec 2023 01:12:53,913 DEBUG: Total peptides inserted: 104
15 Dec 2023 01:12:53,913 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:12:54,081 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:12:54,081 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:12:54,235 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:12:54,235 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:12:54,384 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:54,384 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:12:54,425 INFO : 19% Done
15 Dec 2023 01:12:54,612 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:12:54,613 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:12:55,021 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:12:55,021 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:12:55,936 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:56,224 DEBUG: Total peptides inserted: 67
15 Dec 2023 01:12:56,224 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:12:56,635 INFO : 20% Done
15 Dec 2023 01:12:56,982 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:12:56,983 INFO : Inserting sp|P02778|CXL10_HUMAN
15 Dec 2023 01:12:57,001 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:12:57,001 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 01:12:57,176 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:12:57,177 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:12:57,987 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:12:57,987 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:12:58,759 DEBUG: Inserted 50 peptides
15 Dec 2023 01:12:58,774 DEBUG: Total peptides inserted: 50
15 Dec 2023 01:12:58,774 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:12:58,823 INFO : 21% Done
15 Dec 2023 01:12:59,462 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:12:59,463 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 01:12:59,585 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:12:59,586 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 01:12:59,658 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:12:59,658 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:12:59,856 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:12:59,856 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:13:00,236 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:13:00,237 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:13:00,608 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:13:00,608 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:13:00,892 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:13:00,893 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 01:13:01,144 INFO : 22% Done
15 Dec 2023 01:13:01,317 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:01,317 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:13:01,406 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:01,406 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 01:13:01,580 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:01,580 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:13:02,038 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:13:02,038 INFO : Inserting sp|P04080|CYTB_HUMAN
15 Dec 2023 01:13:02,088 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:02,088 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:13:02,389 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:13:02,390 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:13:03,262 DEBUG: Inserted 50 peptides
15 Dec 2023 01:13:03,612 INFO : 23% Done
15 Dec 2023 01:13:04,240 DEBUG: Inserted 100 peptides
15 Dec 2023 01:13:05,011 DEBUG: Inserted 150 peptides
15 Dec 2023 01:13:05,691 DEBUG: Total peptides inserted: 191
15 Dec 2023 01:13:05,691 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 01:13:05,710 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:05,710 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:13:05,797 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:05,798 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:13:05,848 INFO : 24% Done
15 Dec 2023 01:13:05,905 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:05,905 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:13:06,271 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:13:06,272 INFO : Inserting sp|P04216|THY1_HUMAN
15 Dec 2023 01:13:06,377 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:06,378 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:13:06,764 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:13:06,764 INFO : Inserting sp|P04233|HG2A_HUMAN
15 Dec 2023 01:13:06,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:06,784 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 01:13:07,160 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:13:07,160 INFO : Inserting sp|P04271|S100B_HUMAN
15 Dec 2023 01:13:07,178 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:07,178 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 01:13:07,525 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:13:07,525 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:13:07,695 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:07,695 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:13:08,223 INFO : 25% Done
15 Dec 2023 01:13:08,400 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:13:08,400 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 01:13:08,470 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:08,471 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 01:13:08,544 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:08,544 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 01:13:08,633 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:08,633 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:13:08,764 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:08,765 INFO : Inserting sp|P04843|RPN1_HUMAN
15 Dec 2023 01:13:08,781 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:08,781 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 01:13:08,832 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:08,832 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:13:09,027 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:09,027 INFO : Inserting sp|P05019|IGF1_HUMAN
15 Dec 2023 01:13:09,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:09,037 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 01:13:09,126 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:09,126 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 01:13:09,166 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:09,166 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 01:13:09,253 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:09,253 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 01:13:09,466 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:13:09,466 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:13:09,715 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:13:09,715 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 01:13:09,809 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:09,809 INFO : Inserting sp|P05091|ALDH2_HUMAN
15 Dec 2023 01:13:09,899 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:09,899 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 01:13:10,169 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:10,169 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:13:10,460 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:10,460 INFO : Inserting sp|P05120|PAI2_HUMAN
15 Dec 2023 01:13:10,546 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:10,546 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 01:13:10,660 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:10,660 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:13:10,823 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:10,824 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:13:11,339 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:13:11,339 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:13:11,694 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:11,694 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 01:13:11,859 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:11,859 INFO : Inserting sp|P05161|ISG15_HUMAN
15 Dec 2023 01:13:11,880 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:11,881 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:13:12,831 DEBUG: Inserted 50 peptides
15 Dec 2023 01:13:12,948 DEBUG: Total peptides inserted: 57
15 Dec 2023 01:13:12,948 INFO : Inserting sp|P05198|IF2A_HUMAN
15 Dec 2023 01:13:12,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:12,972 INFO : Inserting sp|P05231|IL6_HUMAN
15 Dec 2023 01:13:13,043 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:13,043 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 01:13:13,069 INFO : 26% Done
15 Dec 2023 01:13:13,125 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:13,125 INFO : Inserting sp|P05386|RLA1_HUMAN
15 Dec 2023 01:13:13,169 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:13,170 INFO : Inserting sp|P05387|RLA2_HUMAN
15 Dec 2023 01:13:13,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:13,217 INFO : Inserting sp|P05388|RLA0_HUMAN
15 Dec 2023 01:13:13,263 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:13,264 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 01:13:13,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:13,287 INFO : Inserting sp|P05413|FABPH_HUMAN
15 Dec 2023 01:13:13,333 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:13,333 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 01:13:13,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:13,372 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 01:13:13,668 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:13,668 INFO : Inserting sp|P05455|LA_HUMAN
15 Dec 2023 01:13:13,827 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:13,827 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:13:14,252 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:13:14,253 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:13:14,650 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:13:14,650 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 01:13:14,700 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:14,700 INFO : Inserting sp|P05771|KPCB_HUMAN
15 Dec 2023 01:13:14,767 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:14,768 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 01:13:14,828 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:14,828 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 01:13:14,865 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:14,865 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:13:15,030 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:15,030 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 01:13:15,074 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:15,074 INFO : Inserting sp|P06331|HV434_HUMAN
15 Dec 2023 01:13:15,091 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:15,091 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:13:15,683 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:13:15,683 INFO : Inserting sp|P06576|ATPB_HUMAN
15 Dec 2023 01:13:15,734 INFO : 27% Done
15 Dec 2023 01:13:15,914 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:13:15,914 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:13:16,403 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:13:16,403 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:13:16,716 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:16,716 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 01:13:17,041 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:13:17,041 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:13:17,513 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:13:17,513 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:13:17,919 INFO : 28% Done
15 Dec 2023 01:13:18,045 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:13:18,045 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:13:18,530 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:13:18,530 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 01:13:18,574 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:18,574 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 01:13:18,729 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:18,729 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:13:18,934 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:18,934 INFO : Imported 400 peptide groups.
15 Dec 2023 01:13:18,934 INFO : Inserting sp|P07108|ACBP_HUMAN
15 Dec 2023 01:13:18,955 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:18,955 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:13:19,287 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:19,287 INFO : Inserting sp|P07196|NFL_HUMAN
15 Dec 2023 01:13:19,318 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:19,318 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 01:13:19,359 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:19,359 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 01:13:19,516 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:19,516 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:13:19,860 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:13:19,860 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 01:13:19,981 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:19,981 INFO : Inserting sp|P07305|H10_HUMAN
15 Dec 2023 01:13:20,020 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:20,020 INFO : Inserting sp|P07307|ASGR2_HUMAN
15 Dec 2023 01:13:20,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:20,039 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 01:13:20,205 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:20,205 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:13:20,347 INFO : 29% Done
15 Dec 2023 01:13:20,530 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:13:20,530 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 01:13:20,708 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:20,708 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:13:21,041 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:13:21,041 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:13:21,400 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:13:21,400 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 01:13:21,445 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:21,445 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 01:13:21,589 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:21,590 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 01:13:21,779 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:13:21,779 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:13:22,039 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:13:22,039 INFO : Inserting sp|P07451|CAH3_HUMAN
15 Dec 2023 01:13:22,071 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:22,071 INFO : Inserting sp|P07585|PGS2_HUMAN
15 Dec 2023 01:13:22,115 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:22,115 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:13:22,443 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:22,444 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 01:13:22,507 INFO : 30% Done
15 Dec 2023 01:13:22,530 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:22,530 INFO : Inserting sp|P07711|CATL1_HUMAN
15 Dec 2023 01:13:22,603 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:22,603 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:13:22,774 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:22,774 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 01:13:22,806 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:22,806 INFO : Inserting sp|P07741|APT_HUMAN
15 Dec 2023 01:13:22,851 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:22,851 INFO : Inserting sp|P07814|SYEP_HUMAN
15 Dec 2023 01:13:22,918 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:22,918 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 01:13:23,145 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:23,145 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:13:23,413 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:13:23,413 INFO : Inserting sp|P07902|GALT_HUMAN
15 Dec 2023 01:13:23,433 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:23,433 INFO : Inserting sp|P07910|HNRPC_HUMAN
15 Dec 2023 01:13:23,476 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:23,476 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 01:13:23,522 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:23,522 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 01:13:23,665 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:23,666 INFO : Inserting sp|P07954|FUMH_HUMAN
15 Dec 2023 01:13:23,778 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:23,778 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:13:23,970 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:23,970 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:13:24,011 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:24,011 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:13:24,266 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:24,267 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 01:13:24,652 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:13:24,652 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:13:24,939 INFO : 31% Done
15 Dec 2023 01:13:25,035 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:13:25,035 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 01:13:25,176 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:25,176 INFO : Inserting sp|P08236|BGLR_HUMAN
15 Dec 2023 01:13:25,253 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:25,253 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:13:25,485 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:25,485 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:13:25,706 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:25,706 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:13:26,065 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:13:26,065 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:13:26,227 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:26,227 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:13:26,393 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:26,393 INFO : Inserting sp|P08473|NEP_HUMAN
15 Dec 2023 01:13:26,425 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:26,425 INFO : Inserting sp|P08476|INHBA_HUMAN
15 Dec 2023 01:13:26,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:26,435 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 01:13:26,454 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:26,454 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 01:13:26,518 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:26,518 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 01:13:26,609 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:26,609 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:13:27,072 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:13:27,072 INFO : Inserting sp|P08572|CO4A2_HUMAN
15 Dec 2023 01:13:27,161 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:27,161 INFO : Inserting sp|P08574|CY1_HUMAN
15 Dec 2023 01:13:27,187 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:27,187 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:13:27,319 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:27,319 INFO : Inserting sp|P08579|RU2B_HUMAN
15 Dec 2023 01:13:27,329 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:27,329 INFO : Inserting sp|P08581|MET_HUMAN
15 Dec 2023 01:13:27,336 INFO : 32% Done
15 Dec 2023 01:13:27,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:27,349 INFO : Inserting sp|P08582|TRFM_HUMAN
15 Dec 2023 01:13:27,395 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:27,395 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:13:28,086 DEBUG: Inserted 50 peptides
15 Dec 2023 01:13:28,265 DEBUG: Total peptides inserted: 67
15 Dec 2023 01:13:28,265 INFO : Inserting sp|P08631|HCK_HUMAN
15 Dec 2023 01:13:28,395 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:28,395 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 01:13:28,465 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:28,465 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 01:13:28,770 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:13:28,771 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:13:29,135 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:13:29,135 INFO : Inserting sp|P08708|RS17_HUMAN
15 Dec 2023 01:13:29,154 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:29,154 INFO : Inserting sp|P08709|FA7_HUMAN
15 Dec 2023 01:13:29,172 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:29,172 INFO : Inserting sp|P08754|GNAI3_HUMAN
15 Dec 2023 01:13:29,234 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:29,234 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 01:13:29,465 INFO : 33% Done
15 Dec 2023 01:13:29,506 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:13:29,506 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:13:29,594 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:29,594 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:13:29,621 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:29,621 INFO : Inserting sp|P09012|SNRPA_HUMAN
15 Dec 2023 01:13:29,631 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:29,631 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 01:13:29,788 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:29,788 INFO : Inserting sp|P09110|THIK_HUMAN
15 Dec 2023 01:13:29,807 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:29,807 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 01:13:29,901 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:29,902 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:13:30,057 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:30,057 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 01:13:30,089 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:30,089 INFO : Inserting sp|P09327|VILI_HUMAN
15 Dec 2023 01:13:30,109 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:30,109 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 01:13:30,164 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:30,164 INFO : Inserting sp|P09417|DHPR_HUMAN
15 Dec 2023 01:13:30,220 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:30,220 INFO : Inserting sp|P09429|HMGB1_HUMAN
15 Dec 2023 01:13:30,311 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:30,311 INFO : Inserting sp|P09467|F16P1_HUMAN
15 Dec 2023 01:13:30,476 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:30,476 INFO : Inserting sp|P09471|GNAO_HUMAN
15 Dec 2023 01:13:30,520 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:30,520 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:13:30,736 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:30,736 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 01:13:30,834 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:30,834 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 01:13:31,132 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:13:31,132 INFO : Inserting sp|P09603|CSF1_HUMAN
15 Dec 2023 01:13:31,237 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:31,237 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 01:13:31,323 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:31,323 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 01:13:31,410 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:31,411 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:13:31,525 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:31,525 INFO : Inserting sp|P09661|RU2A_HUMAN
15 Dec 2023 01:13:31,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:31,542 INFO : Inserting sp|P09668|CATH_HUMAN
15 Dec 2023 01:13:31,693 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:31,694 INFO : Inserting sp|P09669|COX6C_HUMAN
15 Dec 2023 01:13:31,712 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:31,712 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 01:13:31,778 INFO : 34% Done
15 Dec 2023 01:13:31,847 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:31,847 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:13:32,223 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:13:32,223 INFO : Inserting sp|P09874|PARP1_HUMAN
15 Dec 2023 01:13:32,241 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:32,241 INFO : Inserting sp|P09913|IFIT2_HUMAN
15 Dec 2023 01:13:32,263 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:32,263 INFO : Inserting sp|P09917|LOX5_HUMAN
15 Dec 2023 01:13:32,311 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:32,311 INFO : Inserting sp|P09936|UCHL1_HUMAN
15 Dec 2023 01:13:32,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:32,331 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:13:32,833 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:13:32,833 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 01:13:33,090 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:33,090 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:13:34,377 DEBUG: Inserted 50 peptides
15 Dec 2023 01:13:34,403 INFO : 35% Done
15 Dec 2023 01:13:35,681 DEBUG: Inserted 100 peptides
15 Dec 2023 01:13:35,997 DEBUG: Total peptides inserted: 113
15 Dec 2023 01:13:35,997 INFO : Imported 500 peptide groups.
15 Dec 2023 01:13:35,997 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:13:37,169 DEBUG: Inserted 50 peptides
15 Dec 2023 01:13:37,342 INFO : 36% Done
15 Dec 2023 01:13:38,121 DEBUG: Inserted 100 peptides
15 Dec 2023 01:13:38,381 DEBUG: Total peptides inserted: 114
15 Dec 2023 01:13:38,382 INFO : Inserting sp|P0C0S5|H2AZ_HUMAN
15 Dec 2023 01:13:38,434 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:38,434 INFO : Inserting sp|P0CF74|IGLC6_HUMAN
15 Dec 2023 01:13:38,540 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:38,540 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 01:13:38,675 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:38,675 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 01:13:38,802 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:38,803 INFO : Inserting sp|P0DJI8|SAA1_HUMAN
15 Dec 2023 01:13:38,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:38,833 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 01:13:38,864 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:38,864 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:13:39,270 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:39,271 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:13:39,553 INFO : 37% Done
15 Dec 2023 01:13:39,677 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:39,677 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:13:39,814 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:39,814 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:13:39,911 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:39,911 INFO : Inserting sp|P0DP23|CALM1_HUMAN
15 Dec 2023 01:13:39,927 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,927 INFO : Inserting sp|P0DP24|CALM2_HUMAN
15 Dec 2023 01:13:39,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,942 INFO : Inserting sp|P0DP25|CALM3_HUMAN
15 Dec 2023 01:13:39,958 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,958 INFO : Inserting sp|P0DP58|LYNX1_HUMAN
15 Dec 2023 01:13:39,969 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,969 INFO : Inserting sp|P0DPK2|H3Y1_HUMAN
15 Dec 2023 01:13:39,979 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,979 INFO : Inserting sp|P0DPK5|H3Y2_HUMAN
15 Dec 2023 01:13:39,989 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:39,989 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 01:13:40,014 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:40,014 INFO : Inserting sp|P10155|RO60_HUMAN
15 Dec 2023 01:13:40,078 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:40,078 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 01:13:40,142 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:40,142 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 01:13:40,153 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:40,153 INFO : Inserting sp|P10412|H14_HUMAN
15 Dec 2023 01:13:40,290 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:40,290 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 01:13:40,417 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:40,417 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 01:13:40,516 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:40,516 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:13:40,642 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:40,643 INFO : Inserting sp|P10619|PPGB_HUMAN
15 Dec 2023 01:13:40,773 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:40,773 INFO : Inserting sp|P10636|TAU_HUMAN
15 Dec 2023 01:13:40,822 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:40,822 INFO : Inserting sp|P10636-9|TAU_HUMAN
15 Dec 2023 01:13:40,870 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:40,870 INFO : Inserting sp|P10636-8|TAU_HUMAN
15 Dec 2023 01:13:40,919 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:40,919 INFO : Inserting sp|P10636-7|TAU_HUMAN
15 Dec 2023 01:13:40,967 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:40,967 INFO : Inserting sp|P10636-6|TAU_HUMAN
15 Dec 2023 01:13:41,015 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:41,015 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:13:41,659 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:13:41,660 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 01:13:41,748 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:41,748 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:13:41,826 INFO : 38% Done
15 Dec 2023 01:13:41,869 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:41,869 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 01:13:41,927 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:41,927 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:13:42,226 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:13:42,226 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 01:13:42,383 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:42,384 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 01:13:42,450 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:42,450 INFO : Inserting sp|P11055|MYH3_HUMAN
15 Dec 2023 01:13:42,462 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:42,462 INFO : Inserting sp|P11117|PPAL_HUMAN
15 Dec 2023 01:13:42,493 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:42,493 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:13:42,852 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:13:42,852 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:13:43,282 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:13:43,282 INFO : Inserting sp|P11216|PYGB_HUMAN
15 Dec 2023 01:13:43,434 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:43,435 INFO : Inserting sp|P11217|PYGM_HUMAN
15 Dec 2023 01:13:43,539 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:43,539 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 01:13:43,555 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:43,555 INFO : Inserting sp|P11233|RALA_HUMAN
15 Dec 2023 01:13:43,581 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:43,581 INFO : Inserting sp|P11234|RALB_HUMAN
15 Dec 2023 01:13:43,608 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:43,608 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 01:13:43,642 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:43,642 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 01:13:43,688 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:43,688 INFO : Inserting sp|P11310|ACADM_HUMAN
15 Dec 2023 01:13:43,706 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:43,706 INFO : Inserting sp|P11362|FGFR1_HUMAN
15 Dec 2023 01:13:43,787 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:43,787 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:13:43,882 INFO : 39% Done
15 Dec 2023 01:13:44,164 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:13:44,164 INFO : Inserting sp|P11488|GNAT1_HUMAN
15 Dec 2023 01:13:44,192 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:44,192 INFO : Inserting sp|P11597|CETP_HUMAN
15 Dec 2023 01:13:44,211 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:44,211 INFO : Inserting sp|P11678|PERE_HUMAN
15 Dec 2023 01:13:44,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:44,292 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 01:13:44,431 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:44,431 INFO : Inserting sp|P11766|ADHX_HUMAN
15 Dec 2023 01:13:44,458 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:44,458 INFO : Inserting sp|P11908|PRPS2_HUMAN
15 Dec 2023 01:13:44,491 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:44,491 INFO : Inserting sp|P11940|PABP1_HUMAN
15 Dec 2023 01:13:44,602 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:44,602 INFO : Inserting sp|P12081|HARS1_HUMAN
15 Dec 2023 01:13:44,679 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:44,679 INFO : Inserting sp|P12107|COBA1_HUMAN
15 Dec 2023 01:13:44,735 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:44,735 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:13:45,201 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:13:45,201 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 01:13:45,289 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:45,289 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:13:46,036 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:13:46,036 INFO : Inserting sp|P12235|ADT1_HUMAN
15 Dec 2023 01:13:46,162 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:46,162 INFO : Inserting sp|P12236|ADT3_HUMAN
15 Dec 2023 01:13:46,264 INFO : 40% Done
15 Dec 2023 01:13:46,344 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:46,345 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:13:47,009 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:13:47,009 INFO : Inserting sp|P12277|KCRB_HUMAN
15 Dec 2023 01:13:47,054 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:47,054 INFO : Inserting sp|P12314|FCGR1_HUMAN
15 Dec 2023 01:13:47,078 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:47,078 INFO : Inserting sp|P12318|FCG2A_HUMAN
15 Dec 2023 01:13:47,155 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:47,155 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:13:47,503 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:47,503 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 01:13:47,574 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:47,574 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:13:48,259 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:13:48,259 INFO : Inserting sp|P12821|ACE_HUMAN
15 Dec 2023 01:13:48,321 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:48,321 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 01:13:48,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:48,331 INFO : Inserting sp|P12838|DEF4_HUMAN
15 Dec 2023 01:13:48,348 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:48,348 INFO : Inserting sp|P12882|MYH1_HUMAN
15 Dec 2023 01:13:48,362 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:48,362 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 01:13:48,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:48,381 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 01:13:48,585 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:48,585 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 01:13:48,815 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:13:48,816 INFO : Inserting sp|P13284|GILT_HUMAN
15 Dec 2023 01:13:48,876 INFO : 41% Done
15 Dec 2023 01:13:48,884 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:48,884 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 01:13:48,947 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:48,947 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:13:49,298 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:13:49,298 INFO : Inserting sp|P13521|SCG2_HUMAN
15 Dec 2023 01:13:49,347 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:49,347 INFO : Inserting sp|P13535|MYH8_HUMAN
15 Dec 2023 01:13:49,360 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:49,360 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:13:49,587 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:49,587 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 01:13:49,639 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:49,639 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 01:13:49,851 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:13:49,851 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 01:13:50,123 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:50,123 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:13:50,379 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:13:50,379 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:13:50,481 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:50,481 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 01:13:50,524 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:50,524 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:13:50,946 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:13:50,946 INFO : Inserting sp|P13688|CEAM1_HUMAN
15 Dec 2023 01:13:50,972 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:50,973 INFO : Inserting sp|P13693|TCTP_HUMAN
15 Dec 2023 01:13:50,989 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:50,989 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 01:13:51,045 INFO : 42% Done
15 Dec 2023 01:13:51,092 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:51,092 INFO : Inserting sp|P13727|PRG2_HUMAN
15 Dec 2023 01:13:51,128 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:51,128 INFO : Inserting sp|P13747|HLAE_HUMAN
15 Dec 2023 01:13:51,145 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:51,145 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:13:51,828 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:13:51,828 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 01:13:52,003 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:52,004 INFO : Imported 600 peptide groups.
15 Dec 2023 01:13:52,004 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 01:13:52,121 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:52,122 INFO : Inserting sp|P13807|GYS1_HUMAN
15 Dec 2023 01:13:52,220 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:52,220 INFO : Inserting sp|P13861|KAP2_HUMAN
15 Dec 2023 01:13:52,277 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:52,277 INFO : Inserting sp|P13929|ENOB_HUMAN
15 Dec 2023 01:13:52,381 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:52,381 INFO : Inserting sp|P13987|CD59_HUMAN
15 Dec 2023 01:13:52,455 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:52,455 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 01:13:52,501 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:52,501 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 01:13:52,529 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:52,529 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 01:13:52,559 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:52,559 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 01:13:52,659 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:52,660 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 01:13:52,698 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:52,698 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 01:13:52,709 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:52,709 INFO : Inserting sp|P14324|FPPS_HUMAN
15 Dec 2023 01:13:52,719 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:52,719 INFO : Inserting sp|P14384|CBPM_HUMAN
15 Dec 2023 01:13:52,766 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:52,767 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 01:13:52,999 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:13:52,999 INFO : Inserting sp|P14550|AK1A1_HUMAN
15 Dec 2023 01:13:53,083 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:53,083 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 01:13:53,337 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:13:53,337 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:13:53,385 INFO : 43% Done
15 Dec 2023 01:13:53,848 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:13:53,848 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:13:54,077 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:13:54,077 INFO : Inserting sp|P14678|RSMB_HUMAN
15 Dec 2023 01:13:54,148 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:54,148 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:13:54,554 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:13:54,554 INFO : Inserting sp|P14854|CX6B1_HUMAN
15 Dec 2023 01:13:54,581 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:54,581 INFO : Inserting sp|P14866|HNRPL_HUMAN
15 Dec 2023 01:13:54,706 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:54,706 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 01:13:54,747 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:54,747 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 01:13:54,761 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:54,761 INFO : Inserting sp|P15121|ALDR_HUMAN
15 Dec 2023 01:13:54,885 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:54,885 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 01:13:55,066 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:13:55,066 INFO : Inserting sp|P15153|RAC2_HUMAN
15 Dec 2023 01:13:55,239 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:55,239 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 01:13:55,459 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:13:55,460 INFO : Inserting sp|P15170|ERF3A_HUMAN
15 Dec 2023 01:13:55,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:55,477 INFO : Inserting sp|P15289|ARSA_HUMAN
15 Dec 2023 01:13:55,529 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:55,529 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:13:55,661 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:55,661 INFO : Inserting sp|P15309|PPAP_HUMAN
15 Dec 2023 01:13:55,727 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:55,727 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 01:13:55,733 INFO : 44% Done
15 Dec 2023 01:13:56,005 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:13:56,005 INFO : Inserting sp|P15313|VATB1_HUMAN
15 Dec 2023 01:13:56,038 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:56,038 INFO : Inserting sp|P15328|FOLR1_HUMAN
15 Dec 2023 01:13:56,094 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:56,094 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 01:13:56,130 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:56,130 INFO : Inserting sp|P15498|VAV_HUMAN
15 Dec 2023 01:13:56,161 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:56,161 INFO : Inserting sp|P15509|CSF2R_HUMAN
15 Dec 2023 01:13:56,219 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:56,219 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 01:13:56,312 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:56,312 INFO : Inserting sp|P15559|NQO1_HUMAN
15 Dec 2023 01:13:56,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:56,328 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 01:13:56,475 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:56,475 INFO : Inserting sp|P15735|PHKG2_HUMAN
15 Dec 2023 01:13:56,493 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:56,493 INFO : Inserting sp|P15814|IGLL1_HUMAN
15 Dec 2023 01:13:56,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:56,511 INFO : Inserting sp|P15848|ARSB_HUMAN
15 Dec 2023 01:13:56,559 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:56,559 INFO : Inserting sp|P15927|RFA2_HUMAN
15 Dec 2023 01:13:56,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:56,568 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:13:56,700 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:56,700 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 01:13:56,733 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:13:56,733 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:13:56,773 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:56,773 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 01:13:56,894 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:56,894 INFO : Inserting sp|P16278|BGAL_HUMAN
15 Dec 2023 01:13:56,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:56,913 INFO : Inserting sp|P16401|H15_HUMAN
15 Dec 2023 01:13:57,017 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:57,017 INFO : Inserting sp|P16402|H13_HUMAN
15 Dec 2023 01:13:57,163 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:57,164 INFO : Inserting sp|P16403|H12_HUMAN
15 Dec 2023 01:13:57,296 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:57,296 INFO : Inserting sp|P16435|NCPR_HUMAN
15 Dec 2023 01:13:57,362 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:57,362 INFO : Inserting sp|P16671|CD36_HUMAN
15 Dec 2023 01:13:57,390 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:57,390 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:13:57,581 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:57,581 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 01:13:57,665 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:57,665 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 01:13:57,815 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:57,816 INFO : Inserting sp|P16949|STMN1_HUMAN
15 Dec 2023 01:13:57,833 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:57,833 INFO : Inserting sp|P17050|NAGAB_HUMAN
15 Dec 2023 01:13:57,924 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:57,924 INFO : Inserting sp|P17066|HSP76_HUMAN
15 Dec 2023 01:13:57,950 INFO : 45% Done
15 Dec 2023 01:13:58,068 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:58,068 INFO : Inserting sp|P17174|AATC_HUMAN
15 Dec 2023 01:13:58,252 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:13:58,252 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:13:58,408 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:13:58,408 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 01:13:58,473 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:58,473 INFO : Inserting sp|P17612|KAPCA_HUMAN
15 Dec 2023 01:13:58,500 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:58,500 INFO : Inserting sp|P17812|PYRG1_HUMAN
15 Dec 2023 01:13:58,520 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:58,520 INFO : Inserting sp|P17858|PFKAL_HUMAN
15 Dec 2023 01:13:58,654 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:13:58,654 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:13:58,828 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:13:58,828 INFO : Inserting sp|P17927|CR1_HUMAN
15 Dec 2023 01:13:58,961 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:13:58,962 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 01:13:59,039 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:13:59,039 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 01:13:59,082 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:59,083 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 01:13:59,190 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:59,190 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 01:13:59,445 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:13:59,445 INFO : Inserting sp|P18075|BMP7_HUMAN
15 Dec 2023 01:13:59,471 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:59,472 INFO : Inserting sp|P18084|ITB5_HUMAN
15 Dec 2023 01:13:59,498 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:13:59,498 INFO : Inserting sp|P18085|ARF4_HUMAN
15 Dec 2023 01:13:59,598 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:13:59,598 INFO : Inserting sp|P18124|RL7_HUMAN
15 Dec 2023 01:13:59,645 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:13:59,645 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 01:14:00,173 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:14:00,173 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 01:14:00,373 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:00,373 INFO : Inserting sp|P18440|ARY1_HUMAN
15 Dec 2023 01:14:00,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:00,399 INFO : Inserting sp|P18510|IL1RA_HUMAN
15 Dec 2023 01:14:00,437 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:00,437 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:14:00,777 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:00,778 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 01:14:00,788 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:00,788 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 01:14:00,845 INFO : 46% Done
15 Dec 2023 01:14:01,018 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:14:01,018 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 01:14:01,098 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:01,099 INFO : Inserting sp|P19087|GNAT2_HUMAN
15 Dec 2023 01:14:01,127 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:01,127 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 01:14:01,192 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:01,192 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 01:14:01,319 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:01,319 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 01:14:01,369 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:01,370 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 01:14:01,497 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:01,497 INFO : Inserting sp|P19438|TNR1A_HUMAN
15 Dec 2023 01:14:01,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:01,523 INFO : Inserting sp|P19525|E2AK2_HUMAN
15 Dec 2023 01:14:01,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:01,542 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 01:14:01,710 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:01,710 INFO : Inserting sp|P19801|AOC1_HUMAN
15 Dec 2023 01:14:01,728 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:01,728 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:14:02,401 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:14:02,401 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:14:03,015 INFO : 47% Done
15 Dec 2023 01:14:03,095 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:14:03,095 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 01:14:03,210 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:03,210 INFO : Inserting sp|P19838|NFKB1_HUMAN
15 Dec 2023 01:14:03,226 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:03,226 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 01:14:03,364 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:03,364 INFO : Inserting sp|P19957|ELAF_HUMAN
15 Dec 2023 01:14:03,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:03,380 INFO : Imported 700 peptide groups.
15 Dec 2023 01:14:03,380 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:14:03,607 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:03,608 INFO : Inserting sp|P20036|DPA1_HUMAN
15 Dec 2023 01:14:03,624 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:03,624 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 01:14:03,793 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:03,793 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:14:03,970 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:03,970 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 01:14:04,025 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:04,025 INFO : Inserting sp|P20138|CD33_HUMAN
15 Dec 2023 01:14:04,050 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:04,051 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:14:04,201 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:04,201 INFO : Inserting sp|P20292|AL5AP_HUMAN
15 Dec 2023 01:14:04,234 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:04,234 INFO : Inserting sp|P20333|TNR1B_HUMAN
15 Dec 2023 01:14:04,250 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:04,250 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 01:14:04,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:04,274 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:14:04,369 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:04,369 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 01:14:04,459 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:04,459 INFO : Inserting sp|P20701|ITAL_HUMAN
15 Dec 2023 01:14:04,511 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:04,511 INFO : Inserting sp|P20702|ITAX_HUMAN
15 Dec 2023 01:14:04,608 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:04,608 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:14:05,418 INFO : 48% Done
15 Dec 2023 01:14:05,462 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:14:05,463 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:14:05,745 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:05,745 INFO : Inserting sp|P20839|IMDH1_HUMAN
15 Dec 2023 01:14:05,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:05,757 INFO : Inserting sp|P20849|CO9A1_HUMAN
15 Dec 2023 01:14:05,774 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:05,774 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 01:14:05,858 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:05,858 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 01:14:06,025 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:06,025 INFO : Inserting sp|P20916|MAG_HUMAN
15 Dec 2023 01:14:06,114 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:06,114 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:14:06,211 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:06,211 INFO : Inserting sp|P21108|PRPS3_HUMAN
15 Dec 2023 01:14:06,260 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:06,260 INFO : Inserting sp|P21246|PTN_HUMAN
15 Dec 2023 01:14:06,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:06,287 INFO : Inserting sp|P21281|VATB2_HUMAN
15 Dec 2023 01:14:06,339 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:06,339 INFO : Inserting sp|P21283|VATC1_HUMAN
15 Dec 2023 01:14:06,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:06,372 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:14:07,054 DEBUG: Inserted 50 peptides
15 Dec 2023 01:14:07,251 DEBUG: Total peptides inserted: 59
15 Dec 2023 01:14:07,251 INFO : Inserting sp|P21399|ACOHC_HUMAN
15 Dec 2023 01:14:07,349 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:07,349 INFO : Inserting sp|P21462|FPR1_HUMAN
15 Dec 2023 01:14:07,381 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:07,381 INFO : Inserting sp|P21579|SYT1_HUMAN
15 Dec 2023 01:14:07,701 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:14:07,701 INFO : Inserting sp|P21796|VDAC1_HUMAN
15 Dec 2023 01:14:07,721 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:07,721 INFO : Inserting sp|P21802|FGFR2_HUMAN
15 Dec 2023 01:14:07,793 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:07,793 INFO : Inserting sp|P21810|PGS1_HUMAN
15 Dec 2023 01:14:07,814 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:07,814 INFO : Inserting sp|P21926|CD9_HUMAN
15 Dec 2023 01:14:07,845 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:07,845 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 01:14:07,930 INFO : 49% Done
15 Dec 2023 01:14:07,966 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:07,966 INFO : Inserting sp|P22102|PUR2_HUMAN
15 Dec 2023 01:14:08,060 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:08,060 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 01:14:08,670 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:14:08,670 INFO : Inserting sp|P22234|PUR6_HUMAN
15 Dec 2023 01:14:08,705 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:08,705 INFO : Inserting sp|P22304|IDS_HUMAN
15 Dec 2023 01:14:08,768 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:08,768 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:14:09,082 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:09,082 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:14:09,219 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:09,219 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 01:14:09,352 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:09,352 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:14:09,453 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:09,454 INFO : Inserting sp|P22681|CBL_HUMAN
15 Dec 2023 01:14:09,511 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:09,511 INFO : Inserting sp|P22692|IBP4_HUMAN
15 Dec 2023 01:14:09,579 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:09,579 INFO : Inserting sp|P22695|QCR2_HUMAN
15 Dec 2023 01:14:09,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:09,601 INFO : Inserting sp|P22748|CAH4_HUMAN
15 Dec 2023 01:14:09,619 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:09,619 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:14:09,992 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:09,992 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 01:14:10,061 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:10,061 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 01:14:10,257 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:10,257 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:14:10,295 INFO : 50% Done
15 Dec 2023 01:14:10,660 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:14:10,660 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 01:14:10,687 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:10,687 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 01:14:10,831 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:10,831 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:14:11,248 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:14:11,248 INFO : Inserting sp|P23246|SFPQ_HUMAN
15 Dec 2023 01:14:11,261 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:11,261 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:14:11,588 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:11,588 INFO : Inserting sp|P23368|MAOM_HUMAN
15 Dec 2023 01:14:11,732 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:11,732 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 01:14:11,999 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:11,999 INFO : Inserting sp|P23435|CBLN1_HUMAN
15 Dec 2023 01:14:12,015 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:12,015 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 01:14:12,189 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:12,189 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 01:14:12,318 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:12,319 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:14:12,654 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:12,654 INFO : Inserting sp|P23515|OMGP_HUMAN
15 Dec 2023 01:14:12,732 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:12,732 INFO : Inserting sp|P23526|SAHH_HUMAN
15 Dec 2023 01:14:12,816 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:12,816 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:14:13,037 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:13,037 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:14:13,166 INFO : 51% Done
15 Dec 2023 01:14:13,266 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:13,266 INFO : Inserting sp|P23634|AT2B4_HUMAN
15 Dec 2023 01:14:13,277 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:13,277 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 01:14:13,643 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:14:13,643 INFO : Inserting sp|P24071|FCAR_HUMAN
15 Dec 2023 01:14:13,661 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:13,661 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:14:13,765 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:13,765 INFO : Inserting sp|P24347|MMP11_HUMAN
15 Dec 2023 01:14:13,787 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:13,787 INFO : Inserting sp|P24387|CRHBP_HUMAN
15 Dec 2023 01:14:13,822 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:13,822 INFO : Inserting sp|P24534|EF1B_HUMAN
15 Dec 2023 01:14:13,853 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:13,853 INFO : Inserting sp|P24539|AT5F1_HUMAN
15 Dec 2023 01:14:13,868 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:13,868 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:14:13,996 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:13,996 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 01:14:14,018 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:14,018 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 01:14:14,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:14,037 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 01:14:14,247 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:14,247 INFO : Inserting sp|P25025|CXCR2_HUMAN
15 Dec 2023 01:14:14,265 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:14,266 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 01:14:14,458 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:14,458 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:14:14,741 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:14:14,741 INFO : Inserting sp|P25325|THTM_HUMAN
15 Dec 2023 01:14:14,772 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:14,772 INFO : Inserting sp|P25398|RS12_HUMAN
15 Dec 2023 01:14:14,789 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:14,790 INFO : Inserting sp|P25705|ATPA_HUMAN
15 Dec 2023 01:14:14,908 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:14,908 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 01:14:14,958 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:14,958 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 01:14:15,100 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:15,100 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:14:15,233 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:15,233 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 01:14:15,316 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:15,316 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:14:15,435 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:15,435 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:14:15,504 INFO : 52% Done
15 Dec 2023 01:14:15,559 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:15,559 INFO : Inserting sp|P26022|PTX3_HUMAN
15 Dec 2023 01:14:15,674 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:15,674 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:14:16,052 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:14:16,052 INFO : Inserting sp|P26196|DDX6_HUMAN
15 Dec 2023 01:14:16,067 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:16,068 INFO : Inserting sp|P26232|CTNA2_HUMAN
15 Dec 2023 01:14:16,089 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:16,089 INFO : Inserting sp|P26368|U2AF2_HUMAN
15 Dec 2023 01:14:16,160 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:16,160 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 01:14:16,222 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:16,222 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 01:14:16,299 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:16,299 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 01:14:16,405 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:16,405 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:14:16,498 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:16,498 INFO : Inserting sp|P26639|SYTC_HUMAN
15 Dec 2023 01:14:16,608 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:16,608 INFO : Imported 800 peptide groups.
15 Dec 2023 01:14:16,608 INFO : Inserting sp|P26640|SYVC_HUMAN
15 Dec 2023 01:14:16,630 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:16,630 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:14:16,718 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:16,718 INFO : Inserting sp|P26885|FKBP2_HUMAN
15 Dec 2023 01:14:16,737 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:16,737 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 01:14:16,895 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:16,895 INFO : Inserting sp|P26992|CNTFR_HUMAN
15 Dec 2023 01:14:16,962 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:16,962 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 01:14:17,081 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:17,081 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:14:17,288 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:17,288 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 01:14:17,377 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:17,377 INFO : Inserting sp|P27694|RFA1_HUMAN
15 Dec 2023 01:14:17,445 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:17,445 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:14:17,566 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:17,566 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:14:17,655 INFO : 53% Done
15 Dec 2023 01:14:17,694 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:17,694 INFO : Inserting sp|P27815|PDE4A_HUMAN
15 Dec 2023 01:14:17,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:17,704 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 01:14:17,771 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:17,771 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 01:14:17,835 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:17,835 INFO : Inserting sp|P27986|P85A_HUMAN
15 Dec 2023 01:14:17,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:17,852 INFO : Inserting sp|P28062|PSB8_HUMAN
15 Dec 2023 01:14:17,919 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:17,919 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 01:14:17,990 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:17,991 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 01:14:18,094 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:18,094 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 01:14:18,139 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:18,139 INFO : Inserting sp|P28072|PSB6_HUMAN
15 Dec 2023 01:14:18,174 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:18,175 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 01:14:18,192 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:18,192 INFO : Inserting sp|P28161|GSTM2_HUMAN
15 Dec 2023 01:14:18,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:18,214 INFO : Inserting sp|P28300|LYOX_HUMAN
15 Dec 2023 01:14:18,239 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:18,239 INFO : Inserting sp|P28324|ELK4_HUMAN
15 Dec 2023 01:14:18,264 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:18,264 INFO : Inserting sp|P28482|MK01_HUMAN
15 Dec 2023 01:14:18,366 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:18,366 INFO : Inserting sp|P28676|GRAN_HUMAN
15 Dec 2023 01:14:18,595 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:18,595 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 01:14:18,732 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:18,732 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:14:19,079 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:19,079 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 01:14:19,181 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:19,181 INFO : Inserting sp|P29218|IMPA1_HUMAN
15 Dec 2023 01:14:19,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:19,222 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:14:19,502 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:19,502 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:14:20,459 DEBUG: Total peptides inserted: 42
15 Dec 2023 01:14:20,459 INFO : Inserting sp|P29466|CASP1_HUMAN
15 Dec 2023 01:14:20,571 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:20,571 INFO : Inserting sp|P29508|SPB3_HUMAN
15 Dec 2023 01:14:20,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:20,582 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:14:20,618 INFO : 54% Done
15 Dec 2023 01:14:21,072 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:14:21,072 INFO : Inserting sp|P29692|EF1D_HUMAN
15 Dec 2023 01:14:21,101 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:21,101 INFO : Inserting sp|P30038|AL4A1_HUMAN
15 Dec 2023 01:14:21,132 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:21,132 INFO : Inserting sp|P30040|ERP29_HUMAN
15 Dec 2023 01:14:21,180 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:21,180 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:14:21,333 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:21,334 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:14:21,441 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:21,441 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 01:14:21,617 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:21,618 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:14:21,716 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:21,716 INFO : Inserting sp|P30047|GFRP_HUMAN
15 Dec 2023 01:14:21,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:21,739 INFO : Inserting sp|P30048|PRDX3_HUMAN
15 Dec 2023 01:14:21,808 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:21,808 INFO : Inserting sp|P30050|RL12_HUMAN
15 Dec 2023 01:14:21,882 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:21,882 INFO : Inserting sp|P30084|ECHM_HUMAN
15 Dec 2023 01:14:21,909 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:21,909 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 01:14:21,952 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:21,952 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 01:14:22,196 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:22,196 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 01:14:22,368 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:22,368 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 01:14:22,473 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:22,473 INFO : Inserting sp|P30260|CDC27_HUMAN
15 Dec 2023 01:14:22,490 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:22,491 INFO : Inserting sp|P30419|NMT1_HUMAN
15 Dec 2023 01:14:22,552 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:22,552 INFO : Inserting sp|P30520|PURA2_HUMAN
15 Dec 2023 01:14:22,692 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:22,692 INFO : Inserting sp|P30530|UFO_HUMAN
15 Dec 2023 01:14:22,743 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:22,743 INFO : Inserting sp|P30566|PUR8_HUMAN
15 Dec 2023 01:14:22,816 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:22,816 INFO : Inserting sp|P30613|KPYR_HUMAN
15 Dec 2023 01:14:22,846 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:22,846 INFO : Inserting sp|P30626|SORCN_HUMAN
15 Dec 2023 01:14:22,853 INFO : 55% Done
15 Dec 2023 01:14:22,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:22,865 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:14:23,335 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:14:23,336 INFO : Inserting sp|P30837|AL1B1_HUMAN
15 Dec 2023 01:14:23,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:23,356 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:14:23,617 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:23,617 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:14:23,924 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:23,924 INFO : Inserting sp|P31151|S10A7_HUMAN
15 Dec 2023 01:14:23,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:23,952 INFO : Inserting sp|P31153|METK2_HUMAN
15 Dec 2023 01:14:23,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:23,972 INFO : Inserting sp|P31749|AKT1_HUMAN
15 Dec 2023 01:14:23,987 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:23,987 INFO : Inserting sp|P31937|3HIDH_HUMAN
15 Dec 2023 01:14:24,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:24,014 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 01:14:24,193 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:24,193 INFO : Inserting sp|P31942|HNRH3_HUMAN
15 Dec 2023 01:14:24,213 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:24,213 INFO : Inserting sp|P31943|HNRH1_HUMAN
15 Dec 2023 01:14:24,273 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:24,273 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:14:24,449 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:24,449 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 01:14:24,547 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:24,547 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:14:24,671 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:24,672 INFO : Inserting sp|P31997|CEAM8_HUMAN
15 Dec 2023 01:14:24,715 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:24,715 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 01:14:24,761 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:24,762 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:14:24,866 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:24,866 INFO : Inserting sp|P32121|ARRB2_HUMAN
15 Dec 2023 01:14:24,916 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:24,917 INFO : Inserting sp|P32320|CDD_HUMAN
15 Dec 2023 01:14:24,983 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:24,983 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:14:25,088 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:25,088 INFO : Inserting sp|P32456|GBP2_HUMAN
15 Dec 2023 01:14:25,178 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:25,178 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 01:14:25,268 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:25,268 INFO : Inserting sp|P32969|RL9_HUMAN
15 Dec 2023 01:14:25,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:25,313 INFO : Inserting sp|P33121|ACSL1_HUMAN
15 Dec 2023 01:14:25,335 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:25,335 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 01:14:25,360 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:25,360 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:14:25,413 INFO : 56% Done
15 Dec 2023 01:14:25,546 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:25,547 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:14:25,807 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:25,807 INFO : Inserting sp|P34059|GALNS_HUMAN
15 Dec 2023 01:14:25,893 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:25,893 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 01:14:25,950 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:25,950 INFO : Inserting sp|P34810|CD68_HUMAN
15 Dec 2023 01:14:25,978 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:25,979 INFO : Inserting sp|P34896|GLYC_HUMAN
15 Dec 2023 01:14:25,995 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:25,995 INFO : Inserting sp|P34897|GLYM_HUMAN
15 Dec 2023 01:14:26,008 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:26,008 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 01:14:26,378 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:14:26,378 INFO : Inserting sp|P34949|MPI_HUMAN
15 Dec 2023 01:14:26,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:26,433 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 01:14:26,460 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:26,460 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 01:14:26,593 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:26,594 INFO : Inserting sp|P35228|NOS2_HUMAN
15 Dec 2023 01:14:26,659 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:26,659 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 01:14:26,860 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:26,861 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 01:14:27,055 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:27,055 INFO : Inserting sp|P35244|RFA3_HUMAN
15 Dec 2023 01:14:27,115 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:27,116 INFO : Inserting sp|P35268|RL22_HUMAN
15 Dec 2023 01:14:27,143 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:27,143 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 01:14:27,202 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:27,202 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 01:14:27,284 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:27,284 INFO : Imported 900 peptide groups.
15 Dec 2023 01:14:27,284 INFO : Inserting sp|P35475|IDUA_HUMAN
15 Dec 2023 01:14:27,332 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:27,332 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:14:27,597 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:14:27,598 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:14:27,836 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:27,836 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:14:28,242 INFO : 57% Done
15 Dec 2023 01:14:28,517 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:14:28,517 INFO : Inserting sp|P35606|COPB2_HUMAN
15 Dec 2023 01:14:28,533 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:28,533 INFO : Inserting sp|P35609|ACTN2_HUMAN
15 Dec 2023 01:14:28,740 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:28,740 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 01:14:28,756 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:28,756 INFO : Inserting sp|P35749|MYH11_HUMAN
15 Dec 2023 01:14:28,841 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:28,841 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 01:14:28,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:28,857 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:14:29,369 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:14:29,369 INFO : Inserting sp|P35869|AHR_HUMAN
15 Dec 2023 01:14:29,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:29,375 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 01:14:29,601 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:14:29,601 INFO : Inserting sp|P35916|VGFR3_HUMAN
15 Dec 2023 01:14:29,621 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:29,621 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:14:30,003 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:14:30,003 INFO : Inserting sp|P36406|TRI23_HUMAN
15 Dec 2023 01:14:30,021 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:30,021 INFO : Inserting sp|P36543|VATE1_HUMAN
15 Dec 2023 01:14:30,062 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:30,062 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:14:30,235 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:30,235 INFO : Inserting sp|P36897|TGFR1_HUMAN
15 Dec 2023 01:14:30,251 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:30,251 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:14:30,399 INFO : 58% Done
15 Dec 2023 01:14:30,621 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:14:30,621 INFO : Inserting sp|P36957|ODO2_HUMAN
15 Dec 2023 01:14:30,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:30,637 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:14:30,722 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:30,723 INFO : Inserting sp|P37108|SRP14_HUMAN
15 Dec 2023 01:14:30,740 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:30,740 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 01:14:30,855 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:30,855 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:14:31,112 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:31,112 INFO : Inserting sp|P38159|RBMX_HUMAN
15 Dec 2023 01:14:31,152 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:31,152 INFO : Inserting sp|P38405|GNAL_HUMAN
15 Dec 2023 01:14:31,192 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:31,192 INFO : Inserting sp|P38571|LICH_HUMAN
15 Dec 2023 01:14:31,227 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:31,227 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 01:14:31,385 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:31,385 INFO : Inserting sp|P38919|IF4A3_HUMAN
15 Dec 2023 01:14:31,421 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:31,421 INFO : Inserting sp|P39019|RS19_HUMAN
15 Dec 2023 01:14:31,436 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:31,436 INFO : Inserting sp|P39023|RL3_HUMAN
15 Dec 2023 01:14:31,454 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:31,454 INFO : Inserting sp|P39059|COFA1_HUMAN
15 Dec 2023 01:14:31,543 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:31,543 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 01:14:31,735 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:31,735 INFO : Inserting sp|P39656|OST48_HUMAN
15 Dec 2023 01:14:31,781 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:31,781 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 01:14:31,951 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:31,951 INFO : Inserting sp|P39748|FEN1_HUMAN
15 Dec 2023 01:14:31,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:31,976 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 01:14:32,107 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:32,107 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 01:14:32,208 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:32,208 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 01:14:32,252 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:32,252 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 01:14:32,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:32,313 INFO : Inserting sp|P40763|STAT3_HUMAN
15 Dec 2023 01:14:32,401 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:32,401 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:14:32,514 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:32,514 INFO : Inserting sp|P40926|MDHM_HUMAN
15 Dec 2023 01:14:32,667 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:32,667 INFO : Inserting sp|P40939|ECHA_HUMAN
15 Dec 2023 01:14:32,776 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:32,776 INFO : Inserting sp|P41091|IF2G_HUMAN
15 Dec 2023 01:14:32,803 INFO : 59% Done
15 Dec 2023 01:14:32,820 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:32,820 INFO : Inserting sp|P41217|OX2G_HUMAN
15 Dec 2023 01:14:32,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:32,840 INFO : Inserting sp|P41218|MNDA_HUMAN
15 Dec 2023 01:14:33,163 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:33,163 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:14:33,438 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:33,438 INFO : Inserting sp|P41226|UBA7_HUMAN
15 Dec 2023 01:14:33,513 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:33,513 INFO : Inserting sp|P41240|CSK_HUMAN
15 Dec 2023 01:14:33,630 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:33,630 INFO : Inserting sp|P41250|GARS_HUMAN
15 Dec 2023 01:14:33,801 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:33,801 INFO : Inserting sp|P41252|SYIC_HUMAN
15 Dec 2023 01:14:33,864 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:33,864 INFO : Inserting sp|P42166|LAP2A_HUMAN
15 Dec 2023 01:14:33,916 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:33,917 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 01:14:34,085 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:34,085 INFO : Inserting sp|P42226|STAT6_HUMAN
15 Dec 2023 01:14:34,110 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:34,110 INFO : Inserting sp|P42331|RHG25_HUMAN
15 Dec 2023 01:14:34,179 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:34,179 INFO : Inserting sp|P42574|CASP3_HUMAN
15 Dec 2023 01:14:34,214 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:34,214 INFO : Inserting sp|P42658|DPP6_HUMAN
15 Dec 2023 01:14:34,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:34,236 INFO : Inserting sp|P42765|THIM_HUMAN
15 Dec 2023 01:14:34,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:34,257 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 01:14:34,339 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:34,339 INFO : Inserting sp|P43003|EAA1_HUMAN
15 Dec 2023 01:14:34,360 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:34,361 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:14:34,447 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:34,447 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 01:14:34,611 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:34,611 INFO : Inserting sp|P43146|DCC_HUMAN
15 Dec 2023 01:14:34,621 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:34,621 INFO : Inserting sp|P43234|CATO_HUMAN
15 Dec 2023 01:14:34,638 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:34,638 INFO : Inserting sp|P43243|MATR3_HUMAN
15 Dec 2023 01:14:34,669 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:34,669 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 01:14:34,907 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:34,907 INFO : Inserting sp|P43405|KSYK_HUMAN
15 Dec 2023 01:14:34,987 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:34,987 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 01:14:35,277 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:35,277 INFO : Inserting sp|P43630|KI3L2_HUMAN
15 Dec 2023 01:14:35,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:35,292 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:14:35,373 INFO : 60% Done
15 Dec 2023 01:14:35,825 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:14:35,825 INFO : Inserting sp|P45877|PPIC_HUMAN
15 Dec 2023 01:14:35,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:35,840 INFO : Inserting sp|P45880|VDAC2_HUMAN
15 Dec 2023 01:14:35,870 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:35,870 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 01:14:35,902 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:35,902 INFO : Inserting sp|P46109|CRKL_HUMAN
15 Dec 2023 01:14:35,955 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:35,955 INFO : Inserting sp|P46459|NSF_HUMAN
15 Dec 2023 01:14:35,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:35,973 INFO : Inserting sp|P46736|BRCC3_HUMAN
15 Dec 2023 01:14:35,984 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:35,984 INFO : Inserting sp|P46776|RL27A_HUMAN
15 Dec 2023 01:14:36,009 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:36,009 INFO : Inserting sp|P46777|RL5_HUMAN
15 Dec 2023 01:14:36,047 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:36,047 INFO : Inserting sp|P46778|RL21_HUMAN
15 Dec 2023 01:14:36,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:36,057 INFO : Inserting sp|P46783|RS10_HUMAN
15 Dec 2023 01:14:36,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:36,074 INFO : Inserting sp|P46821|MAP1B_HUMAN
15 Dec 2023 01:14:36,175 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:36,175 INFO : Inserting sp|P46926|GNPI1_HUMAN
15 Dec 2023 01:14:36,279 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:36,279 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:14:36,845 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:14:36,845 INFO : Inserting sp|P46976|GLYG_HUMAN
15 Dec 2023 01:14:36,983 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:36,983 INFO : Inserting sp|P47755|CAZA2_HUMAN
15 Dec 2023 01:14:37,058 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:37,059 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:14:37,196 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:37,197 INFO : Inserting sp|P47813|IF1AX_HUMAN
15 Dec 2023 01:14:37,215 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:37,215 INFO : Inserting sp|P47897|SYQ_HUMAN
15 Dec 2023 01:14:37,296 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:37,297 INFO : Inserting sp|P48047|ATPO_HUMAN
15 Dec 2023 01:14:37,649 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:14:37,649 INFO : Inserting sp|P48058|GRIA4_HUMAN
15 Dec 2023 01:14:37,694 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:37,694 INFO : Inserting sp|P48061|SDF1_HUMAN
15 Dec 2023 01:14:37,718 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:37,718 INFO : Inserting sp|P48147|PPCE_HUMAN
15 Dec 2023 01:14:37,840 INFO : 61% Done
15 Dec 2023 01:14:38,008 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:38,008 INFO : Inserting sp|P48304|REG1B_HUMAN
15 Dec 2023 01:14:38,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:38,037 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 01:14:38,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:38,056 INFO : Inserting sp|P48444|COPD_HUMAN
15 Dec 2023 01:14:38,122 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:38,122 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 01:14:38,151 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:38,152 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 01:14:38,175 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:38,175 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:14:38,435 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:14:38,435 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 01:14:38,552 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:38,552 INFO : Imported 1000 peptide groups.
15 Dec 2023 01:14:38,552 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 01:14:38,609 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:38,609 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 01:14:38,737 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:38,737 INFO : Inserting sp|P48723|HSP13_HUMAN
15 Dec 2023 01:14:38,826 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:38,826 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 01:14:39,057 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:39,057 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 01:14:39,090 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:39,091 INFO : Inserting sp|P48960|AGRE5_HUMAN
15 Dec 2023 01:14:39,176 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:39,176 INFO : Inserting sp|P49069|CAMLG_HUMAN
15 Dec 2023 01:14:39,200 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,200 INFO : Inserting sp|P49137|MAPK2_HUMAN
15 Dec 2023 01:14:39,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,225 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 01:14:39,276 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:39,276 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 01:14:39,305 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:39,305 INFO : Inserting sp|P49257|LMAN1_HUMAN
15 Dec 2023 01:14:39,337 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,337 INFO : Inserting sp|P49354|FNTA_HUMAN
15 Dec 2023 01:14:39,424 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:39,424 INFO : Inserting sp|P49368|TCPG_HUMAN
15 Dec 2023 01:14:39,484 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:39,484 INFO : Inserting sp|P49411|EFTU_HUMAN
15 Dec 2023 01:14:39,507 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,507 INFO : Inserting sp|P49448|DHE4_HUMAN
15 Dec 2023 01:14:39,567 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:39,567 INFO : Inserting sp|P49585|PCY1A_HUMAN
15 Dec 2023 01:14:39,586 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,586 INFO : Inserting sp|P49588|SYAC_HUMAN
15 Dec 2023 01:14:39,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,608 INFO : Inserting sp|P49589|SYCC_HUMAN
15 Dec 2023 01:14:39,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:39,628 INFO : Inserting sp|P49591|SYSC_HUMAN
15 Dec 2023 01:14:39,709 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:39,709 INFO : Inserting sp|P49593|PPM1F_HUMAN
15 Dec 2023 01:14:39,790 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:39,790 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:14:40,103 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:40,103 INFO : Inserting sp|P49662|CASP4_HUMAN
15 Dec 2023 01:14:40,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:40,120 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 01:14:40,195 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:40,195 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:14:40,333 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:40,333 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 01:14:40,380 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:40,380 INFO : Inserting sp|P49773|HINT1_HUMAN
15 Dec 2023 01:14:40,413 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:40,413 INFO : Inserting sp|P49788|TIG1_HUMAN
15 Dec 2023 01:14:40,449 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:40,449 INFO : Inserting sp|P49821|NDUV1_HUMAN
15 Dec 2023 01:14:40,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:40,468 INFO : Inserting sp|P49862|KLK7_HUMAN
15 Dec 2023 01:14:40,487 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:40,487 INFO : Inserting sp|P49902|5NTC_HUMAN
15 Dec 2023 01:14:40,494 INFO : 62% Done
15 Dec 2023 01:14:40,602 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:40,602 INFO : Inserting sp|P49903|SPS1_HUMAN
15 Dec 2023 01:14:40,688 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:40,688 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:14:40,729 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:40,729 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 01:14:40,809 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:40,809 INFO : Inserting sp|P50135|HNMT_HUMAN
15 Dec 2023 01:14:40,829 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:40,829 INFO : Inserting sp|P50225|ST1A1_HUMAN
15 Dec 2023 01:14:40,897 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:40,897 INFO : Inserting sp|P50226|ST1A2_HUMAN
15 Dec 2023 01:14:40,964 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:40,964 INFO : Inserting sp|P50281|MMP14_HUMAN
15 Dec 2023 01:14:40,993 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:40,993 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:14:41,417 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:14:41,417 INFO : Inserting sp|P50452|SPB8_HUMAN
15 Dec 2023 01:14:41,502 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:41,502 INFO : Inserting sp|P50453|SPB9_HUMAN
15 Dec 2023 01:14:41,558 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:41,558 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 01:14:41,632 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:41,632 INFO : Inserting sp|P50570|DYN2_HUMAN
15 Dec 2023 01:14:41,701 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:41,701 INFO : Inserting sp|P50579|MAP2_HUMAN
15 Dec 2023 01:14:41,721 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:41,722 INFO : Inserting sp|P50897|PPT1_HUMAN
15 Dec 2023 01:14:41,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:41,736 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 01:14:41,797 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:41,797 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 01:14:41,891 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:41,891 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 01:14:41,966 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:41,966 INFO : Inserting sp|P51148|RAB5C_HUMAN
15 Dec 2023 01:14:42,016 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:42,016 INFO : Inserting sp|P51149|RAB7A_HUMAN
15 Dec 2023 01:14:42,132 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:42,132 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 01:14:42,216 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:42,216 INFO : Inserting sp|P51580|TPMT_HUMAN
15 Dec 2023 01:14:42,232 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:42,232 INFO : Inserting sp|P51610|HCFC1_HUMAN
15 Dec 2023 01:14:42,247 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:42,247 INFO : Inserting sp|P51649|SSDH_HUMAN
15 Dec 2023 01:14:42,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:42,257 INFO : Inserting sp|P51659|DHB4_HUMAN
15 Dec 2023 01:14:42,297 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:42,297 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 01:14:42,327 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:42,327 INFO : Inserting sp|P51668|UB2D1_HUMAN
15 Dec 2023 01:14:42,346 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:42,346 INFO : Inserting sp|P51692|STA5B_HUMAN
15 Dec 2023 01:14:42,414 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:42,414 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 01:14:42,587 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:42,587 INFO : Inserting sp|P51809|VAMP7_HUMAN
15 Dec 2023 01:14:42,620 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:42,620 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 01:14:42,652 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:42,652 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:14:42,804 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:42,804 INFO : Inserting sp|P51888|PRELP_HUMAN
15 Dec 2023 01:14:42,833 INFO : 63% Done
15 Dec 2023 01:14:42,862 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:42,862 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 01:14:42,932 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:42,932 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:14:43,345 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:14:43,345 INFO : Inserting sp|P52272|HNRPM_HUMAN
15 Dec 2023 01:14:43,389 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:43,389 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 01:14:43,498 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:43,498 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:14:43,700 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:43,700 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:14:43,746 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:43,746 INFO : Inserting sp|P52788|SPSY_HUMAN
15 Dec 2023 01:14:43,780 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:43,780 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:14:44,237 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:14:44,237 INFO : Inserting sp|P52799|EFNB2_HUMAN
15 Dec 2023 01:14:44,273 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:44,273 INFO : Inserting sp|P52888|THOP1_HUMAN
15 Dec 2023 01:14:44,309 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:44,309 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 01:14:44,390 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:44,390 INFO : Inserting sp|P52951|GBX2_HUMAN
15 Dec 2023 01:14:44,410 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:44,410 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 01:14:44,520 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:44,520 INFO : Inserting sp|P53365|ARFP2_HUMAN
15 Dec 2023 01:14:44,530 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:44,530 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:14:44,821 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:14:44,821 INFO : Inserting sp|P53582|MAP11_HUMAN
15 Dec 2023 01:14:44,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:44,840 INFO : Inserting sp|P53609|PGTB1_HUMAN
15 Dec 2023 01:14:44,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:44,850 INFO : Inserting sp|P53618|COPB_HUMAN
15 Dec 2023 01:14:44,922 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:44,922 INFO : Inserting sp|P53621|COPA_HUMAN
15 Dec 2023 01:14:45,023 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:45,023 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 01:14:45,058 INFO : 64% Done
15 Dec 2023 01:14:45,176 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:45,176 INFO : Inserting sp|P53675|CLH2_HUMAN
15 Dec 2023 01:14:45,445 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:14:45,445 INFO : Inserting sp|P53801|PTTG_HUMAN
15 Dec 2023 01:14:45,467 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:45,467 INFO : Inserting sp|P53992|SC24C_HUMAN
15 Dec 2023 01:14:45,510 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:45,510 INFO : Inserting sp|P53999|TCP4_HUMAN
15 Dec 2023 01:14:45,529 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:45,529 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 01:14:45,580 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:45,580 INFO : Inserting sp|P54136|SYRC_HUMAN
15 Dec 2023 01:14:45,628 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:45,629 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 01:14:45,902 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:14:45,902 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 01:14:45,993 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:45,993 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 01:14:46,190 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:46,190 INFO : Inserting sp|P54707|AT12A_HUMAN
15 Dec 2023 01:14:46,263 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:46,263 INFO : Inserting sp|P54709|AT1B3_HUMAN
15 Dec 2023 01:14:46,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:46,288 INFO : Inserting sp|P54725|RD23A_HUMAN
15 Dec 2023 01:14:46,312 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:46,312 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 01:14:46,401 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:46,401 INFO : Inserting sp|P54756|EPHA5_HUMAN
15 Dec 2023 01:14:46,445 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:46,446 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 01:14:46,580 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:46,581 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 01:14:46,794 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:46,794 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 01:14:46,933 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:46,933 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 01:14:46,994 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:46,994 INFO : Imported 1100 peptide groups.
15 Dec 2023 01:14:46,994 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 01:14:47,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:47,013 INFO : Inserting sp|P55010|IF5_HUMAN
15 Dec 2023 01:14:47,074 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:47,074 INFO : Inserting sp|P55011|S12A2_HUMAN
15 Dec 2023 01:14:47,087 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:47,087 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:14:47,758 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:14:47,758 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:14:48,108 INFO : 65% Done
15 Dec 2023 01:14:48,124 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:14:48,125 INFO : Inserting sp|P55083|MFAP4_HUMAN
15 Dec 2023 01:14:48,196 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,196 INFO : Inserting sp|P55160|NCKPL_HUMAN
15 Dec 2023 01:14:48,351 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:48,351 INFO : Inserting sp|P55209|NP1L1_HUMAN
15 Dec 2023 01:14:48,393 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,393 INFO : Inserting sp|P55210|CASP7_HUMAN
15 Dec 2023 01:14:48,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:48,408 INFO : Inserting sp|P55263|ADK_HUMAN
15 Dec 2023 01:14:48,469 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:48,469 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 01:14:48,557 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:48,557 INFO : Inserting sp|P55285|CADH6_HUMAN
15 Dec 2023 01:14:48,589 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,589 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 01:14:48,642 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:48,642 INFO : Inserting sp|P55290|CAD13_HUMAN
15 Dec 2023 01:14:48,675 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,675 INFO : Inserting sp|P55735|SEC13_HUMAN
15 Dec 2023 01:14:48,699 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,699 INFO : Inserting sp|P55774|CCL18_HUMAN
15 Dec 2023 01:14:48,733 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:48,733 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 01:14:49,024 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:49,024 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 01:14:49,047 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:49,047 INFO : Inserting sp|P55854|SUMO3_HUMAN
15 Dec 2023 01:14:49,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:49,057 INFO : Inserting sp|P55884|EIF3B_HUMAN
15 Dec 2023 01:14:49,132 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:49,132 INFO : Inserting sp|P55899|FCGRN_HUMAN
15 Dec 2023 01:14:49,154 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:49,154 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 01:14:49,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:49,213 INFO : Inserting sp|P56134|ATPK_HUMAN
15 Dec 2023 01:14:49,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:49,223 INFO : Inserting sp|P56556|NDUA6_HUMAN
15 Dec 2023 01:14:49,255 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:49,255 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:14:49,414 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:49,414 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 01:14:49,528 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:49,528 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 01:14:49,635 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:49,635 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:14:49,815 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:49,815 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:14:49,857 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:49,857 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:14:49,900 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:49,900 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 01:14:50,100 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:50,100 INFO : Inserting sp|P60033|CD81_HUMAN
15 Dec 2023 01:14:50,151 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:50,151 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:14:50,362 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:50,362 INFO : Inserting sp|P60201|MYPR_HUMAN
15 Dec 2023 01:14:50,413 INFO : 66% Done
15 Dec 2023 01:14:50,422 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:50,422 INFO : Inserting sp|P60228|EIF3E_HUMAN
15 Dec 2023 01:14:50,450 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:50,450 INFO : Inserting sp|P60510|PP4C_HUMAN
15 Dec 2023 01:14:50,468 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:50,468 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:14:50,581 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:50,581 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:14:51,047 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:14:51,048 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 01:14:51,144 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:51,144 INFO : Inserting sp|P60891|PRPS1_HUMAN
15 Dec 2023 01:14:51,177 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:51,177 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 01:14:51,264 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:51,264 INFO : Inserting sp|P60953|CDC42_HUMAN
15 Dec 2023 01:14:51,308 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,308 INFO : Inserting sp|P61006|RAB8A_HUMAN
15 Dec 2023 01:14:51,350 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,351 INFO : Inserting sp|P61018|RAB4B_HUMAN
15 Dec 2023 01:14:51,396 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,396 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 01:14:51,439 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,439 INFO : Inserting sp|P61020|RAB5B_HUMAN
15 Dec 2023 01:14:51,501 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:51,502 INFO : Inserting sp|P61026|RAB10_HUMAN
15 Dec 2023 01:14:51,543 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,543 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 01:14:51,560 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:51,561 INFO : Inserting sp|P61086|UBE2K_HUMAN
15 Dec 2023 01:14:51,594 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:51,594 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 01:14:51,621 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:51,621 INFO : Inserting sp|P61106|RAB14_HUMAN
15 Dec 2023 01:14:51,672 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:51,672 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:14:51,966 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:14:51,967 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:14:52,274 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:14:52,274 INFO : Inserting sp|P61163|ACTZ_HUMAN
15 Dec 2023 01:14:52,307 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:52,307 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 01:14:52,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:52,326 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 01:14:52,483 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:52,483 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 01:14:52,561 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:52,562 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 01:14:52,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:52,582 INFO : Inserting sp|P61313|RL15_HUMAN
15 Dec 2023 01:14:52,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:52,601 INFO : Inserting sp|P61326|MGN_HUMAN
15 Dec 2023 01:14:52,625 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:52,626 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 01:14:52,764 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:52,764 INFO : Inserting sp|P61604|CH10_HUMAN
15 Dec 2023 01:14:52,819 INFO : 67% Done
15 Dec 2023 01:14:52,875 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:52,875 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:14:53,040 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:53,041 INFO : Inserting sp|P61758|PFD3_HUMAN
15 Dec 2023 01:14:53,073 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:53,073 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:14:53,261 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:53,261 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:14:53,436 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:14:53,436 INFO : Inserting sp|P61812|TGFB2_HUMAN
15 Dec 2023 01:14:53,511 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:53,511 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:14:53,678 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:53,678 INFO : Inserting sp|P61956|SUMO2_HUMAN
15 Dec 2023 01:14:53,692 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:53,692 INFO : Inserting sp|P61960|UFM1_HUMAN
15 Dec 2023 01:14:53,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:53,716 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 01:14:53,906 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:53,906 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 01:14:54,048 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:54,048 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:14:54,203 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:54,203 INFO : Inserting sp|P62081|RS7_HUMAN
15 Dec 2023 01:14:54,221 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:54,221 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:14:54,385 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:54,386 INFO : Inserting sp|P62140|PP1B_HUMAN
15 Dec 2023 01:14:54,555 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:54,555 INFO : Inserting sp|P62241|RS8_HUMAN
15 Dec 2023 01:14:54,572 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:54,572 INFO : Inserting sp|P62249|RS16_HUMAN
15 Dec 2023 01:14:54,597 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:54,597 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 01:14:54,794 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:14:54,794 INFO : Inserting sp|P62269|RS18_HUMAN
15 Dec 2023 01:14:54,811 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:54,811 INFO : Inserting sp|P62304|RUXE_HUMAN
15 Dec 2023 01:14:54,837 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:54,837 INFO : Inserting sp|P62318|SMD3_HUMAN
15 Dec 2023 01:14:54,870 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:54,870 INFO : Inserting sp|P62330|ARF6_HUMAN
15 Dec 2023 01:14:54,903 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:54,903 INFO : Inserting sp|P62333|PRS10_HUMAN
15 Dec 2023 01:14:54,942 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:54,942 INFO : Inserting sp|P62424|RL7A_HUMAN
15 Dec 2023 01:14:54,961 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:54,962 INFO : Inserting sp|P62491|RB11A_HUMAN
15 Dec 2023 01:14:55,026 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:55,027 INFO : Inserting sp|P62495|ERF1_HUMAN
15 Dec 2023 01:14:55,064 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:55,064 INFO : Inserting sp|P62701|RS4X_HUMAN
15 Dec 2023 01:14:55,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:55,080 INFO : Inserting sp|P62714|PP2AB_HUMAN
15 Dec 2023 01:14:55,136 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:55,136 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:14:55,352 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:14:55,352 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:14:55,488 INFO : 68% Done
15 Dec 2023 01:14:55,604 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:14:55,604 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:14:55,762 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:55,762 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:14:55,885 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:55,885 INFO : Inserting sp|P62834|RAP1A_HUMAN
15 Dec 2023 01:14:55,940 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:55,940 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 01:14:55,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:55,960 INFO : Inserting sp|P62873|GBB1_HUMAN
15 Dec 2023 01:14:56,087 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:14:56,087 INFO : Inserting sp|P62879|GBB2_HUMAN
15 Dec 2023 01:14:56,196 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:56,196 INFO : Inserting sp|P62888|RL30_HUMAN
15 Dec 2023 01:14:56,232 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:56,232 INFO : Inserting sp|P62899|RL31_HUMAN
15 Dec 2023 01:14:56,270 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:56,270 INFO : Inserting sp|P62906|RL10A_HUMAN
15 Dec 2023 01:14:56,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:56,313 INFO : Imported 1200 peptide groups.
15 Dec 2023 01:14:56,313 INFO : Inserting sp|P62913|RL11_HUMAN
15 Dec 2023 01:14:56,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:56,331 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 01:14:56,470 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:56,470 INFO : Inserting sp|P62942|FKB1A_HUMAN
15 Dec 2023 01:14:56,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:56,528 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 01:14:56,651 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:56,651 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 01:14:56,776 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:14:56,776 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 01:14:56,799 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:56,799 INFO : Inserting sp|P62995|TRA2B_HUMAN
15 Dec 2023 01:14:56,808 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:56,808 INFO : Inserting sp|P63000|RAC1_HUMAN
15 Dec 2023 01:14:56,948 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:56,948 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 01:14:57,048 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:57,048 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 01:14:57,106 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:57,106 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:14:57,279 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:14:57,280 INFO : Inserting sp|P63151|2ABA_HUMAN
15 Dec 2023 01:14:57,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:57,297 INFO : Inserting sp|P63162|RSMN_HUMAN
15 Dec 2023 01:14:57,370 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:57,370 INFO : Inserting sp|P63167|DYL1_HUMAN
15 Dec 2023 01:14:57,396 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:14:57,397 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 01:14:57,503 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:57,503 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 01:14:57,636 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:14:57,636 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 01:14:57,664 INFO : 69% Done
15 Dec 2023 01:14:58,155 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:14:58,155 INFO : Inserting sp|P63267|ACTH_HUMAN
15 Dec 2023 01:14:58,543 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:14:58,543 INFO : Inserting sp|P63279|UBC9_HUMAN
15 Dec 2023 01:14:58,669 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:14:58,669 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 01:14:58,791 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:14:58,791 INFO : Inserting sp|P67812|SC11A_HUMAN
15 Dec 2023 01:14:58,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:14:58,825 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 01:14:58,914 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:58,914 INFO : Inserting sp|P68104|EF1A1_HUMAN
15 Dec 2023 01:14:59,124 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:14:59,124 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:14:59,295 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:14:59,295 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 01:14:59,605 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:14:59,605 INFO : Inserting sp|P68400|CSK21_HUMAN
15 Dec 2023 01:14:59,663 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:59,663 INFO : Inserting sp|P68402|PA1B2_HUMAN
15 Dec 2023 01:14:59,745 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:14:59,746 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 01:14:59,984 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:14:59,985 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:15:00,399 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:15:00,399 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:15:00,476 INFO : 70% Done
15 Dec 2023 01:15:00,500 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:00,500 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:15:00,585 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:00,585 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:15:01,012 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:15:01,012 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 01:15:01,056 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:01,056 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 01:15:01,219 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:01,219 INFO : Inserting sp|P78380|OLR1_HUMAN
15 Dec 2023 01:15:01,322 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:01,322 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 01:15:01,502 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:01,502 INFO : Inserting sp|P78423|X3CL1_HUMAN
15 Dec 2023 01:15:01,529 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:01,529 INFO : Inserting sp|P78509|RELN_HUMAN
15 Dec 2023 01:15:01,771 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:15:01,771 INFO : Inserting sp|P78527|PRKDC_HUMAN
15 Dec 2023 01:15:01,979 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:01,979 INFO : Inserting sp|P78536|ADA17_HUMAN
15 Dec 2023 01:15:02,006 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:02,007 INFO : Inserting sp|P78559|MAP1A_HUMAN
15 Dec 2023 01:15:02,095 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:02,095 INFO : Inserting sp|P78563|RED1_HUMAN
15 Dec 2023 01:15:02,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,106 INFO : Inserting sp|P79483|DRB3_HUMAN
15 Dec 2023 01:15:02,140 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,140 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 01:15:02,391 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:15:02,391 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:15:02,672 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:15:02,672 INFO : Inserting sp|P80217|IN35_HUMAN
15 Dec 2023 01:15:02,767 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:02,767 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 01:15:02,785 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,785 INFO : Inserting sp|P80404|GABT_HUMAN
15 Dec 2023 01:15:02,796 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,797 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:15:02,914 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:02,914 INFO : Inserting sp|P81172|HEPC_HUMAN
15 Dec 2023 01:15:02,921 INFO : 71% Done
15 Dec 2023 01:15:02,933 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,933 INFO : Inserting sp|P83731|RL24_HUMAN
15 Dec 2023 01:15:02,949 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:02,949 INFO : Inserting sp|P83916|CBX1_HUMAN
15 Dec 2023 01:15:02,991 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:02,992 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 01:15:03,112 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:03,112 INFO : Inserting sp|P84095|RHOG_HUMAN
15 Dec 2023 01:15:03,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:03,130 INFO : Inserting sp|P84103|SRSF3_HUMAN
15 Dec 2023 01:15:03,146 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:03,146 INFO : Inserting sp|P84243|H33_HUMAN
15 Dec 2023 01:15:03,337 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:03,337 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 01:15:03,384 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:03,384 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:15:03,482 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:03,483 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:15:04,240 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:15:04,240 INFO : Inserting sp|P98171|RHG04_HUMAN
15 Dec 2023 01:15:04,326 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:04,326 INFO : Inserting sp|P98172|EFNB1_HUMAN
15 Dec 2023 01:15:04,406 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:04,407 INFO : Inserting sp|P98179|RBM3_HUMAN
15 Dec 2023 01:15:04,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:04,420 INFO : Inserting sp|P99999|CYC_HUMAN
15 Dec 2023 01:15:04,460 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:04,460 INFO : Inserting sp|Q00059|TFAM_HUMAN
15 Dec 2023 01:15:04,482 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:04,483 INFO : Inserting sp|Q00325|MPCP_HUMAN
15 Dec 2023 01:15:04,534 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:04,534 INFO : Inserting sp|Q00587|BORG5_HUMAN
15 Dec 2023 01:15:04,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:04,552 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 01:15:05,168 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:15:05,168 INFO : Inserting sp|Q00688|FKBP3_HUMAN
15 Dec 2023 01:15:05,188 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:05,188 INFO : Inserting sp|Q00722|PLCB2_HUMAN
15 Dec 2023 01:15:05,237 INFO : 72% Done
15 Dec 2023 01:15:05,280 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:05,280 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 01:15:05,344 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:05,344 INFO : Inserting sp|Q01081|U2AF1_HUMAN
15 Dec 2023 01:15:05,361 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:05,361 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:15:05,581 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:05,581 INFO : Inserting sp|Q01432|AMPD3_HUMAN
15 Dec 2023 01:15:05,626 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:05,626 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 01:15:05,669 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:05,669 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:15:05,960 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:15:05,960 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 01:15:06,436 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:15:06,436 INFO : Inserting sp|Q02388|CO7A1_HUMAN
15 Dec 2023 01:15:06,505 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:06,505 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 01:15:06,652 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:06,652 INFO : Inserting sp|Q02750|MP2K1_HUMAN
15 Dec 2023 01:15:06,684 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:06,684 INFO : Inserting sp|Q02790|FKBP4_HUMAN
15 Dec 2023 01:15:06,748 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:06,748 INFO : Inserting sp|Q02809|PLOD1_HUMAN
15 Dec 2023 01:15:06,959 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:15:06,960 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 01:15:07,122 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:07,122 INFO : Inserting sp|Q02878|RL6_HUMAN
15 Dec 2023 01:15:07,143 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:07,143 INFO : Inserting sp|Q02880|TOP2B_HUMAN
15 Dec 2023 01:15:07,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:07,168 INFO : Inserting sp|Q02978|M2OM_HUMAN
15 Dec 2023 01:15:07,223 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:07,223 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 01:15:07,267 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:07,267 INFO : Inserting sp|Q03001|DYST_HUMAN
15 Dec 2023 01:15:07,304 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:07,304 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:15:07,404 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:07,404 INFO : Inserting sp|Q03252|LMNB2_HUMAN
15 Dec 2023 01:15:07,419 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:07,420 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:15:07,584 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:07,584 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:15:07,669 INFO : 73% Done
15 Dec 2023 01:15:07,733 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:07,733 INFO : Inserting sp|Q04721|NOTC2_HUMAN
15 Dec 2023 01:15:07,782 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:07,782 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 01:15:07,863 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:07,863 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 01:15:07,945 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:07,945 INFO : Inserting sp|Q04912|RON_HUMAN
15 Dec 2023 01:15:07,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:07,962 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 01:15:08,055 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:08,055 INFO : Inserting sp|Q05193|DYN1_HUMAN
15 Dec 2023 01:15:08,138 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:08,138 INFO : Inserting sp|Q05315|LEG10_HUMAN
15 Dec 2023 01:15:08,171 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:08,171 INFO : Inserting sp|Q05655|KPCD_HUMAN
15 Dec 2023 01:15:08,255 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:08,255 INFO : Inserting sp|Q05707|COEA1_HUMAN
15 Dec 2023 01:15:08,282 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:08,282 INFO : Imported 1300 peptide groups.
15 Dec 2023 01:15:08,282 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:15:08,614 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:15:08,614 INFO : Inserting sp|Q06124|PTN11_HUMAN
15 Dec 2023 01:15:08,656 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:08,656 INFO : Inserting sp|Q06141|REG3A_HUMAN
15 Dec 2023 01:15:08,675 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:08,675 INFO : Inserting sp|Q06187|BTK_HUMAN
15 Dec 2023 01:15:08,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:08,696 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:15:08,846 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:08,846 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 01:15:08,891 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:08,892 INFO : Inserting sp|Q06828|FMOD_HUMAN
15 Dec 2023 01:15:09,000 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:09,000 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 01:15:09,071 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:09,071 INFO : Inserting sp|Q07020|RL18_HUMAN
15 Dec 2023 01:15:09,099 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:09,099 INFO : Inserting sp|Q07666|KHDR1_HUMAN
15 Dec 2023 01:15:09,131 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:09,131 INFO : Inserting sp|Q07812|BAX_HUMAN
15 Dec 2023 01:15:09,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:09,149 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 01:15:09,524 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:15:09,524 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 01:15:09,544 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:09,544 INFO : Inserting sp|Q07960|RHG01_HUMAN
15 Dec 2023 01:15:09,709 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:09,710 INFO : Inserting sp|Q08043|ACTN3_HUMAN
15 Dec 2023 01:15:09,869 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:09,869 INFO : Inserting sp|Q08174|PCDH1_HUMAN
15 Dec 2023 01:15:09,887 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:09,887 INFO : Inserting sp|Q08209|PP2BA_HUMAN
15 Dec 2023 01:15:09,953 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:09,953 INFO : Inserting sp|Q08211|DHX9_HUMAN
15 Dec 2023 01:15:10,034 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:10,034 INFO : Inserting sp|Q08257|QOR_HUMAN
15 Dec 2023 01:15:10,049 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:10,050 INFO : Inserting sp|Q08345|DDR1_HUMAN
15 Dec 2023 01:15:10,058 INFO : 74% Done
15 Dec 2023 01:15:10,113 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:10,113 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:15:10,487 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:15:10,487 INFO : Inserting sp|Q08431|MFGM_HUMAN
15 Dec 2023 01:15:10,569 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:10,569 INFO : Inserting sp|Q08477|CP4F3_HUMAN
15 Dec 2023 01:15:10,641 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:10,641 INFO : Inserting sp|Q08554|DSC1_HUMAN
15 Dec 2023 01:15:10,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:10,660 INFO : Inserting sp|Q08623|HDHD1_HUMAN
15 Dec 2023 01:15:10,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:10,680 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 01:15:10,783 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:10,783 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:15:10,865 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:10,865 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 01:15:10,996 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:10,996 INFO : Inserting sp|Q09328|MGT5A_HUMAN
15 Dec 2023 01:15:11,040 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:11,040 INFO : Inserting sp|Q0VD83|APOBR_HUMAN
15 Dec 2023 01:15:11,058 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:11,058 INFO : Inserting sp|Q0VGL1|LTOR4_HUMAN
15 Dec 2023 01:15:11,079 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:11,079 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 01:15:11,218 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:11,218 INFO : Inserting sp|Q10472|GALT1_HUMAN
15 Dec 2023 01:15:11,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:11,231 INFO : Inserting sp|Q10567|AP1B1_HUMAN
15 Dec 2023 01:15:11,361 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:11,362 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 01:15:11,602 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:11,602 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 01:15:11,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:11,620 INFO : Inserting sp|Q12794|HYAL1_HUMAN
15 Dec 2023 01:15:11,683 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:11,683 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:15:12,080 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:15:12,081 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:15:12,200 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:12,200 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 01:15:12,783 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:15:12,783 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 01:15:12,848 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:12,848 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 01:15:12,953 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:12,953 INFO : Inserting sp|Q12904|AIMP1_HUMAN
15 Dec 2023 01:15:12,977 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:12,977 INFO : Inserting sp|Q12905|ILF2_HUMAN
15 Dec 2023 01:15:13,062 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:13,062 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 01:15:13,116 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:13,116 INFO : Inserting sp|Q12907|LMAN2_HUMAN
15 Dec 2023 01:15:13,415 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:15:13,415 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 01:15:13,458 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:13,458 INFO : Inserting sp|Q12931|TRAP1_HUMAN
15 Dec 2023 01:15:13,476 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,476 INFO : Inserting sp|Q12972|PP1R8_HUMAN
15 Dec 2023 01:15:13,496 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,496 INFO : Inserting sp|Q13011|ECH1_HUMAN
15 Dec 2023 01:15:13,545 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:13,545 INFO : Inserting sp|Q13043|STK4_HUMAN
15 Dec 2023 01:15:13,593 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:13,593 INFO : Inserting sp|Q13045|FLII_HUMAN
15 Dec 2023 01:15:13,733 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:13,733 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 01:15:13,815 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:13,815 INFO : Inserting sp|Q13098|CSN1_HUMAN
15 Dec 2023 01:15:13,832 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,832 INFO : Inserting sp|Q13099|IFT88_HUMAN
15 Dec 2023 01:15:13,848 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,848 INFO : Inserting sp|Q13126|MTAP_HUMAN
15 Dec 2023 01:15:13,912 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:13,912 INFO : Inserting sp|Q13148|TADBP_HUMAN
15 Dec 2023 01:15:13,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,931 INFO : Inserting sp|Q13151|ROA0_HUMAN
15 Dec 2023 01:15:13,950 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:13,950 INFO : Inserting sp|Q13153|PAK1_HUMAN
15 Dec 2023 01:15:13,993 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:13,993 INFO : Inserting sp|Q13177|PAK2_HUMAN
15 Dec 2023 01:15:14,064 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:14,064 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 01:15:14,109 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:14,109 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 01:15:14,166 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:14,167 INFO : Inserting sp|Q13214|SEM3B_HUMAN
15 Dec 2023 01:15:14,186 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:14,186 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 01:15:14,235 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:14,235 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 01:15:14,369 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:14,369 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:15:14,597 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:15:14,597 INFO : Inserting sp|Q13247|SRSF6_HUMAN
15 Dec 2023 01:15:14,617 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:14,617 INFO : Inserting sp|Q13277|STX3_HUMAN
15 Dec 2023 01:15:14,635 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:14,635 INFO : Inserting sp|Q13283|G3BP1_HUMAN
15 Dec 2023 01:15:14,664 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:14,664 INFO : Inserting sp|Q13303|KCAB2_HUMAN
15 Dec 2023 01:15:14,768 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:14,769 INFO : Inserting sp|Q13308|PTK7_HUMAN
15 Dec 2023 01:15:14,818 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:14,818 INFO : Inserting sp|Q13310|PABP4_HUMAN
15 Dec 2023 01:15:14,885 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:14,885 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 01:15:14,984 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:14,984 INFO : Inserting sp|Q13347|EIF3I_HUMAN
15 Dec 2023 01:15:15,023 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:15,024 INFO : Inserting sp|Q13349|ITAD_HUMAN
15 Dec 2023 01:15:15,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,056 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 01:15:15,075 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,076 INFO : Inserting sp|Q13409|DC1I2_HUMAN
15 Dec 2023 01:15:15,098 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,098 INFO : Inserting sp|Q13418|ILK_HUMAN
15 Dec 2023 01:15:15,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,120 INFO : Inserting sp|Q13421|MSLN_HUMAN
15 Dec 2023 01:15:15,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,153 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 01:15:15,222 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:15,222 INFO : Inserting sp|Q13451|FKBP5_HUMAN
15 Dec 2023 01:15:15,228 INFO : 75% Done
15 Dec 2023 01:15:15,234 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,234 INFO : Inserting sp|Q13488|VPP3_HUMAN
15 Dec 2023 01:15:15,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,257 INFO : Inserting sp|Q13492|PICAL_HUMAN
15 Dec 2023 01:15:15,337 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:15,337 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 01:15:15,420 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:15,420 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:15:15,513 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:15,513 INFO : Inserting sp|Q13519|PNOC_HUMAN
15 Dec 2023 01:15:15,529 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,529 INFO : Inserting sp|Q13547|HDAC1_HUMAN
15 Dec 2023 01:15:15,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,551 INFO : Inserting sp|Q13554|KCC2B_HUMAN
15 Dec 2023 01:15:15,585 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,585 INFO : Inserting sp|Q13564|ULA1_HUMAN
15 Dec 2023 01:15:15,619 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,619 INFO : Inserting sp|Q13576|IQGA2_HUMAN
15 Dec 2023 01:15:15,682 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:15,682 INFO : Inserting sp|Q13616|CUL1_HUMAN
15 Dec 2023 01:15:15,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,704 INFO : Inserting sp|Q13617|CUL2_HUMAN
15 Dec 2023 01:15:15,728 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,728 INFO : Inserting sp|Q13618|CUL3_HUMAN
15 Dec 2023 01:15:15,743 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,743 INFO : Inserting sp|Q13636|RAB31_HUMAN
15 Dec 2023 01:15:15,785 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:15,785 INFO : Inserting sp|Q13637|RAB32_HUMAN
15 Dec 2023 01:15:15,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,795 INFO : Inserting sp|Q13641|TPBG_HUMAN
15 Dec 2023 01:15:15,816 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:15,816 INFO : Inserting sp|Q13698|CAC1S_HUMAN
15 Dec 2023 01:15:15,841 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:15,841 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:15:16,008 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:16,008 INFO : Inserting sp|Q13765|NACA_HUMAN
15 Dec 2023 01:15:16,035 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:16,036 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 01:15:16,062 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:16,062 INFO : Imported 1400 peptide groups.
15 Dec 2023 01:15:16,062 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 01:15:16,283 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:15:16,283 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:15:16,996 DEBUG: Inserted 50 peptides
15 Dec 2023 01:15:17,056 DEBUG: Total peptides inserted: 53
15 Dec 2023 01:15:17,056 INFO : Inserting sp|Q13825|AUHM_HUMAN
15 Dec 2023 01:15:17,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:17,074 INFO : Inserting sp|Q13838|DX39B_HUMAN
15 Dec 2023 01:15:17,185 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:17,185 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 01:15:17,323 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:17,323 INFO : Inserting sp|Q13885|TBB2A_HUMAN
15 Dec 2023 01:15:17,501 INFO : 76% Done
15 Dec 2023 01:15:17,553 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:15:17,554 INFO : Inserting sp|Q14005|IL16_HUMAN
15 Dec 2023 01:15:17,593 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:17,593 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:15:17,652 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:17,652 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:15:17,786 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:17,786 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 01:15:18,036 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:15:18,036 INFO : Inserting sp|Q14116|IL18_HUMAN
15 Dec 2023 01:15:18,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:18,056 INFO : Inserting sp|Q14118|DAG1_HUMAN
15 Dec 2023 01:15:18,295 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:15:18,295 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 01:15:18,336 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:18,336 INFO : Inserting sp|Q14141|SEPT6_HUMAN
15 Dec 2023 01:15:18,495 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:18,495 INFO : Inserting sp|Q14152|EIF3A_HUMAN
15 Dec 2023 01:15:18,579 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:18,579 INFO : Inserting sp|Q14155|ARHG7_HUMAN
15 Dec 2023 01:15:18,594 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:18,595 INFO : Inserting sp|Q14161|GIT2_HUMAN
15 Dec 2023 01:15:18,614 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:18,614 INFO : Inserting sp|Q14165|MLEC_HUMAN
15 Dec 2023 01:15:18,650 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:18,650 INFO : Inserting sp|Q14166|TTL12_HUMAN
15 Dec 2023 01:15:18,729 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:18,729 INFO : Inserting sp|Q14194|DPYL1_HUMAN
15 Dec 2023 01:15:18,755 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:18,756 INFO : Inserting sp|Q14204|DYHC1_HUMAN
15 Dec 2023 01:15:18,941 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:18,941 INFO : Inserting sp|Q14213|IL27B_HUMAN
15 Dec 2023 01:15:18,980 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:18,981 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 01:15:19,099 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:19,099 INFO : Inserting sp|Q14258|TRI25_HUMAN
15 Dec 2023 01:15:19,151 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:19,151 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 01:15:19,186 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:19,186 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:15:19,279 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:19,279 INFO : Inserting sp|Q14331|FRG1_HUMAN
15 Dec 2023 01:15:19,301 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:19,301 INFO : Inserting sp|Q14344|GNA13_HUMAN
15 Dec 2023 01:15:19,353 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:19,353 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 01:15:19,484 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:19,484 INFO : Inserting sp|Q14444|CAPR1_HUMAN
15 Dec 2023 01:15:19,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:19,510 INFO : Inserting sp|Q14508|WFDC2_HUMAN
15 Dec 2023 01:15:19,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:19,542 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:15:19,912 INFO : 77% Done
15 Dec 2023 01:15:19,974 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:15:19,974 INFO : Inserting sp|Q14517|FAT1_HUMAN
15 Dec 2023 01:15:20,014 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:20,014 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:15:20,117 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:20,117 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:15:21,051 DEBUG: Inserted 50 peptides
15 Dec 2023 01:15:21,160 DEBUG: Total peptides inserted: 55
15 Dec 2023 01:15:21,161 INFO : Inserting sp|Q14651|PLSI_HUMAN
15 Dec 2023 01:15:21,232 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:21,232 INFO : Inserting sp|Q14678|KANK1_HUMAN
15 Dec 2023 01:15:21,251 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:21,251 INFO : Inserting sp|Q14696|MESD_HUMAN
15 Dec 2023 01:15:21,270 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:21,270 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:15:21,513 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:21,513 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 01:15:21,723 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:21,723 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 01:15:21,747 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:21,747 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 01:15:21,824 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:21,824 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:15:21,904 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:21,904 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:15:22,112 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:22,112 INFO : Inserting sp|Q14980|NUMA1_HUMAN
15 Dec 2023 01:15:22,167 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:22,167 INFO : Inserting sp|Q14982|OPCM_HUMAN
15 Dec 2023 01:15:22,253 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:22,253 INFO : Inserting sp|Q15008|PSMD6_HUMAN
15 Dec 2023 01:15:22,337 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:22,338 INFO : Inserting sp|Q15019|SEPT2_HUMAN
15 Dec 2023 01:15:22,380 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:22,380 INFO : Inserting sp|Q15027|ACAP1_HUMAN
15 Dec 2023 01:15:22,416 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:22,416 INFO : Inserting sp|Q15046|SYK_HUMAN
15 Dec 2023 01:15:22,422 INFO : 78% Done
15 Dec 2023 01:15:22,459 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:22,459 INFO : Inserting sp|Q15051|IQCB1_HUMAN
15 Dec 2023 01:15:22,486 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:22,486 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 01:15:22,501 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:22,501 INFO : Inserting sp|Q15057|ACAP2_HUMAN
15 Dec 2023 01:15:22,532 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:22,532 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 01:15:22,659 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:22,659 INFO : Inserting sp|Q15067|ACOX1_HUMAN
15 Dec 2023 01:15:22,704 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:22,704 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 01:15:22,768 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:22,768 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 01:15:22,823 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:22,823 INFO : Inserting sp|Q15102|PA1B3_HUMAN
15 Dec 2023 01:15:22,844 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:22,844 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:15:23,157 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:15:23,157 INFO : Inserting sp|Q15121|PEA15_HUMAN
15 Dec 2023 01:15:23,228 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:23,228 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 01:15:23,527 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:15:23,527 INFO : Inserting sp|Q15166|PON3_HUMAN
15 Dec 2023 01:15:23,537 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:23,538 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 01:15:23,570 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:23,570 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 01:15:23,625 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:23,625 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 01:15:23,761 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:23,761 INFO : Inserting sp|Q15262|PTPRK_HUMAN
15 Dec 2023 01:15:23,780 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:23,780 INFO : Inserting sp|Q15286|RAB35_HUMAN
15 Dec 2023 01:15:23,813 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:23,814 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 01:15:23,906 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:23,907 INFO : Inserting sp|Q15366|PCBP2_HUMAN
15 Dec 2023 01:15:23,949 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:23,949 INFO : Inserting sp|Q15369|ELOC_HUMAN
15 Dec 2023 01:15:23,961 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:23,962 INFO : Inserting sp|Q15370|ELOB_HUMAN
15 Dec 2023 01:15:23,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:23,981 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 01:15:24,026 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:24,027 INFO : Inserting sp|Q15393|SF3B3_HUMAN
15 Dec 2023 01:15:24,165 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:24,165 INFO : Inserting sp|Q15428|SF3A2_HUMAN
15 Dec 2023 01:15:24,198 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:24,198 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 01:15:24,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:24,292 INFO : Inserting sp|Q15436|SC23A_HUMAN
15 Dec 2023 01:15:24,358 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:24,358 INFO : Inserting sp|Q15459|SF3A1_HUMAN
15 Dec 2023 01:15:24,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:24,375 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 01:15:24,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:24,399 INFO : Inserting sp|Q15555|MARE2_HUMAN
15 Dec 2023 01:15:24,430 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:24,431 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:15:24,802 INFO : 79% Done
15 Dec 2023 01:15:24,988 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:15:24,988 INFO : Inserting sp|Q15631|TSN_HUMAN
15 Dec 2023 01:15:25,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:25,016 INFO : Inserting sp|Q15637|SF01_HUMAN
15 Dec 2023 01:15:25,050 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:25,050 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 01:15:25,101 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:25,102 INFO : Inserting sp|Q15717|ELAV1_HUMAN
15 Dec 2023 01:15:25,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:25,119 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:15:25,518 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:15:25,518 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 01:15:25,685 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:25,685 INFO : Inserting sp|Q15819|UB2V2_HUMAN
15 Dec 2023 01:15:25,710 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:25,710 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 01:15:25,751 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:25,751 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:15:25,915 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:25,916 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 01:15:25,957 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:25,958 INFO : Inserting sp|Q15904|VAS1_HUMAN
15 Dec 2023 01:15:26,088 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:26,088 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 01:15:26,151 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:26,151 INFO : Inserting sp|Q16143|SYUB_HUMAN
15 Dec 2023 01:15:26,172 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:26,172 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 01:15:26,247 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:26,247 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:15:26,460 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:26,460 INFO : Inserting sp|Q16288|NTRK3_HUMAN
15 Dec 2023 01:15:26,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:26,477 INFO : Inserting sp|Q16363|LAMA4_HUMAN
15 Dec 2023 01:15:26,528 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:26,528 INFO : Inserting sp|Q16394|EXT1_HUMAN
15 Dec 2023 01:15:26,576 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:26,576 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 01:15:26,640 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:26,640 INFO : Inserting sp|Q16512|PKN1_HUMAN
15 Dec 2023 01:15:26,664 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:26,664 INFO : Imported 1500 peptide groups.
15 Dec 2023 01:15:26,664 INFO : Inserting sp|Q16531|DDB1_HUMAN
15 Dec 2023 01:15:26,933 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:15:26,933 INFO : Inserting sp|Q16539|MK14_HUMAN
15 Dec 2023 01:15:27,009 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:27,009 INFO : Inserting sp|Q16555|DPYL2_HUMAN
15 Dec 2023 01:15:27,143 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:27,143 INFO : Inserting sp|Q16576|RBBP7_HUMAN
15 Dec 2023 01:15:27,248 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:27,248 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 01:15:27,254 INFO : 80% Done
15 Dec 2023 01:15:27,463 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:15:27,464 INFO : Inserting sp|Q16620|NTRK2_HUMAN
15 Dec 2023 01:15:27,487 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:27,487 INFO : Inserting sp|Q16627|CCL14_HUMAN
15 Dec 2023 01:15:27,497 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:27,497 INFO : Inserting sp|Q16629|SRSF7_HUMAN
15 Dec 2023 01:15:27,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:27,511 INFO : Inserting sp|Q16644|MAPK3_HUMAN
15 Dec 2023 01:15:27,537 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:27,537 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 01:15:27,562 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:27,562 INFO : Inserting sp|Q16658|FSCN1_HUMAN
15 Dec 2023 01:15:27,618 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:27,618 INFO : Inserting sp|Q16666|IF16_HUMAN
15 Dec 2023 01:15:27,714 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:27,714 INFO : Inserting sp|Q16674|MIA_HUMAN
15 Dec 2023 01:15:27,743 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:27,743 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 01:15:28,098 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:15:28,098 INFO : Inserting sp|Q16719|KYNU_HUMAN
15 Dec 2023 01:15:28,174 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:28,174 INFO : Inserting sp|Q16769|QPCT_HUMAN
15 Dec 2023 01:15:28,244 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:28,244 INFO : Inserting sp|Q16774|KGUA_HUMAN
15 Dec 2023 01:15:28,263 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:28,263 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 01:15:28,330 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:28,330 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:15:28,443 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:28,443 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:15:28,610 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:28,610 INFO : Inserting sp|Q16795|NDUA9_HUMAN
15 Dec 2023 01:15:28,629 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:28,629 INFO : Inserting sp|Q16836|HCDH_HUMAN
15 Dec 2023 01:15:28,676 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:28,676 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:15:28,796 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:28,796 INFO : Inserting sp|Q16853|AOC3_HUMAN
15 Dec 2023 01:15:28,812 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:28,812 INFO : Inserting sp|Q16875|F263_HUMAN
15 Dec 2023 01:15:28,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:28,830 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 01:15:29,039 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:29,039 INFO : Inserting sp|Q24JP5|T132A_HUMAN
15 Dec 2023 01:15:29,201 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:29,201 INFO : Inserting sp|Q2M1P5|KIF7_HUMAN
15 Dec 2023 01:15:29,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,220 INFO : Inserting sp|Q2M1Z3|RHG31_HUMAN
15 Dec 2023 01:15:29,242 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,242 INFO : Inserting sp|Q2M389|WASC4_HUMAN
15 Dec 2023 01:15:29,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,258 INFO : Inserting sp|Q2TAY7|SMU1_HUMAN
15 Dec 2023 01:15:29,341 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:29,341 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 01:15:29,457 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:29,457 INFO : Inserting sp|Q3V6T2|GRDN_HUMAN
15 Dec 2023 01:15:29,470 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,470 INFO : Inserting sp|Q496F6|CLM2_HUMAN
15 Dec 2023 01:15:29,485 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,485 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:15:29,573 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:29,573 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:15:29,587 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,587 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 01:15:29,618 INFO : 81% Done
15 Dec 2023 01:15:29,651 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:29,652 INFO : Inserting sp|Q53FA7|QORX_HUMAN
15 Dec 2023 01:15:29,686 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:29,686 INFO : Inserting sp|Q53GQ0|DHB12_HUMAN
15 Dec 2023 01:15:29,728 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:29,728 INFO : Inserting sp|Q53GS9|SNUT2_HUMAN
15 Dec 2023 01:15:29,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,744 INFO : Inserting sp|Q5GLZ8|HERC4_HUMAN
15 Dec 2023 01:15:29,760 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,760 INFO : Inserting sp|Q5JRA6|TGO1_HUMAN
15 Dec 2023 01:15:29,769 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,769 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 01:15:29,824 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:29,824 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 01:15:29,839 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,839 INFO : Inserting sp|Q5QGZ9|CL12A_HUMAN
15 Dec 2023 01:15:29,856 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:29,856 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:15:30,017 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:30,017 INFO : Inserting sp|Q5T1M5|FKB15_HUMAN
15 Dec 2023 01:15:30,058 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:30,059 INFO : Inserting sp|Q5T4S7|UBR4_HUMAN
15 Dec 2023 01:15:30,079 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,079 INFO : Inserting sp|Q5TEJ8|THMS2_HUMAN
15 Dec 2023 01:15:30,122 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:30,122 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:15:30,163 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:30,164 INFO : Inserting sp|Q5VWZ2|LYPL1_HUMAN
15 Dec 2023 01:15:30,178 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,178 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 01:15:30,205 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:30,205 INFO : Inserting sp|Q66K74|MAP1S_HUMAN
15 Dec 2023 01:15:30,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,228 INFO : Inserting sp|Q68CZ6|HAUS3_HUMAN
15 Dec 2023 01:15:30,254 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:30,254 INFO : Inserting sp|Q68E01|INT3_HUMAN
15 Dec 2023 01:15:30,273 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,273 INFO : Inserting sp|Q6DD88|ATLA3_HUMAN
15 Dec 2023 01:15:30,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,291 INFO : Inserting sp|Q6DN90|IQEC1_HUMAN
15 Dec 2023 01:15:30,324 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:30,324 INFO : Inserting sp|Q6EEV6|SUMO4_HUMAN
15 Dec 2023 01:15:30,334 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,334 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:15:30,426 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:30,426 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 01:15:30,430 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,430 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:15:30,539 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:30,539 INFO : Inserting sp|Q6IA69|NADE_HUMAN
15 Dec 2023 01:15:30,594 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:30,594 INFO : Inserting sp|Q6IAA8|LTOR1_HUMAN
15 Dec 2023 01:15:30,639 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:30,639 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 01:15:30,747 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:30,747 INFO : Inserting sp|Q6ICL3|TNG2_HUMAN
15 Dec 2023 01:15:30,792 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:30,792 INFO : Inserting sp|Q6NW40|RGMB_HUMAN
15 Dec 2023 01:15:30,849 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:30,849 INFO : Inserting sp|Q6NXG1|ESRP1_HUMAN
15 Dec 2023 01:15:30,864 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,864 INFO : Inserting sp|Q6NZY4|ZCHC8_HUMAN
15 Dec 2023 01:15:30,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:30,885 INFO : Inserting sp|Q6P4A8|PLBL1_HUMAN
15 Dec 2023 01:15:30,994 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:30,994 INFO : Inserting sp|Q6P9A2|GLT18_HUMAN
15 Dec 2023 01:15:31,010 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:31,010 INFO : Inserting sp|Q6PCB0|VWA1_HUMAN
15 Dec 2023 01:15:31,065 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:31,065 INFO : Inserting sp|Q6PCE3|PGM2L_HUMAN
15 Dec 2023 01:15:31,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:31,084 INFO : Inserting sp|Q6PIW4|FIGL1_HUMAN
15 Dec 2023 01:15:31,105 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:31,105 INFO : Inserting sp|Q6UWE0|LRSM1_HUMAN
15 Dec 2023 01:15:31,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:31,130 INFO : Inserting sp|Q6UWR7|ENPP6_HUMAN
15 Dec 2023 01:15:31,163 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:31,163 INFO : Inserting sp|Q6UWY2|PRS57_HUMAN
15 Dec 2023 01:15:31,191 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:31,191 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:15:31,399 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:31,399 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 01:15:31,491 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:31,491 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 01:15:31,591 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:31,591 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 01:15:31,662 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:31,663 INFO : Inserting sp|Q6VY07|PACS1_HUMAN
15 Dec 2023 01:15:31,680 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:31,680 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:15:31,914 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:31,914 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:15:32,052 INFO : 82% Done
15 Dec 2023 01:15:32,133 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:32,133 INFO : Inserting sp|Q6ZMI3|GLDN_HUMAN
15 Dec 2023 01:15:32,186 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:32,186 INFO : Inserting sp|Q6ZNJ1|NBEL2_HUMAN
15 Dec 2023 01:15:32,210 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:32,211 INFO : Inserting sp|Q6ZRP7|QSOX2_HUMAN
15 Dec 2023 01:15:32,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:32,246 INFO : Inserting sp|Q6ZT62|BGIN_HUMAN
15 Dec 2023 01:15:32,267 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:32,267 INFO : Inserting sp|Q6ZTN6|AN13D_HUMAN
15 Dec 2023 01:15:32,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:32,288 INFO : Inserting sp|Q70J99|UN13D_HUMAN
15 Dec 2023 01:15:32,379 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:32,379 INFO : Inserting sp|Q71DI3|H32_HUMAN
15 Dec 2023 01:15:32,621 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:15:32,621 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 01:15:32,805 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:32,805 INFO : Inserting sp|Q71UI9|H2AV_HUMAN
15 Dec 2023 01:15:32,877 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:32,877 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 01:15:32,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:32,899 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 01:15:32,987 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:32,987 INFO : Inserting sp|Q7L1Q6|5MP2_HUMAN
15 Dec 2023 01:15:33,037 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:33,037 INFO : Inserting sp|Q7L2H7|EIF3M_HUMAN
15 Dec 2023 01:15:33,112 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:33,112 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 01:15:33,145 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:33,145 INFO : Inserting sp|Q7L576|CYFP1_HUMAN
15 Dec 2023 01:15:33,211 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:33,211 INFO : Inserting sp|Q7L591|DOK3_HUMAN
15 Dec 2023 01:15:33,233 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,233 INFO : Inserting sp|Q7L592|NDUF7_HUMAN
15 Dec 2023 01:15:33,245 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,245 INFO : Imported 1600 peptide groups.
15 Dec 2023 01:15:33,245 INFO : Inserting sp|Q7LFX5|CHSTF_HUMAN
15 Dec 2023 01:15:33,267 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,268 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 01:15:33,315 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:33,315 INFO : Inserting sp|Q7Z406|MYH14_HUMAN
15 Dec 2023 01:15:33,379 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:33,380 INFO : Inserting sp|Q7Z434|MAVS_HUMAN
15 Dec 2023 01:15:33,404 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,404 INFO : Inserting sp|Q7Z5R6|AB1IP_HUMAN
15 Dec 2023 01:15:33,450 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:33,450 INFO : Inserting sp|Q7Z6I6|RHG30_HUMAN
15 Dec 2023 01:15:33,482 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:33,482 INFO : Inserting sp|Q7Z6K1|THAP5_HUMAN
15 Dec 2023 01:15:33,503 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,503 INFO : Inserting sp|Q7Z6M3|MILR1_HUMAN
15 Dec 2023 01:15:33,522 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:33,523 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 01:15:33,589 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:33,589 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 01:15:33,652 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:33,653 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 01:15:34,013 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:15:34,013 INFO : Inserting sp|Q86SE5|RALYL_HUMAN
15 Dec 2023 01:15:34,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:34,028 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 01:15:34,094 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:34,094 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 01:15:34,123 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:34,123 INFO : Inserting sp|Q86TH1|ATL2_HUMAN
15 Dec 2023 01:15:34,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:34,138 INFO : Inserting sp|Q86UW6|N4BP2_HUMAN
15 Dec 2023 01:15:34,147 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:34,148 INFO : Inserting sp|Q86UX2|ITIH5_HUMAN
15 Dec 2023 01:15:34,276 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:34,276 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:15:34,465 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:34,465 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:15:34,592 INFO : 83% Done
15 Dec 2023 01:15:34,882 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:15:34,882 INFO : Inserting sp|Q86VI3|IQGA3_HUMAN
15 Dec 2023 01:15:34,951 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:34,951 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 01:15:35,186 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:35,186 INFO : Inserting sp|Q86Y34|AGRG3_HUMAN
15 Dec 2023 01:15:35,213 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,213 INFO : Inserting sp|Q86YT9|JAML_HUMAN
15 Dec 2023 01:15:35,238 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:35,238 INFO : Inserting sp|Q86Z02|HIPK1_HUMAN
15 Dec 2023 01:15:35,258 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,258 INFO : Inserting sp|Q8IUI8|CRLF3_HUMAN
15 Dec 2023 01:15:35,276 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,276 INFO : Inserting sp|Q8IUK5|PLDX1_HUMAN
15 Dec 2023 01:15:35,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,297 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:15:35,376 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:35,376 INFO : Inserting sp|Q8IUZ5|AT2L2_HUMAN
15 Dec 2023 01:15:35,394 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,394 INFO : Inserting sp|Q8IV08|PLD3_HUMAN
15 Dec 2023 01:15:35,418 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,418 INFO : Inserting sp|Q8IWA5|CTL2_HUMAN
15 Dec 2023 01:15:35,451 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:35,451 INFO : Inserting sp|Q8IWB7|WDFY1_HUMAN
15 Dec 2023 01:15:35,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,479 INFO : Inserting sp|Q8IWV2|CNTN4_HUMAN
15 Dec 2023 01:15:35,536 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:35,536 INFO : Inserting sp|Q8IWV7|UBR1_HUMAN
15 Dec 2023 01:15:35,556 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,556 INFO : Inserting sp|Q8IWY4|SCUB1_HUMAN
15 Dec 2023 01:15:35,569 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,570 INFO : Inserting sp|Q8IX12|CCAR1_HUMAN
15 Dec 2023 01:15:35,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,592 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 01:15:35,718 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:35,718 INFO : Inserting sp|Q8IYD1|ERF3B_HUMAN
15 Dec 2023 01:15:35,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,739 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:15:35,808 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:35,809 INFO : Inserting sp|Q8IYT4|KATL2_HUMAN
15 Dec 2023 01:15:35,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,830 INFO : Inserting sp|Q8IZ07|AN13A_HUMAN
15 Dec 2023 01:15:35,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:35,851 INFO : Inserting sp|Q8IZF0|NALCN_HUMAN
15 Dec 2023 01:15:35,871 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:35,871 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 01:15:35,946 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:35,946 INFO : Inserting sp|Q8N149|LIRA2_HUMAN
15 Dec 2023 01:15:35,990 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:35,990 INFO : Inserting sp|Q8N1K5|THMS1_HUMAN
15 Dec 2023 01:15:36,030 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:36,030 INFO : Inserting sp|Q8N386|LRC25_HUMAN
15 Dec 2023 01:15:36,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,056 INFO : Inserting sp|Q8N3J6|CADM2_HUMAN
15 Dec 2023 01:15:36,140 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:36,140 INFO : Inserting sp|Q8N474|SFRP1_HUMAN
15 Dec 2023 01:15:36,195 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:36,195 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:15:36,287 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:36,287 INFO : Inserting sp|Q8N6Q3|CD177_HUMAN
15 Dec 2023 01:15:36,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,291 INFO : Inserting sp|Q8NBI6|XXLT1_HUMAN
15 Dec 2023 01:15:36,319 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,319 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 01:15:36,340 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:36,340 INFO : Inserting sp|Q8NBJ5|GT251_HUMAN
15 Dec 2023 01:15:36,403 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:36,403 INFO : Inserting sp|Q8NBJ7|SUMF2_HUMAN
15 Dec 2023 01:15:36,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,426 INFO : Inserting sp|Q8NBQ5|DHB11_HUMAN
15 Dec 2023 01:15:36,444 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,444 INFO : Inserting sp|Q8NBS9|TXND5_HUMAN
15 Dec 2023 01:15:36,521 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:36,521 INFO : Inserting sp|Q8NCC3|PAG15_HUMAN
15 Dec 2023 01:15:36,590 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:36,590 INFO : Inserting sp|Q8NCL4|GALT6_HUMAN
15 Dec 2023 01:15:36,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,611 INFO : Inserting sp|Q8NCW5|NNRE_HUMAN
15 Dec 2023 01:15:36,705 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:36,705 INFO : Inserting sp|Q8NES3|LFNG_HUMAN
15 Dec 2023 01:15:36,738 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:36,738 INFO : Inserting sp|Q8NF50|DOCK8_HUMAN
15 Dec 2023 01:15:36,764 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,765 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 01:15:36,873 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:36,873 INFO : Inserting sp|Q8NFG4|FLCN_HUMAN
15 Dec 2023 01:15:36,905 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,905 INFO : Inserting sp|Q8NFT8|DNER_HUMAN
15 Dec 2023 01:15:36,957 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:36,957 INFO : Inserting sp|Q8NFY4|SEM6D_HUMAN
15 Dec 2023 01:15:36,983 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:36,983 INFO : Inserting sp|Q8NFZ8|CADM4_HUMAN
15 Dec 2023 01:15:37,079 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:37,080 INFO : Inserting sp|Q8NG11|TSN14_HUMAN
15 Dec 2023 01:15:37,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,103 INFO : Inserting sp|Q8NHJ6|LIRB4_HUMAN
15 Dec 2023 01:15:37,137 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,137 INFO : Inserting sp|Q8NHP6|MSPD2_HUMAN
15 Dec 2023 01:15:37,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,156 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 01:15:37,211 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:37,211 INFO : Inserting sp|Q8TAQ2|SMRC2_HUMAN
15 Dec 2023 01:15:37,249 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,249 INFO : Inserting sp|Q8TBC4|UBA3_HUMAN
15 Dec 2023 01:15:37,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,274 INFO : Inserting sp|Q8TCT8|SPP2A_HUMAN
15 Dec 2023 01:15:37,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,292 INFO : Inserting sp|Q8TCU6|PREX1_HUMAN
15 Dec 2023 01:15:37,368 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:37,369 INFO : Inserting sp|Q8TD19|NEK9_HUMAN
15 Dec 2023 01:15:37,379 INFO : 84% Done
15 Dec 2023 01:15:37,410 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,410 INFO : Inserting sp|Q8TDP1|RNH2C_HUMAN
15 Dec 2023 01:15:37,437 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,437 INFO : Inserting sp|Q8TDQ0|HAVR2_HUMAN
15 Dec 2023 01:15:37,471 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,472 INFO : Inserting sp|Q8TDZ2|MICA1_HUMAN
15 Dec 2023 01:15:37,515 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,516 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 01:15:37,536 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:37,536 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 01:15:37,589 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:37,589 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 01:15:37,600 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,600 INFO : Inserting sp|Q8WTP8|AEN_HUMAN
15 Dec 2023 01:15:37,619 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,619 INFO : Inserting sp|Q8WU79|SMAP2_HUMAN
15 Dec 2023 01:15:37,639 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,639 INFO : Inserting sp|Q8WUJ3|CEMIP_HUMAN
15 Dec 2023 01:15:37,718 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:37,719 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 01:15:37,796 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:37,796 INFO : Inserting sp|Q8WUW1|BRK1_HUMAN
15 Dec 2023 01:15:37,812 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:37,812 INFO : Inserting sp|Q8WVN6|SCTM1_HUMAN
15 Dec 2023 01:15:37,917 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:37,917 INFO : Inserting sp|Q8WVQ1|CANT1_HUMAN
15 Dec 2023 01:15:38,038 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:38,039 INFO : Inserting sp|Q8WVY7|UBCP1_HUMAN
15 Dec 2023 01:15:38,061 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,062 INFO : Inserting sp|Q8WWI5|CTL1_HUMAN
15 Dec 2023 01:15:38,118 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,118 INFO : Inserting sp|Q8WWX9|SELM_HUMAN
15 Dec 2023 01:15:38,136 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,136 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 01:15:38,214 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,214 INFO : Inserting sp|Q8WXI8|CLC4D_HUMAN
15 Dec 2023 01:15:38,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,225 INFO : Inserting sp|Q8WXX5|DNJC9_HUMAN
15 Dec 2023 01:15:38,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,237 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 01:15:38,254 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,254 INFO : Inserting sp|Q8WZ75|ROBO4_HUMAN
15 Dec 2023 01:15:38,280 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:38,280 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 01:15:38,343 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:38,343 INFO : Inserting sp|Q92484|ASM3A_HUMAN
15 Dec 2023 01:15:38,395 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:38,396 INFO : Inserting sp|Q92485|ASM3B_HUMAN
15 Dec 2023 01:15:38,438 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:38,438 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:15:38,591 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:38,591 INFO : Inserting sp|Q92530|PSMF1_HUMAN
15 Dec 2023 01:15:38,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,608 INFO : Imported 1700 peptide groups.
15 Dec 2023 01:15:38,608 INFO : Inserting sp|Q92542|NICA_HUMAN
15 Dec 2023 01:15:38,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:38,628 INFO : Inserting sp|Q92556|ELMO1_HUMAN
15 Dec 2023 01:15:38,685 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,685 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 01:15:38,704 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:38,704 INFO : Inserting sp|Q92597|NDRG1_HUMAN
15 Dec 2023 01:15:38,750 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,750 INFO : Inserting sp|Q92598|HS105_HUMAN
15 Dec 2023 01:15:38,814 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,814 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 01:15:38,924 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:38,925 INFO : Inserting sp|Q92614|MY18A_HUMAN
15 Dec 2023 01:15:38,986 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:38,986 INFO : Inserting sp|Q92619|HMHA1_HUMAN
15 Dec 2023 01:15:39,005 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,005 INFO : Inserting sp|Q92626|PXDN_HUMAN
15 Dec 2023 01:15:39,027 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,027 INFO : Inserting sp|Q92637|FCGRB_HUMAN
15 Dec 2023 01:15:39,048 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,048 INFO : Inserting sp|Q92673|SORL_HUMAN
15 Dec 2023 01:15:39,219 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:39,219 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:15:39,358 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:39,358 INFO : Inserting sp|Q92692|NECT2_HUMAN
15 Dec 2023 01:15:39,395 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:39,395 INFO : Inserting sp|Q92734|TFG_HUMAN
15 Dec 2023 01:15:39,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,415 INFO : Inserting sp|Q92743|HTRA1_HUMAN
15 Dec 2023 01:15:39,509 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:39,509 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 01:15:39,623 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:39,624 INFO : Inserting sp|Q92769|HDAC2_HUMAN
15 Dec 2023 01:15:39,647 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,647 INFO : Inserting sp|Q92777|SYN2_HUMAN
15 Dec 2023 01:15:39,665 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:39,665 INFO : Inserting sp|Q92804|RBP56_HUMAN
15 Dec 2023 01:15:39,683 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:39,683 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:15:39,827 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:39,828 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:15:39,889 INFO : 85% Done
15 Dec 2023 01:15:40,292 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:15:40,292 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 01:15:40,390 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:40,391 INFO : Inserting sp|Q92841|DDX17_HUMAN
15 Dec 2023 01:15:40,478 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:40,478 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 01:15:40,510 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:40,511 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 01:15:40,714 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:40,714 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:15:40,854 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:40,854 INFO : Inserting sp|Q92882|OSTF1_HUMAN
15 Dec 2023 01:15:40,973 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:40,973 INFO : Inserting sp|Q92888|ARHG1_HUMAN
15 Dec 2023 01:15:41,010 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:41,010 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 01:15:41,094 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:41,094 INFO : Inserting sp|Q92904|DAZL_HUMAN
15 Dec 2023 01:15:41,110 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,110 INFO : Inserting sp|Q92905|CSN5_HUMAN
15 Dec 2023 01:15:41,159 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:41,159 INFO : Inserting sp|Q92911|SC5A5_HUMAN
15 Dec 2023 01:15:41,194 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:41,194 INFO : Inserting sp|Q92945|FUBP2_HUMAN
15 Dec 2023 01:15:41,212 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,212 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:15:41,286 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:41,286 INFO : Inserting sp|Q92973|TNPO1_HUMAN
15 Dec 2023 01:15:41,316 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:41,316 INFO : Inserting sp|Q93063|EXT2_HUMAN
15 Dec 2023 01:15:41,362 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:41,362 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:15:41,517 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:41,517 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:15:41,598 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:41,598 INFO : Inserting sp|Q969H8|MYDGF_HUMAN
15 Dec 2023 01:15:41,613 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,613 INFO : Inserting sp|Q969P0|IGSF8_HUMAN
15 Dec 2023 01:15:41,695 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:41,695 INFO : Inserting sp|Q969Q5|RAB24_HUMAN
15 Dec 2023 01:15:41,711 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,711 INFO : Inserting sp|Q96A08|H2B1A_HUMAN
15 Dec 2023 01:15:41,812 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:41,812 INFO : Inserting sp|Q96A72|MGN2_HUMAN
15 Dec 2023 01:15:41,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,830 INFO : Inserting sp|Q96AE4|FUBP1_HUMAN
15 Dec 2023 01:15:41,841 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,841 INFO : Inserting sp|Q96AG4|LRC59_HUMAN
15 Dec 2023 01:15:41,915 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:41,915 INFO : Inserting sp|Q96AP7|ESAM_HUMAN
15 Dec 2023 01:15:41,934 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,934 INFO : Inserting sp|Q96AT9|RPE_HUMAN
15 Dec 2023 01:15:41,957 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,957 INFO : Inserting sp|Q96B97|SH3K1_HUMAN
15 Dec 2023 01:15:41,968 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:41,968 INFO : Inserting sp|Q96BM9|ARL8A_HUMAN
15 Dec 2023 01:15:42,011 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:42,012 INFO : Inserting sp|Q96BZ4|PLD4_HUMAN
15 Dec 2023 01:15:42,185 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:42,185 INFO : Inserting sp|Q96C23|GALM_HUMAN
15 Dec 2023 01:15:42,208 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:42,208 INFO : Inserting sp|Q96C86|DCPS_HUMAN
15 Dec 2023 01:15:42,246 INFO : 86% Done
15 Dec 2023 01:15:42,293 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:42,293 INFO : Inserting sp|Q96CG8|CTHR1_HUMAN
15 Dec 2023 01:15:42,327 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:42,327 INFO : Inserting sp|Q96CW1|AP2M1_HUMAN
15 Dec 2023 01:15:42,515 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:42,515 INFO : Inserting sp|Q96D96|HVCN1_HUMAN
15 Dec 2023 01:15:42,525 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:42,525 INFO : Inserting sp|Q96DI7|SNR40_HUMAN
15 Dec 2023 01:15:42,535 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:42,535 INFO : Inserting sp|Q96E17|RAB3C_HUMAN
15 Dec 2023 01:15:42,559 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:42,560 INFO : Inserting sp|Q96EP5|DAZP1_HUMAN
15 Dec 2023 01:15:42,591 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:42,591 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 01:15:42,714 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:42,714 INFO : Inserting sp|Q96FJ2|DYL2_HUMAN
15 Dec 2023 01:15:42,738 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:42,738 INFO : Inserting sp|Q96FN4|CPNE2_HUMAN
15 Dec 2023 01:15:42,806 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:42,806 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 01:15:42,920 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:42,920 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 01:15:43,070 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:43,070 INFO : Inserting sp|Q96GG9|DCNL1_HUMAN
15 Dec 2023 01:15:43,110 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:43,110 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:15:43,225 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:43,226 INFO : Inserting sp|Q96GX9|MTNB_HUMAN
15 Dec 2023 01:15:43,244 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:43,244 INFO : Inserting sp|Q96HD1|CREL1_HUMAN
15 Dec 2023 01:15:43,288 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:43,288 INFO : Inserting sp|Q96HE7|ERO1A_HUMAN
15 Dec 2023 01:15:43,385 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:43,385 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 01:15:43,471 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:43,471 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 01:15:43,678 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:15:43,678 INFO : Inserting sp|Q96K76|UBP47_HUMAN
15 Dec 2023 01:15:43,693 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:43,693 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:15:44,233 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:15:44,233 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 01:15:44,392 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:44,392 INFO : Inserting sp|Q96L92|SNX27_HUMAN
15 Dec 2023 01:15:44,432 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:44,432 INFO : Inserting sp|Q96LB3|IFT74_HUMAN
15 Dec 2023 01:15:44,460 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:44,460 INFO : Inserting sp|Q96MU8|KREM1_HUMAN
15 Dec 2023 01:15:44,482 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:44,482 INFO : Inserting sp|Q96NY7|CLIC6_HUMAN
15 Dec 2023 01:15:44,535 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:44,535 INFO : Inserting sp|Q96NZ9|PRAP1_HUMAN
15 Dec 2023 01:15:44,573 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:44,573 INFO : Inserting sp|Q96P48|ARAP1_HUMAN
15 Dec 2023 01:15:44,620 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:44,620 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:15:44,798 INFO : 87% Done
15 Dec 2023 01:15:45,171 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:15:45,172 INFO : Inserting sp|Q96PP8|GBP5_HUMAN
15 Dec 2023 01:15:45,206 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:45,206 INFO : Inserting sp|Q96PX8|SLIK1_HUMAN
15 Dec 2023 01:15:45,314 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:45,315 INFO : Inserting sp|Q96Q15|SMG1_HUMAN
15 Dec 2023 01:15:45,369 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:45,369 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:15:45,608 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:45,608 INFO : Inserting sp|Q96QV6|H2A1A_HUMAN
15 Dec 2023 01:15:45,702 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:45,702 INFO : Inserting sp|Q96RW7|HMCN1_HUMAN
15 Dec 2023 01:15:45,732 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:45,732 INFO : Inserting sp|Q96S97|MYADM_HUMAN
15 Dec 2023 01:15:45,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:45,757 INFO : Inserting sp|Q96T51|RUFY1_HUMAN
15 Dec 2023 01:15:45,810 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:45,810 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:15:46,142 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:15:46,142 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 01:15:46,203 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:46,203 INFO : Inserting sp|Q99439|CNN2_HUMAN
15 Dec 2023 01:15:46,276 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:46,276 INFO : Inserting sp|Q99460|PSMD1_HUMAN
15 Dec 2023 01:15:46,310 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:46,310 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 01:15:46,371 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:46,371 INFO : Inserting sp|Q99519|NEUR1_HUMAN
15 Dec 2023 01:15:46,387 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:46,387 INFO : Inserting sp|Q99536|VAT1_HUMAN
15 Dec 2023 01:15:46,539 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:46,539 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 01:15:46,725 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:46,725 INFO : Inserting sp|Q99542|MMP19_HUMAN
15 Dec 2023 01:15:46,740 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:46,740 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:15:46,787 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:46,788 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 01:15:46,863 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:46,863 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 01:15:46,892 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:46,892 INFO : Imported 1800 peptide groups.
15 Dec 2023 01:15:46,893 INFO : Inserting sp|Q99653|CHP1_HUMAN
15 Dec 2023 01:15:46,902 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:46,902 INFO : Inserting sp|Q99715|COCA1_HUMAN
15 Dec 2023 01:15:46,969 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:46,969 INFO : Inserting sp|Q99719|SEPT5_HUMAN
15 Dec 2023 01:15:47,009 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:47,009 INFO : Inserting sp|Q99729|ROAA_HUMAN
15 Dec 2023 01:15:47,050 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:47,051 INFO : Inserting sp|Q99731|CCL19_HUMAN
15 Dec 2023 01:15:47,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:47,065 INFO : Inserting sp|Q99733|NP1L4_HUMAN
15 Dec 2023 01:15:47,082 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:47,082 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 01:15:47,101 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:47,101 INFO : Inserting sp|Q99798|ACON_HUMAN
15 Dec 2023 01:15:47,159 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:47,160 INFO : Inserting sp|Q99829|CPNE1_HUMAN
15 Dec 2023 01:15:47,213 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:47,213 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 01:15:47,306 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:47,306 INFO : Inserting sp|Q99873|ANM1_HUMAN
15 Dec 2023 01:15:47,341 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:47,341 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:15:47,389 INFO : 88% Done
15 Dec 2023 01:15:47,511 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:47,511 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:15:47,674 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:47,674 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 01:15:47,696 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:47,697 INFO : Inserting sp|Q99972|MYOC_HUMAN
15 Dec 2023 01:15:47,714 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:47,714 INFO : Inserting sp|Q99983|OMD_HUMAN
15 Dec 2023 01:15:47,811 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:47,811 INFO : Inserting sp|Q99986|VRK1_HUMAN
15 Dec 2023 01:15:47,836 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:47,836 INFO : Inserting sp|Q9BQS8|FYCO1_HUMAN
15 Dec 2023 01:15:47,855 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:47,855 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 01:15:47,886 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:47,887 INFO : Inserting sp|Q9BRA2|TXD17_HUMAN
15 Dec 2023 01:15:47,917 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:47,917 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:15:48,034 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:48,034 INFO : Inserting sp|Q9BRG1|VPS25_HUMAN
15 Dec 2023 01:15:48,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,056 INFO : Inserting sp|Q9BRR6|ADPGK_HUMAN
15 Dec 2023 01:15:48,105 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:48,105 INFO : Inserting sp|Q9BRR9|RHG09_HUMAN
15 Dec 2023 01:15:48,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,130 INFO : Inserting sp|Q9BS26|ERP44_HUMAN
15 Dec 2023 01:15:48,171 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:48,171 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 01:15:48,186 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,186 INFO : Inserting sp|Q9BSJ8|ESYT1_HUMAN
15 Dec 2023 01:15:48,221 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:48,221 INFO : Inserting sp|Q9BTT0|AN32E_HUMAN
15 Dec 2023 01:15:48,242 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,242 INFO : Inserting sp|Q9BTV5|FSD1_HUMAN
15 Dec 2023 01:15:48,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,259 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 01:15:48,334 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:48,334 INFO : Inserting sp|Q9BUD6|SPON2_HUMAN
15 Dec 2023 01:15:48,366 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:48,366 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:15:48,491 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:48,491 INFO : Inserting sp|Q9BUJ2|HNRL1_HUMAN
15 Dec 2023 01:15:48,531 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:48,531 INFO : Inserting sp|Q9BUL8|PDC10_HUMAN
15 Dec 2023 01:15:48,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,567 INFO : Inserting sp|Q9BVA1|TBB2B_HUMAN
15 Dec 2023 01:15:48,803 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:15:48,803 INFO : Inserting sp|Q9BVJ7|DUS23_HUMAN
15 Dec 2023 01:15:48,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,830 INFO : Inserting sp|Q9BVK6|TMED9_HUMAN
15 Dec 2023 01:15:48,849 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,849 INFO : Inserting sp|Q9BWD1|THIC_HUMAN
15 Dec 2023 01:15:48,921 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:48,921 INFO : Inserting sp|Q9BWJ5|SF3B5_HUMAN
15 Dec 2023 01:15:48,941 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,941 INFO : Inserting sp|Q9BWS9|CHID1_HUMAN
15 Dec 2023 01:15:48,972 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:48,972 INFO : Inserting sp|Q9BWV1|BOC_HUMAN
15 Dec 2023 01:15:48,989 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:48,989 INFO : Inserting sp|Q9BX67|JAM3_HUMAN
15 Dec 2023 01:15:49,007 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,007 INFO : Inserting sp|Q9BXJ4|C1QT3_HUMAN
15 Dec 2023 01:15:49,025 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,026 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 01:15:49,051 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:49,051 INFO : Inserting sp|Q9BXS5|AP1M1_HUMAN
15 Dec 2023 01:15:49,116 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:49,117 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:15:49,194 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:49,194 INFO : Inserting sp|Q9BY32|ITPA_HUMAN
15 Dec 2023 01:15:49,228 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:49,229 INFO : Inserting sp|Q9BY44|EIF2A_HUMAN
15 Dec 2023 01:15:49,247 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,248 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 01:15:49,262 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,262 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:15:49,362 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:49,362 INFO : Inserting sp|Q9BY79|MFRP_HUMAN
15 Dec 2023 01:15:49,454 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:49,454 INFO : Inserting sp|Q9BYH1|SE6L1_HUMAN
15 Dec 2023 01:15:49,531 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:49,531 INFO : Inserting sp|Q9BYT8|NEUL_HUMAN
15 Dec 2023 01:15:49,555 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,555 INFO : Inserting sp|Q9BYT9|ANO3_HUMAN
15 Dec 2023 01:15:49,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,566 INFO : Inserting sp|Q9BYV7|BCDO2_HUMAN
15 Dec 2023 01:15:49,576 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,576 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 01:15:49,653 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:49,653 INFO : Inserting sp|Q9BZR6|RTN4R_HUMAN
15 Dec 2023 01:15:49,681 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,681 INFO : Inserting sp|Q9C0A0|CNTP4_HUMAN
15 Dec 2023 01:15:49,728 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:49,728 INFO : Inserting sp|Q9GZQ8|MLP3B_HUMAN
15 Dec 2023 01:15:49,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,744 INFO : Inserting sp|Q9GZS3|SKI8_HUMAN
15 Dec 2023 01:15:49,764 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,764 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 01:15:49,844 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:49,844 INFO : Inserting sp|Q9H008|LHPP_HUMAN
15 Dec 2023 01:15:49,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,876 INFO : Inserting sp|Q9H0E2|TOLIP_HUMAN
15 Dec 2023 01:15:49,926 INFO : 89% Done
15 Dec 2023 01:15:49,939 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:49,939 INFO : Inserting sp|Q9H0N5|PHS2_HUMAN
15 Dec 2023 01:15:49,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,952 INFO : Inserting sp|Q9H0R8|GBRL1_HUMAN
15 Dec 2023 01:15:49,983 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:49,983 INFO : Inserting sp|Q9H0U4|RAB1B_HUMAN
15 Dec 2023 01:15:50,066 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:50,066 INFO : Inserting sp|Q9H0W9|CK054_HUMAN
15 Dec 2023 01:15:50,153 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:50,153 INFO : Inserting sp|Q9H173|SIL1_HUMAN
15 Dec 2023 01:15:50,220 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:50,220 INFO : Inserting sp|Q9H299|SH3L3_HUMAN
15 Dec 2023 01:15:50,279 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:50,279 INFO : Inserting sp|Q9H2A7|CXL16_HUMAN
15 Dec 2023 01:15:50,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,297 INFO : Inserting sp|Q9H2G2|SLK_HUMAN
15 Dec 2023 01:15:50,315 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,315 INFO : Inserting sp|Q9H2K8|TAOK3_HUMAN
15 Dec 2023 01:15:50,356 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:50,357 INFO : Inserting sp|Q9H2U2|IPYR2_HUMAN
15 Dec 2023 01:15:50,388 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:50,389 INFO : Inserting sp|Q9H2X0|CHRD_HUMAN
15 Dec 2023 01:15:50,490 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:50,490 INFO : Inserting sp|Q9H3N1|TMX1_HUMAN
15 Dec 2023 01:15:50,507 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,507 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:15:50,676 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:50,677 INFO : Inserting sp|Q9H3T3|SEM6B_HUMAN
15 Dec 2023 01:15:50,693 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,693 INFO : Inserting sp|Q9H4A9|DPEP2_HUMAN
15 Dec 2023 01:15:50,727 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:50,727 INFO : Inserting sp|Q9H4F8|SMOC1_HUMAN
15 Dec 2023 01:15:50,743 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,744 INFO : Inserting sp|Q9H4G4|GAPR1_HUMAN
15 Dec 2023 01:15:50,768 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:50,768 INFO : Inserting sp|Q9H4L7|SMRCD_HUMAN
15 Dec 2023 01:15:50,789 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:50,789 INFO : Inserting sp|Q9H4M9|EHD1_HUMAN
15 Dec 2023 01:15:50,939 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:50,939 INFO : Inserting sp|Q9H6B4|CLMP_HUMAN
15 Dec 2023 01:15:50,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,957 INFO : Inserting sp|Q9H6T0|ESRP2_HUMAN
15 Dec 2023 01:15:50,973 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,973 INFO : Inserting sp|Q9H6X2|ANTR1_HUMAN
15 Dec 2023 01:15:50,983 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,983 INFO : Inserting sp|Q9H7Z6|KAT8_HUMAN
15 Dec 2023 01:15:50,987 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:50,987 INFO : Inserting sp|Q9H892|TTC12_HUMAN
15 Dec 2023 01:15:51,005 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,005 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 01:15:51,051 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:51,051 INFO : Inserting sp|Q9H993|ARMT1_HUMAN
15 Dec 2023 01:15:51,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,071 INFO : Inserting sp|Q9HAB8|PPCS_HUMAN
15 Dec 2023 01:15:51,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,092 INFO : Inserting sp|Q9HAR2|AGRL3_HUMAN
15 Dec 2023 01:15:51,124 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,124 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:15:51,253 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:15:51,253 INFO : Inserting sp|Q9HAU0|PKHA5_HUMAN
15 Dec 2023 01:15:51,269 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,269 INFO : Inserting sp|Q9HAV0|GBB4_HUMAN
15 Dec 2023 01:15:51,349 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:51,349 INFO : Inserting sp|Q9HB07|MYG1_HUMAN
15 Dec 2023 01:15:51,384 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,384 INFO : Inserting sp|Q9HB71|CYBP_HUMAN
15 Dec 2023 01:15:51,414 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,414 INFO : Inserting sp|Q9HB90|RRAGC_HUMAN
15 Dec 2023 01:15:51,437 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,437 INFO : Inserting sp|Q9HBI0|PARVG_HUMAN
15 Dec 2023 01:15:51,487 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,488 INFO : Inserting sp|Q9HBW1|LRRC4_HUMAN
15 Dec 2023 01:15:51,508 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,508 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 01:15:51,614 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:51,614 INFO : Imported 1900 peptide groups.
15 Dec 2023 01:15:51,614 INFO : Inserting sp|Q9HCU0|CD248_HUMAN
15 Dec 2023 01:15:51,647 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,647 INFO : Inserting sp|Q9HCU4|CELR2_HUMAN
15 Dec 2023 01:15:51,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,668 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 01:15:51,723 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:51,723 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 01:15:51,810 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:51,810 INFO : Inserting sp|Q9NNX6|CD209_HUMAN
15 Dec 2023 01:15:51,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,831 INFO : Inserting sp|Q9NP84|TNR12_HUMAN
15 Dec 2023 01:15:51,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:51,857 INFO : Inserting sp|Q9NPA0|EMC7_HUMAN
15 Dec 2023 01:15:51,894 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,894 INFO : Inserting sp|Q9NPA2|MMP25_HUMAN
15 Dec 2023 01:15:51,932 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,932 INFO : Inserting sp|Q9NPP4|NLRC4_HUMAN
15 Dec 2023 01:15:51,965 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:51,965 INFO : Inserting sp|Q9NPR2|SEM4B_HUMAN
15 Dec 2023 01:15:52,101 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:52,102 INFO : Inserting sp|Q9NPY3|C1QR1_HUMAN
15 Dec 2023 01:15:52,169 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:52,169 INFO : Inserting sp|Q9NQ30|ESM1_HUMAN
15 Dec 2023 01:15:52,184 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,185 INFO : Inserting sp|Q9NQ66|PLCB1_HUMAN
15 Dec 2023 01:15:52,200 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,200 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 01:15:52,381 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:52,382 INFO : Inserting sp|Q9NQG5|RPR1B_HUMAN
15 Dec 2023 01:15:52,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:52,433 INFO : Inserting sp|Q9NQR4|NIT2_HUMAN
15 Dec 2023 01:15:52,554 INFO : 90% Done
15 Dec 2023 01:15:52,566 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:52,566 INFO : Inserting sp|Q9NQW7|XPP1_HUMAN
15 Dec 2023 01:15:52,602 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:52,602 INFO : Inserting sp|Q9NQW8|CNGB3_HUMAN
15 Dec 2023 01:15:52,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,628 INFO : Inserting sp|Q9NQX7|ITM2C_HUMAN
15 Dec 2023 01:15:52,648 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,648 INFO : Inserting sp|Q9NR34|MA1C1_HUMAN
15 Dec 2023 01:15:52,716 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:52,716 INFO : Inserting sp|Q9NR45|SIAS_HUMAN
15 Dec 2023 01:15:52,754 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:52,754 INFO : Inserting sp|Q9NR46|SHLB2_HUMAN
15 Dec 2023 01:15:52,781 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,781 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 01:15:52,827 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:52,827 INFO : Inserting sp|Q9NRF8|PYRG2_HUMAN
15 Dec 2023 01:15:52,844 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,844 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 01:15:52,871 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:52,871 INFO : Inserting sp|Q9NS15|LTBP3_HUMAN
15 Dec 2023 01:15:52,889 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:52,889 INFO : Inserting sp|Q9NSC7|SIA7A_HUMAN
15 Dec 2023 01:15:52,912 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:52,912 INFO : Inserting sp|Q9NSD9|SYFB_HUMAN
15 Dec 2023 01:15:52,983 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:52,983 INFO : Inserting sp|Q9NSE4|SYIM_HUMAN
15 Dec 2023 01:15:53,000 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,001 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 01:15:53,026 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:53,026 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 01:15:53,178 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:53,178 INFO : Inserting sp|Q9NTI5|PDS5B_HUMAN
15 Dec 2023 01:15:53,193 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,193 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 01:15:53,264 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:53,264 INFO : Inserting sp|Q9NTM9|CUTC_HUMAN
15 Dec 2023 01:15:53,286 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,286 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:15:53,488 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:53,488 INFO : Inserting sp|Q9NVD3|SETD4_HUMAN
15 Dec 2023 01:15:53,510 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,510 INFO : Inserting sp|Q9NVJ2|ARL8B_HUMAN
15 Dec 2023 01:15:53,550 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:53,550 INFO : Inserting sp|Q9NX46|ADPRS_HUMAN
15 Dec 2023 01:15:53,588 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:53,588 INFO : Inserting sp|Q9NX62|IMPA3_HUMAN
15 Dec 2023 01:15:53,649 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:53,649 INFO : Inserting sp|Q9NY12|GAR1_HUMAN
15 Dec 2023 01:15:53,670 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,670 INFO : Inserting sp|Q9NY15|STAB1_HUMAN
15 Dec 2023 01:15:53,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,689 INFO : Inserting sp|Q9NY25|CLC5A_HUMAN
15 Dec 2023 01:15:53,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:53,704 INFO : Inserting sp|Q9NY33|DPP3_HUMAN
15 Dec 2023 01:15:53,855 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:53,855 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 01:15:53,962 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:53,962 INFO : Inserting sp|Q9NYU2|UGGG1_HUMAN
15 Dec 2023 01:15:54,001 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:54,001 INFO : Inserting sp|Q9NYX4|CALY_HUMAN
15 Dec 2023 01:15:54,018 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,018 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 01:15:54,194 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:15:54,194 INFO : Inserting sp|Q9NZ53|PDXL2_HUMAN
15 Dec 2023 01:15:54,215 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,215 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 01:15:54,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,236 INFO : Inserting sp|Q9NZJ7|MTCH1_HUMAN
15 Dec 2023 01:15:54,252 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,252 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:15:54,654 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:15:54,655 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 01:15:54,683 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:54,683 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:15:54,800 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:54,800 INFO : Inserting sp|Q9P035|HACD3_HUMAN
15 Dec 2023 01:15:54,817 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,817 INFO : Inserting sp|Q9P0K9|FRS1L_HUMAN
15 Dec 2023 01:15:54,840 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:54,840 INFO : Inserting sp|Q9P0L0|VAPA_HUMAN
15 Dec 2023 01:15:54,854 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:54,854 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 01:15:54,890 INFO : 91% Done
15 Dec 2023 01:15:54,953 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:54,953 INFO : Inserting sp|Q9P258|RCC2_HUMAN
15 Dec 2023 01:15:55,101 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:55,101 INFO : Inserting sp|Q9P289|STK26_HUMAN
15 Dec 2023 01:15:55,118 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:55,119 INFO : Inserting sp|Q9P2E8|MARH4_HUMAN
15 Dec 2023 01:15:55,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:55,125 INFO : Inserting sp|Q9P2J5|SYLC_HUMAN
15 Dec 2023 01:15:55,143 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:55,144 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 01:15:55,261 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:55,261 INFO : Inserting sp|Q9P2T1|GMPR2_HUMAN
15 Dec 2023 01:15:55,288 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:55,288 INFO : Inserting sp|Q9UBE0|SAE1_HUMAN
15 Dec 2023 01:15:55,314 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:55,314 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 01:15:55,455 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:55,455 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:15:55,645 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:15:55,645 INFO : Inserting sp|Q9UBQ0|VPS29_HUMAN
15 Dec 2023 01:15:55,786 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:55,786 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 01:15:55,923 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:15:55,923 INFO : Inserting sp|Q9UBQ7|GRHPR_HUMAN
15 Dec 2023 01:15:55,993 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:55,994 INFO : Inserting sp|Q9UBR2|CATZ_HUMAN
15 Dec 2023 01:15:56,021 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,022 INFO : Inserting sp|Q9UBT2|SAE2_HUMAN
15 Dec 2023 01:15:56,080 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,080 INFO : Inserting sp|Q9UBV8|PEF1_HUMAN
15 Dec 2023 01:15:56,139 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:56,139 INFO : Inserting sp|Q9UBW5|BIN2_HUMAN
15 Dec 2023 01:15:56,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,167 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 01:15:56,287 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:56,287 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 01:15:56,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,313 INFO : Inserting sp|Q9UBX7|KLK11_HUMAN
15 Dec 2023 01:15:56,531 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:56,531 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 01:15:56,561 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,561 INFO : Inserting sp|Q9UFH2|DYH17_HUMAN
15 Dec 2023 01:15:56,612 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,612 INFO : Inserting sp|Q9UFP1|GAK1A_HUMAN
15 Dec 2023 01:15:56,651 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,652 INFO : Inserting sp|Q9UGJ0|AAKG2_HUMAN
15 Dec 2023 01:15:56,690 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,691 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 01:15:56,803 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:56,804 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 01:15:56,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,826 INFO : Inserting sp|Q9UH03|SEPT3_HUMAN
15 Dec 2023 01:15:56,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,851 INFO : Inserting sp|Q9UH65|SWP70_HUMAN
15 Dec 2023 01:15:56,898 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,898 INFO : Inserting sp|Q9UHA4|LTOR3_HUMAN
15 Dec 2023 01:15:56,948 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:56,948 INFO : Inserting sp|Q9UHC6|CNTP2_HUMAN
15 Dec 2023 01:15:56,970 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:56,970 INFO : Inserting sp|Q9UHD8|SEPT9_HUMAN
15 Dec 2023 01:15:57,061 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:57,061 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 01:15:57,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:57,132 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 01:15:57,173 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:57,173 INFO : Inserting sp|Q9UHI8|ATS1_HUMAN
15 Dec 2023 01:15:57,223 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:57,223 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 01:15:57,353 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:57,353 INFO : Inserting sp|Q9UHV9|PFD2_HUMAN
15 Dec 2023 01:15:57,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:57,373 INFO : Inserting sp|Q9UHY1|NRBP_HUMAN
15 Dec 2023 01:15:57,413 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:57,413 INFO : Inserting sp|Q9UHY7|ENOPH_HUMAN
15 Dec 2023 01:15:57,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:57,468 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 01:15:57,572 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:15:57,572 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 01:15:57,617 INFO : 92% Done
15 Dec 2023 01:15:57,624 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:57,624 INFO : Inserting sp|Q9UIK4|DAPK2_HUMAN
15 Dec 2023 01:15:57,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:57,647 INFO : Inserting sp|Q9UJ68|MSRA_HUMAN
15 Dec 2023 01:15:57,686 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:57,686 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 01:15:57,837 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:15:57,837 INFO : Inserting sp|Q9UJA9|ENPP5_HUMAN
15 Dec 2023 01:15:57,856 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:57,856 INFO : Imported 2000 peptide groups.
15 Dec 2023 01:15:57,856 INFO : Inserting sp|Q9UJJ9|GNPTG_HUMAN
15 Dec 2023 01:15:57,922 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:57,922 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 01:15:57,997 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:57,997 INFO : Inserting sp|Q9UJW0|DCTN4_HUMAN
15 Dec 2023 01:15:58,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,017 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:15:58,242 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:15:58,242 INFO : Inserting sp|Q9UKG1|DP13A_HUMAN
15 Dec 2023 01:15:58,295 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:58,295 INFO : Inserting sp|Q9UKK3|PARP4_HUMAN
15 Dec 2023 01:15:58,321 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:58,321 INFO : Inserting sp|Q9UKK9|NUDT5_HUMAN
15 Dec 2023 01:15:58,356 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:58,357 INFO : Inserting sp|Q9UKM9|RALY_HUMAN
15 Dec 2023 01:15:58,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,376 INFO : Inserting sp|Q9UKX2|MYH2_HUMAN
15 Dec 2023 01:15:58,391 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,391 INFO : Inserting sp|Q9UKX3|MYH13_HUMAN
15 Dec 2023 01:15:58,405 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,405 INFO : Inserting sp|Q9UL18|AGO1_HUMAN
15 Dec 2023 01:15:58,460 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:58,460 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 01:15:58,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:58,499 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 01:15:58,542 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:58,542 INFO : Inserting sp|Q9ULB1|NRX1A_HUMAN
15 Dec 2023 01:15:58,627 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:58,627 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 01:15:58,710 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:15:58,710 INFO : Inserting sp|Q9ULI3|HEG1_HUMAN
15 Dec 2023 01:15:58,756 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:58,756 INFO : Inserting sp|Q9ULM3|YETS2_HUMAN
15 Dec 2023 01:15:58,774 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,774 INFO : Inserting sp|Q9ULR3|PPM1H_HUMAN
15 Dec 2023 01:15:58,792 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,792 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:15:58,867 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:15:58,868 INFO : Inserting sp|Q9ULX7|CAH14_HUMAN
15 Dec 2023 01:15:58,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:58,901 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:15:59,011 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:59,011 INFO : Inserting sp|Q9UM00|TMCO1_HUMAN
15 Dec 2023 01:15:59,034 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:59,034 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:15:59,518 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:15:59,518 INFO : Inserting sp|Q9UM22|EPDR1_HUMAN
15 Dec 2023 01:15:59,555 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:59,555 INFO : Inserting sp|Q9UM47|NOTC3_HUMAN
15 Dec 2023 01:15:59,573 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:59,574 INFO : Inserting sp|Q9UMF0|ICAM5_HUMAN
15 Dec 2023 01:15:59,616 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:59,616 INFO : Inserting sp|Q9UMS4|PRP19_HUMAN
15 Dec 2023 01:15:59,679 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:15:59,679 INFO : Inserting sp|Q9UMX0|UBQL1_HUMAN
15 Dec 2023 01:15:59,724 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:59,724 INFO : Inserting sp|Q9UN36|NDRG2_HUMAN
15 Dec 2023 01:15:59,776 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:15:59,777 INFO : Inserting sp|Q9UN37|VPS4A_HUMAN
15 Dec 2023 01:15:59,804 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:15:59,804 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 01:15:59,923 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:15:59,924 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 01:16:00,021 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:00,021 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:16:00,141 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:00,141 INFO : Inserting sp|Q9UQM7|KCC2A_HUMAN
15 Dec 2023 01:16:00,195 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:00,195 INFO : Inserting sp|Q9Y219|JAG2_HUMAN
15 Dec 2023 01:16:00,210 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:00,210 INFO : Inserting sp|Q9Y224|RTRAF_HUMAN
15 Dec 2023 01:16:00,247 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:00,247 INFO : Inserting sp|Q9Y237|PIN4_HUMAN
15 Dec 2023 01:16:00,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:00,257 INFO : Inserting sp|Q9Y240|CLC11_HUMAN
15 Dec 2023 01:16:00,292 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:00,292 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 01:16:00,339 INFO : 93% Done
15 Dec 2023 01:16:00,357 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:00,357 INFO : Inserting sp|Q9Y265|RUVB1_HUMAN
15 Dec 2023 01:16:00,402 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:00,402 INFO : Inserting sp|Q9Y266|NUDC_HUMAN
15 Dec 2023 01:16:00,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:00,424 INFO : Inserting sp|Q9Y275|TN13B_HUMAN
15 Dec 2023 01:16:00,445 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:00,445 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 01:16:00,484 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:00,484 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:16:00,621 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:16:00,621 INFO : Inserting sp|Q9Y287|ITM2B_HUMAN
15 Dec 2023 01:16:00,674 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:00,674 INFO : Inserting sp|Q9Y2E5|MA2B2_HUMAN
15 Dec 2023 01:16:00,704 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:00,704 INFO : Inserting sp|Q9Y2G1|MYRF_HUMAN
15 Dec 2023 01:16:00,719 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:00,719 INFO : Inserting sp|Q9Y2I2|NTNG1_HUMAN
15 Dec 2023 01:16:00,753 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:00,753 INFO : Inserting sp|Q9Y2J8|PADI2_HUMAN
15 Dec 2023 01:16:00,864 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:16:00,864 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 01:16:00,971 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:00,971 INFO : Inserting sp|Q9Y2T3|GUAD_HUMAN
15 Dec 2023 01:16:01,029 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:01,029 INFO : Inserting sp|Q9Y2V0|CDIN1_HUMAN
15 Dec 2023 01:16:01,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,039 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 01:16:01,070 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,070 INFO : Inserting sp|Q9Y2X8|UB2D4_HUMAN
15 Dec 2023 01:16:01,089 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,089 INFO : Inserting sp|Q9Y315|DEOC_HUMAN
15 Dec 2023 01:16:01,143 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:01,143 INFO : Inserting sp|Q9Y316|MEMO1_HUMAN
15 Dec 2023 01:16:01,199 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:01,199 INFO : Inserting sp|Q9Y333|LSM2_HUMAN
15 Dec 2023 01:16:01,218 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,218 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 01:16:01,337 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:16:01,337 INFO : Inserting sp|Q9Y3B3|TMED7_HUMAN
15 Dec 2023 01:16:01,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,347 INFO : Inserting sp|Q9Y3C8|UFC1_HUMAN
15 Dec 2023 01:16:01,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,375 INFO : Inserting sp|Q9Y3F4|STRAP_HUMAN
15 Dec 2023 01:16:01,403 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:01,403 INFO : Inserting sp|Q9Y3I0|RTCB_HUMAN
15 Dec 2023 01:16:01,419 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,419 INFO : Inserting sp|Q9Y3L3|3BP1_HUMAN
15 Dec 2023 01:16:01,437 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:01,437 INFO : Inserting sp|Q9Y3Z3|SAMH1_HUMAN
15 Dec 2023 01:16:01,499 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:01,499 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:16:02,021 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:16:02,021 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 01:16:02,189 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:16:02,192 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 01:16:02,286 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:02,286 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 01:16:02,421 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:16:02,421 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 01:16:02,454 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:02,454 INFO : Inserting sp|Q9Y4W6|AFG32_HUMAN
15 Dec 2023 01:16:02,469 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,469 INFO : Inserting sp|Q9Y547|IFT25_HUMAN
15 Dec 2023 01:16:02,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:02,500 INFO : Inserting sp|Q9Y5K8|VATD_HUMAN
15 Dec 2023 01:16:02,546 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:02,547 INFO : Inserting sp|Q9Y5L0|TNPO3_HUMAN
15 Dec 2023 01:16:02,579 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:02,579 INFO : Inserting sp|Q9Y5P4|CERT_HUMAN
15 Dec 2023 01:16:02,589 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,590 INFO : Inserting sp|Q9Y5P6|GMPPB_HUMAN
15 Dec 2023 01:16:02,606 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,607 INFO : Inserting sp|Q9Y5S8|NOX1_HUMAN
15 Dec 2023 01:16:02,634 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:02,634 INFO : Inserting sp|Q9Y5S9|RBM8A_HUMAN
15 Dec 2023 01:16:02,662 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,662 INFO : Inserting sp|Q9Y5W8|SNX13_HUMAN
15 Dec 2023 01:16:02,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,679 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:16:02,723 INFO : 94% Done
15 Dec 2023 01:16:02,799 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:02,799 INFO : Inserting sp|Q9Y5Z4|HEBP2_HUMAN
15 Dec 2023 01:16:02,845 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:02,845 INFO : Inserting sp|Q9Y617|SERC_HUMAN
15 Dec 2023 01:16:02,929 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:02,930 INFO : Inserting sp|Q9Y623|MYH4_HUMAN
15 Dec 2023 01:16:02,945 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,945 INFO : Inserting sp|Q9Y644|RFNG_HUMAN
15 Dec 2023 01:16:02,971 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:02,971 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 01:16:03,099 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:16:03,099 INFO : Inserting sp|Q9Y678|COPG1_HUMAN
15 Dec 2023 01:16:03,212 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:03,212 INFO : Inserting sp|Q9Y6E0|STK24_HUMAN
15 Dec 2023 01:16:03,232 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:03,232 INFO : Inserting sp|Q9Y6K9|NEMO_HUMAN
15 Dec 2023 01:16:03,255 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:03,255 INFO : Inserting sp|Q9Y6N5|SQOR_HUMAN
15 Dec 2023 01:16:03,310 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:03,311 INFO : Inserting sp|Q9Y6N6|LAMC3_HUMAN
15 Dec 2023 01:16:03,334 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:03,335 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 01:16:03,345 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:03,345 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:16:04,258 DEBUG: Inserted 50 peptides
15 Dec 2023 01:16:05,078 INFO : 95% Done
15 Dec 2023 01:16:05,275 DEBUG: Inserted 100 peptides
15 Dec 2023 01:16:05,562 DEBUG: Total peptides inserted: 115
15 Dec 2023 01:16:05,562 INFO : Inserting sp|Q9Y6X5|ENPP4_HUMAN
15 Dec 2023 01:16:05,592 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:05,592 INFO : Inserting sp|Q9Y6Y9|LY96_HUMAN
15 Dec 2023 01:16:05,626 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:05,626 INFO : Inserting sp|A0A075B6Q5|HV364_HUMAN
15 Dec 2023 01:16:05,670 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:05,671 INFO : Inserting sp|A0A075B6R2|HV404_HUMAN
15 Dec 2023 01:16:05,687 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:05,687 INFO : Inserting sp|A0A087WSY4|HV432_HUMAN
15 Dec 2023 01:16:05,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:05,704 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 01:16:05,752 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:05,752 INFO : Inserting sp|A0A0B4J1V1|HV321_HUMAN
15 Dec 2023 01:16:05,830 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:05,830 INFO : Inserting sp|A0A0B4J1V2|HV226_HUMAN
15 Dec 2023 01:16:05,871 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:05,871 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 01:16:05,941 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:05,941 INFO : Imported 2100 peptide groups.
15 Dec 2023 01:16:05,941 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 01:16:06,005 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:06,005 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 01:16:06,049 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:06,049 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 01:16:06,059 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,059 INFO : Inserting sp|A0A0C4DH29|HV103_HUMAN
15 Dec 2023 01:16:06,068 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,068 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 01:16:06,085 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,085 INFO : Inserting sp|A0A0C4DH32|HV320_HUMAN
15 Dec 2023 01:16:06,139 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:06,139 INFO : Inserting sp|A0A0C4DH33|HV124_HUMAN
15 Dec 2023 01:16:06,157 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,157 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 01:16:06,200 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:06,200 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 01:16:06,231 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,231 INFO : Inserting sp|A0A0C4DH41|HV461_HUMAN
15 Dec 2023 01:16:06,246 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,246 INFO : Inserting sp|A0A0C4DH42|HV366_HUMAN
15 Dec 2023 01:16:06,309 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:06,309 INFO : Inserting sp|A0A0J9YX35|HV64D_HUMAN
15 Dec 2023 01:16:06,335 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,335 INFO : Inserting sp|A5D6W6|FITM1_HUMAN
15 Dec 2023 01:16:06,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,356 INFO : Inserting sp|A6NCE7|MP3B2_HUMAN
15 Dec 2023 01:16:06,373 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,373 INFO : Inserting sp|A6QL63|ABTB3_HUMAN
15 Dec 2023 01:16:06,393 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,393 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:16:06,541 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:16:06,541 INFO : Inserting sp|E9PAV3|NACAM_HUMAN
15 Dec 2023 01:16:06,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,568 INFO : Inserting sp|O14602|IF1AY_HUMAN
15 Dec 2023 01:16:06,585 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,585 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 01:16:06,630 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:06,630 INFO : Inserting sp|O60245|PCDH7_HUMAN
15 Dec 2023 01:16:06,649 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,649 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 01:16:06,696 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,696 INFO : Inserting sp|O75711|SCRG1_HUMAN
15 Dec 2023 01:16:06,734 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:06,734 INFO : Inserting sp|O75964|ATP5L_HUMAN
15 Dec 2023 01:16:06,771 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:06,771 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:16:06,795 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,795 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:16:06,904 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:06,904 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 01:16:06,921 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,921 INFO : Inserting sp|P01601|KVD16_HUMAN
15 Dec 2023 01:16:06,938 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,938 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 01:16:06,953 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:06,953 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 01:16:06,984 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:06,984 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 01:16:07,015 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:07,015 INFO : Inserting sp|P01714|LV319_HUMAN
15 Dec 2023 01:16:07,045 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:07,045 INFO : Inserting sp|P01718|LV327_HUMAN
15 Dec 2023 01:16:07,060 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,060 INFO : Inserting sp|P04430|KV116_HUMAN
15 Dec 2023 01:16:07,077 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,077 INFO : Inserting sp|P04432|KVD39_HUMAN
15 Dec 2023 01:16:07,137 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:07,137 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 01:16:07,181 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:07,181 INFO : Inserting sp|P06310|KV230_HUMAN
15 Dec 2023 01:16:07,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,196 INFO : Inserting sp|P07311|ACYP1_HUMAN
15 Dec 2023 01:16:07,219 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:07,219 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:16:07,483 INFO : 96% Done
15 Dec 2023 01:16:07,522 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:16:07,522 INFO : Inserting sp|P0DP01|HV108_HUMAN
15 Dec 2023 01:16:07,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,532 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 01:16:07,610 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:07,610 INFO : Inserting sp|P0DP04|HV43D_HUMAN
15 Dec 2023 01:16:07,666 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:07,666 INFO : Inserting sp|P0DP06|HVD34_HUMAN
15 Dec 2023 01:16:07,682 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,682 INFO : Inserting sp|P0DP07|HV431_HUMAN
15 Dec 2023 01:16:07,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,698 INFO : Inserting sp|P0DP08|HVD82_HUMAN
15 Dec 2023 01:16:07,714 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,714 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 01:16:07,770 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:07,770 INFO : Inserting sp|P56385|ATP5I_HUMAN
15 Dec 2023 01:16:07,788 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:07,788 INFO : Inserting sp|P60983|GMFB_HUMAN
15 Dec 2023 01:16:07,836 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:07,836 INFO : Inserting sp|P80748|LV321_HUMAN
15 Dec 2023 01:16:07,865 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:07,865 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 01:16:07,985 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:16:07,985 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 01:16:08,084 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:08,085 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 01:16:08,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,103 INFO : Inserting sp|Q14C87|T132D_HUMAN
15 Dec 2023 01:16:08,132 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,132 INFO : Inserting sp|Q15404|RSU1_HUMAN
15 Dec 2023 01:16:08,201 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:08,201 INFO : Inserting sp|Q2TAC6|KIF19_HUMAN
15 Dec 2023 01:16:08,218 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,218 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 01:16:08,288 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:08,288 INFO : Inserting sp|Q2VIR3|IF2GL_HUMAN
15 Dec 2023 01:16:08,321 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:08,321 INFO : Inserting sp|Q53RD9|FBLN7_HUMAN
15 Dec 2023 01:16:08,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,341 INFO : Inserting sp|Q562R1|ACTBL_HUMAN
15 Dec 2023 01:16:08,494 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:16:08,494 INFO : Inserting sp|Q58FF8|H90B2_HUMAN
15 Dec 2023 01:16:08,564 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:08,564 INFO : Inserting sp|Q5JSL3|DOC11_HUMAN
15 Dec 2023 01:16:08,598 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:08,598 INFO : Inserting sp|Q5T013|HYI_HUMAN
15 Dec 2023 01:16:08,610 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,611 INFO : Inserting sp|Q5TBC7|B2L15_HUMAN
15 Dec 2023 01:16:08,625 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:08,625 INFO : Inserting sp|Q5TEC6|H37_HUMAN
15 Dec 2023 01:16:08,766 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:16:08,766 INFO : Inserting sp|Q5VTE0|EF1A3_HUMAN
15 Dec 2023 01:16:08,951 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:16:08,951 INFO : Inserting sp|Q5VU97|CAHD1_HUMAN
15 Dec 2023 01:16:08,968 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:08,968 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 01:16:09,013 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:09,013 INFO : Inserting sp|Q66LE6|2ABD_HUMAN
15 Dec 2023 01:16:09,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,029 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 01:16:09,151 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:09,151 INFO : Inserting sp|Q6MZW2|FSTL4_HUMAN
15 Dec 2023 01:16:09,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,167 INFO : Inserting sp|Q6PI73|LIRA6_HUMAN
15 Dec 2023 01:16:09,219 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:09,219 INFO : Inserting sp|Q6S8J3|POTEE_HUMAN
15 Dec 2023 01:16:09,366 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:16:09,366 INFO : Inserting sp|Q6UWD8|CP054_HUMAN
15 Dec 2023 01:16:09,381 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,381 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:16:09,464 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:09,464 INFO : Inserting sp|Q6ZMR3|LDH6A_HUMAN
15 Dec 2023 01:16:09,505 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:09,505 INFO : Inserting sp|Q86UW8|HPLN4_HUMAN
15 Dec 2023 01:16:09,527 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,528 INFO : Inserting sp|Q86X76|NIT1_HUMAN
15 Dec 2023 01:16:09,563 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:09,563 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 01:16:09,667 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:09,668 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 01:16:09,742 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:09,742 INFO : Inserting sp|Q8NBX0|SCPDL_HUMAN
15 Dec 2023 01:16:09,870 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:09,870 INFO : Inserting sp|Q8NHP1|ARK74_HUMAN
15 Dec 2023 01:16:09,903 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,903 INFO : Inserting sp|Q8NI29|FBX27_HUMAN
15 Dec 2023 01:16:09,916 INFO : 97% Done
15 Dec 2023 01:16:09,941 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:09,941 INFO : Inserting sp|Q92747|ARC1A_HUMAN
15 Dec 2023 01:16:10,012 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:10,012 INFO : Inserting sp|Q92928|RAB1C_HUMAN
15 Dec 2023 01:16:10,098 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:10,098 INFO : Inserting sp|Q96A23|CPNE4_HUMAN
15 Dec 2023 01:16:10,144 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:10,144 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 01:16:10,257 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:10,257 INFO : Inserting sp|Q96CX2|KCD12_HUMAN
15 Dec 2023 01:16:10,346 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:10,346 INFO : Inserting sp|Q96M27|PRRC1_HUMAN
15 Dec 2023 01:16:10,382 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:10,383 INFO : Inserting sp|Q96S96|PEBP4_HUMAN
15 Dec 2023 01:16:10,537 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:16:10,537 INFO : Inserting sp|Q96SE7|ZN347_HUMAN
15 Dec 2023 01:16:10,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:10,551 INFO : Inserting sp|Q96SM3|CPXM1_HUMAN
15 Dec 2023 01:16:10,579 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:10,579 INFO : Inserting sp|Q9BPX5|ARP5L_HUMAN
15 Dec 2023 01:16:10,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:10,601 INFO : Inserting sp|Q9BT23|LIMD2_HUMAN
15 Dec 2023 01:16:10,623 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:10,623 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 01:16:10,677 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:10,677 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:16:10,922 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:16:10,922 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:16:11,116 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:16:11,116 INFO : Inserting sp|Q9HBR0|S38AA_HUMAN
15 Dec 2023 01:16:11,142 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,142 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 01:16:11,267 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:11,267 INFO : Inserting sp|Q9HC56|PCDH9_HUMAN
15 Dec 2023 01:16:11,298 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:11,299 INFO : Inserting sp|Q9NPH6|OBP2B_HUMAN
15 Dec 2023 01:16:11,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,322 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 01:16:11,394 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:11,394 INFO : Imported 2200 peptide groups.
15 Dec 2023 01:16:11,394 INFO : Inserting sp|Q9NRR1|CYTL1_HUMAN
15 Dec 2023 01:16:11,439 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,439 INFO : Inserting sp|Q9NRY5|F1142_HUMAN
15 Dec 2023 01:16:11,485 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,485 INFO : Inserting sp|Q9NS98|SEM3G_HUMAN
15 Dec 2023 01:16:11,559 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,559 INFO : Inserting sp|Q9NYL9|TMOD3_HUMAN
15 Dec 2023 01:16:11,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,593 INFO : Inserting sp|Q9NZT2|OGFR_HUMAN
15 Dec 2023 01:16:11,642 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,642 INFO : Inserting sp|Q9P206|K1522_HUMAN
15 Dec 2023 01:16:11,669 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,669 INFO : Inserting sp|Q9UKU9|ANGL2_HUMAN
15 Dec 2023 01:16:11,710 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,711 INFO : Inserting sp|Q9Y5G0|PCDGH_HUMAN
15 Dec 2023 01:16:11,765 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,765 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 01:16:11,787 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,787 INFO : Inserting sp|A0A075B6K4|LV310_HUMAN
15 Dec 2023 01:16:11,814 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,814 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 01:16:11,880 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:11,880 INFO : Inserting sp|A0A075B6N3|TVBX1_HUMAN
15 Dec 2023 01:16:11,911 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,911 INFO : Inserting sp|A0A075B6P5|KV228_HUMAN
15 Dec 2023 01:16:11,939 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,939 INFO : Inserting sp|A0A075B6S2|KVD29_HUMAN
15 Dec 2023 01:16:11,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:11,962 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:16:12,011 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,011 INFO : Inserting sp|A0A075B6S6|KVD30_HUMAN
15 Dec 2023 01:16:12,035 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,035 INFO : Inserting sp|A0A087WSY6|KVD15_HUMAN
15 Dec 2023 01:16:12,077 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,078 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 01:16:12,099 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,099 INFO : Inserting sp|A0A0A0MRZ7|KVD26_HUMAN
15 Dec 2023 01:16:12,121 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,121 INFO : Inserting sp|A0A0B4J1U3|LV136_HUMAN
15 Dec 2023 01:16:12,152 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,152 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 01:16:12,194 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,194 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 01:16:12,230 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,230 INFO : Inserting sp|A0A0C4DH69|KV109_HUMAN
15 Dec 2023 01:16:12,268 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,268 INFO : Inserting sp|A0A0C4DH73|KV112_HUMAN
15 Dec 2023 01:16:12,323 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:12,323 INFO : Inserting sp|A2NJV5|KV229_HUMAN
15 Dec 2023 01:16:12,342 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,342 INFO : Inserting sp|A4D2H0|CTGEF_HUMAN
15 Dec 2023 01:16:12,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,355 INFO : Inserting sp|A6NES4|MRO2A_HUMAN
15 Dec 2023 01:16:12,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,374 INFO : Inserting sp|F5H284|PAL4D_HUMAN
15 Dec 2023 01:16:12,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:12,401 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:16:12,555 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:16:12,555 INFO : Inserting sp|O60268|K0513_HUMAN
15 Dec 2023 01:16:12,586 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,586 INFO : Inserting sp|O75526|RMXL2_HUMAN
15 Dec 2023 01:16:12,627 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:12,627 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 01:16:12,768 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:12,768 INFO : Inserting sp|O95825|QORL1_HUMAN
15 Dec 2023 01:16:12,790 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,790 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 01:16:12,909 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:16:12,909 INFO : Inserting sp|P16562|CRIS2_HUMAN
15 Dec 2023 01:16:12,921 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,921 INFO : Inserting sp|Q14549|GBX1_HUMAN
15 Dec 2023 01:16:12,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:12,942 INFO : Inserting sp|Q15181|IPYR_HUMAN
15 Dec 2023 01:16:12,967 INFO : 98% Done
15 Dec 2023 01:16:13,015 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:16:13,015 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 01:16:13,058 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:13,058 INFO : Inserting sp|Q2TAA2|IAH1_HUMAN
15 Dec 2023 01:16:13,095 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,095 INFO : Inserting sp|Q4G0F5|VP26B_HUMAN
15 Dec 2023 01:16:13,128 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,128 INFO : Inserting sp|Q5JS37|NHLC3_HUMAN
15 Dec 2023 01:16:13,172 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:13,172 INFO : Inserting sp|Q5TFE4|NT5D1_HUMAN
15 Dec 2023 01:16:13,192 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,192 INFO : Inserting sp|Q5VSG8|MANEL_HUMAN
15 Dec 2023 01:16:13,214 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,214 INFO : Inserting sp|Q6P589|TP8L2_HUMAN
15 Dec 2023 01:16:13,253 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,253 INFO : Inserting sp|Q6TFL3|CC171_HUMAN
15 Dec 2023 01:16:13,272 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,272 INFO : Inserting sp|Q86UF2|CTGE6_HUMAN
15 Dec 2023 01:16:13,282 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,282 INFO : Inserting sp|Q86YQ8|CPNE8_HUMAN
15 Dec 2023 01:16:13,306 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,306 INFO : Inserting sp|Q8IX94|CTGE4_HUMAN
15 Dec 2023 01:16:13,316 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,316 INFO : Inserting sp|Q8N3T6|T132C_HUMAN
15 Dec 2023 01:16:13,340 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,340 INFO : Inserting sp|Q8N5W9|RFLB_HUMAN
15 Dec 2023 01:16:13,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,356 INFO : Inserting sp|Q8NCR9|CLRN3_HUMAN
15 Dec 2023 01:16:13,376 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,376 INFO : Inserting sp|Q96MF6|CQ10A_HUMAN
15 Dec 2023 01:16:13,391 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,391 INFO : Inserting sp|Q9BT73|PSMG3_HUMAN
15 Dec 2023 01:16:13,411 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,411 INFO : Inserting sp|Q9BZK3|NACP4_HUMAN
15 Dec 2023 01:16:13,438 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,438 INFO : Inserting sp|Q9GZN8|CT027_HUMAN
15 Dec 2023 01:16:13,468 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,468 INFO : Inserting sp|Q9H0R4|HDHD2_HUMAN
15 Dec 2023 01:16:13,509 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:16:13,509 INFO : Inserting sp|Q9H8J5|MANS1_HUMAN
15 Dec 2023 01:16:13,522 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,523 INFO : Inserting sp|Q9H8M1|CQ10B_HUMAN
15 Dec 2023 01:16:13,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,538 INFO : Inserting sp|Q9HD45|TM9S3_HUMAN
15 Dec 2023 01:16:13,566 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,566 INFO : Inserting sp|Q9NPD7|NRN1_HUMAN
15 Dec 2023 01:16:13,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,582 INFO : Inserting sp|Q9P016|THYN1_HUMAN
15 Dec 2023 01:16:13,606 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,606 INFO : Inserting sp|Q9UFN0|NPS3A_HUMAN
15 Dec 2023 01:16:13,667 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:13,667 INFO : Inserting sp|Q9UJC5|SH3L2_HUMAN
15 Dec 2023 01:16:13,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,686 INFO : Inserting sp|Q9Y485|DMXL1_HUMAN
15 Dec 2023 01:16:13,718 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,718 INFO : Inserting sp|A0A3B3IRV3|MCTS2_HUMAN
15 Dec 2023 01:16:13,787 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:13,787 INFO : Inserting sp|A4FU28|CTGE9_HUMAN
15 Dec 2023 01:16:13,797 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,797 INFO : Inserting sp|A6NGN9|IGLO5_HUMAN
15 Dec 2023 01:16:13,824 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,824 INFO : Inserting sp|A6NLU5|VTM2B_HUMAN
15 Dec 2023 01:16:13,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,841 INFO : Inserting sp|O75071|EFC14_HUMAN
15 Dec 2023 01:16:13,862 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,862 INFO : Inserting sp|P0CG41|CTGE8_HUMAN
15 Dec 2023 01:16:13,871 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,871 INFO : Inserting sp|Q5T6V5|QSPP_HUMAN
15 Dec 2023 01:16:13,889 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:13,890 INFO : Inserting sp|Q5VVH2|FKB1C_HUMAN
15 Dec 2023 01:16:13,947 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:13,947 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 01:16:13,994 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:13,994 INFO : Inserting sp|Q86V85|GP180_HUMAN
15 Dec 2023 01:16:14,014 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:14,014 INFO : Inserting sp|Q8N7X1|RMXL3_HUMAN
15 Dec 2023 01:16:14,031 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:14,031 INFO : Inserting sp|Q8N9C0|IGS22_HUMAN
15 Dec 2023 01:16:14,047 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:14,047 INFO : Inserting sp|Q96CN7|ISOC1_HUMAN
15 Dec 2023 01:16:14,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:14,056 INFO : Inserting sp|Q9BPW8|NIPS1_HUMAN
15 Dec 2023 01:16:14,110 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:16:14,110 INFO : Inserting sp|Q9P1F3|ABRAL_HUMAN
15 Dec 2023 01:16:14,153 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:16:14,153 INFO : Inserting sp|Q56UQ5|TPT1L_HUMAN
15 Dec 2023 01:16:14,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:16:14,168 INFO : None of the 1213574 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:19:29,342 INFO : Updated 401100 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:19:29,347 INFO : Done parsing Skyline document.
15 Dec 2023 01:19:29,388 WARN : Missed importing 49 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6666.24_F4_S2-E4_1_2921.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 43 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.15_F4_S2-C3_1_2837.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 38 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.35_F4_S2-F3_1_2862.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 52 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.47_F4_S2-H3_1_2881.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 50 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.9_F4_S2-B3_1_2829.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 43 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.28_F4_S2-E3_1_2854.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 54 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.22_F4_S2-D3_1_2846.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 38 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6666.7_F4_S2-B4_1_2897.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 42 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.41_F4_S2-G3_1_2873.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 39 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6666.17_F4_S2-D4_1_2913.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 47 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6666.11_F4_S2-C4_1_2905.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 36 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.3_F4_S1-A8_1_3066.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 42 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6666.3_F4_S2-A4_1_2889.d
15 Dec 2023 01:19:29,389 WARN : Missed importing 53 chromatograms from sample file D:\SILK\P017\CSF\Data\F4\CSF_6653.3_F4_S2-A3_1_2821.d
15 Dec 2023 01:19:29,389 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:19:33,947 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 01:19:52,153 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 01:19:58,707 INFO : Cleaning up temp tables
15 Dec 2023 01:19:59,066 INFO : Completed import of Skyline document from SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 01:19:59,068 INFO : 100% Done
15 Dec 2023 01:19:59,119 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179056/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip into the system
15 Dec 2023 01:19:59,122 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179064/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd into the system
15 Dec 2023 01:19:59,122 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179064/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd into the system
15 Dec 2023 01:19:59,123 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179064/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip into the system
15 Dec 2023 01:19:59,124 INFO : Starting import from SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 01:19:59,127 INFO : Starting to import Skyline document from SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 01:19:59,191 INFO : Expanding human.protdb
15 Dec 2023 01:20:02,485 INFO : Expanding CSF_P017_F5.imsdb
15 Dec 2023 01:20:02,492 INFO : Expanding SILK_P017_CSF_F5_a.blib
15 Dec 2023 01:20:02,570 INFO : Expanding SILK_P017_CSF_F5_a.redundant.blib
15 Dec 2023 01:20:02,839 INFO : Expanding SILK_P017_CSF_F5_a.skyd
15 Dec 2023 01:20:04,623 INFO : Expanding SILK_P017_CSF_F5_a.sky.view
15 Dec 2023 01:20:04,675 INFO : Expanding SILK_P017_CSF_F5_a.sky
15 Dec 2023 01:20:04,871 INFO : Expanding SILK_P017_CSF_F5_a.skyl
15 Dec 2023 01:20:09,301 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:20:09,516 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:20:11,881 INFO : Inserting sp|A6NNZ2|TBB8B_HUMAN
15 Dec 2023 01:20:11,892 WARN : 'SILK_P017_CSF_F5' library was not found in settings.
15 Dec 2023 01:20:11,917 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:11,917 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.3_F5_S1-A10_1_3067.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.3_F5_S2-A7_1_2822.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.9_F5_S2-B7_1_2830.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.15_F5_S2-C7_1_2839.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.22_F5_S2-D7_1_2847.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.28_F5_S2-E7_1_2855.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.35_F5_S2-F7_1_2863.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.41_F5_S2-G7_1_2874.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6653.47_F5_S2-H7_1_2882.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6666.3_F5_S2-A8_1_2890.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6666.7_F5_S2-B8_1_2898.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6666.11_F5_S2-C8_1_2906.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6666.17_F5_S2-D8_1_2914.d
15 Dec 2023 01:20:11,973 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\CSF\Data\F5\CSF_6666.24_F5_S2-E8_1_2922.d
15 Dec 2023 01:20:11,993 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:11,993 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:20:12,135 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:12,135 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:20:12,165 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,165 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:20:12,202 INFO : 1% Done
15 Dec 2023 01:20:12,258 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:12,258 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:20:12,305 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:12,305 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 01:20:12,359 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,359 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:20:12,416 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,416 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:20:12,523 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:12,523 INFO : Inserting sp|O14880|MGST3_HUMAN
15 Dec 2023 01:20:12,588 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,588 INFO : Inserting sp|O14979|HNRDL_HUMAN
15 Dec 2023 01:20:12,613 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,613 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:20:12,629 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,629 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:20:12,700 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,701 INFO : Inserting sp|O15389|SIGL5_HUMAN
15 Dec 2023 01:20:12,734 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,734 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:20:12,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,779 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:20:12,934 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:12,934 INFO : Inserting sp|O43557|TNF14_HUMAN
15 Dec 2023 01:20:12,950 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:12,950 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:20:13,164 INFO : 2% Done
15 Dec 2023 01:20:13,244 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:13,244 INFO : Inserting sp|O43809|CPSF5_HUMAN
15 Dec 2023 01:20:13,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,328 INFO : Inserting sp|O60449|LY75_HUMAN
15 Dec 2023 01:20:13,365 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,365 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:20:13,392 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,392 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:20:13,491 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,491 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:20:13,521 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:13,521 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:20:13,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,575 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:20:13,660 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:13,660 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:20:13,714 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,714 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:20:13,778 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,778 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:20:13,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,827 INFO : Inserting sp|O75629|CREG1_HUMAN
15 Dec 2023 01:20:13,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,876 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:20:13,948 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,948 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:20:13,990 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:13,990 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:20:14,000 INFO : 3% Done
15 Dec 2023 01:20:14,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,055 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:20:14,085 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,085 INFO : Inserting sp|O95382|M3K6_HUMAN
15 Dec 2023 01:20:14,146 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,146 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:20:14,198 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,198 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 01:20:14,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,367 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:20:14,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,397 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:20:14,667 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:14,667 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:20:14,753 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,753 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:20:14,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:14,802 INFO : 4% Done
15 Dec 2023 01:20:14,802 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:20:15,458 INFO : 5% Done
15 Dec 2023 01:20:15,886 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:20:15,886 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:20:15,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:15,929 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:20:16,057 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:16,057 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:20:16,240 INFO : 6% Done
15 Dec 2023 01:20:16,308 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:16,308 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:20:16,598 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:16,598 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:20:16,898 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:20:16,898 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:20:16,935 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:16,935 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:20:17,096 INFO : 7% Done
15 Dec 2023 01:20:17,285 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:17,285 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:20:17,505 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:17,505 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:20:17,822 INFO : 8% Done
15 Dec 2023 01:20:17,992 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:20:17,992 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:20:18,055 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:18,055 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:20:18,493 INFO : 9% Done
15 Dec 2023 01:20:18,586 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:20:18,587 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:20:18,909 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:18,909 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:20:19,189 INFO : 10% Done
15 Dec 2023 01:20:19,704 INFO : 11% Done
15 Dec 2023 01:20:20,560 INFO : 12% Done
15 Dec 2023 01:20:20,580 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:20:20,580 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:20:21,284 INFO : 13% Done
15 Dec 2023 01:20:21,461 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:20:21,461 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:20:22,092 INFO : 14% Done
15 Dec 2023 01:20:22,882 INFO : 15% Done
15 Dec 2023 01:20:22,987 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:20:22,988 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:20:23,703 INFO : 16% Done
15 Dec 2023 01:20:24,457 INFO : 17% Done
15 Dec 2023 01:20:24,960 DEBUG: Inserted 50 peptides
15 Dec 2023 01:20:25,152 INFO : 18% Done
15 Dec 2023 01:20:25,931 INFO : 19% Done
15 Dec 2023 01:20:26,387 DEBUG: Total peptides inserted: 75
15 Dec 2023 01:20:26,387 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:20:26,633 INFO : 20% Done
15 Dec 2023 01:20:27,503 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:20:27,503 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:20:27,540 INFO : 21% Done
15 Dec 2023 01:20:27,676 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:27,676 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:20:27,886 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:27,886 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:20:27,987 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:27,987 INFO : Inserting sp|P01236|PRL_HUMAN
15 Dec 2023 01:20:28,039 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:28,039 INFO : Inserting sp|P01602|KV105_HUMAN
15 Dec 2023 01:20:28,063 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:28,063 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:20:28,192 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:28,192 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:20:28,311 INFO : 22% Done
15 Dec 2023 01:20:28,446 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:28,446 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:20:28,568 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:28,568 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:20:28,708 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:28,708 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:20:28,860 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:28,860 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:20:29,022 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:29,022 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:20:29,153 INFO : 23% Done
15 Dec 2023 01:20:29,358 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:29,358 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:20:29,385 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:29,385 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:20:29,674 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:29,674 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:20:29,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:29,689 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:20:29,952 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:29,952 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:20:30,045 INFO : 24% Done
15 Dec 2023 01:20:30,065 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:30,065 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:20:30,205 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:30,205 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:20:30,513 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:30,513 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:20:30,656 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:30,656 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:20:30,794 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:30,795 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:20:30,804 INFO : 25% Done
15 Dec 2023 01:20:30,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:30,850 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:20:30,873 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:30,873 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:20:31,183 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:31,183 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:20:31,305 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:31,305 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:20:31,442 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:31,442 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:20:31,496 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:31,496 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:20:31,705 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:31,705 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:20:32,060 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:32,061 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:20:32,366 INFO : 26% Done
15 Dec 2023 01:20:32,727 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:20:32,727 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:20:32,891 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:32,891 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:20:32,981 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:32,981 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:20:33,094 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:33,095 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:20:33,306 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:33,306 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:20:33,318 INFO : 27% Done
15 Dec 2023 01:20:34,056 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:20:34,056 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:20:34,336 INFO : 28% Done
15 Dec 2023 01:20:35,202 INFO : 29% Done
15 Dec 2023 01:20:35,429 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:20:35,429 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:20:36,038 INFO : 30% Done
15 Dec 2023 01:20:36,395 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:20:36,396 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:20:36,920 INFO : 31% Done
15 Dec 2023 01:20:37,000 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:20:37,000 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:20:37,264 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:37,264 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:20:37,712 INFO : 32% Done
15 Dec 2023 01:20:37,976 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:20:37,976 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:20:38,035 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:38,035 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:20:38,159 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:38,159 INFO : Imported 100 peptide groups.
15 Dec 2023 01:20:38,159 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:20:38,265 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:38,265 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:20:38,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:38,319 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:20:38,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:38,401 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:20:38,525 INFO : 33% Done
15 Dec 2023 01:20:38,563 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:38,563 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:20:38,744 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:38,744 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:20:39,317 INFO : 34% Done
15 Dec 2023 01:20:40,182 INFO : 35% Done
15 Dec 2023 01:20:40,336 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:20:40,336 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:20:40,442 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:40,442 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:20:40,544 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:40,544 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:20:40,853 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:40,854 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:20:41,039 INFO : 36% Done
15 Dec 2023 01:20:41,296 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:41,296 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:20:41,403 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:41,403 INFO : Inserting sp|P04350|TBB4A_HUMAN
15 Dec 2023 01:20:41,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:41,435 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:20:41,620 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:41,620 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:20:41,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:41,716 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:20:41,746 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:41,746 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 01:20:41,985 INFO : 37% Done
15 Dec 2023 01:20:42,034 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:42,034 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:20:42,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:42,080 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:20:42,265 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:42,265 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:20:42,326 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:42,326 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:20:42,482 INFO : 38% Done
15 Dec 2023 01:20:42,643 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:20:42,643 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:20:42,768 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:42,768 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:20:42,914 INFO : 39% Done
15 Dec 2023 01:20:42,984 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:42,984 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:20:43,178 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:43,178 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:20:43,301 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:43,301 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:20:43,321 INFO : 40% Done
15 Dec 2023 01:20:43,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:43,371 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:20:43,518 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:43,518 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:20:43,716 INFO : 41% Done
15 Dec 2023 01:20:43,742 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:43,742 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:20:43,845 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:43,845 INFO : Inserting sp|P06730|IF4E_HUMAN
15 Dec 2023 01:20:43,861 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:43,861 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:20:44,029 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:44,030 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:20:44,119 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:44,119 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:20:44,128 INFO : 42% Done
15 Dec 2023 01:20:44,326 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:44,326 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:20:44,345 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:44,345 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:20:44,409 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:44,409 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:20:44,425 INFO : 43% Done
15 Dec 2023 01:20:44,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,478 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:20:44,616 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:44,616 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:20:44,737 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:44,737 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:20:44,752 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,752 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:20:44,771 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,771 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:20:44,781 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,781 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:20:44,802 INFO : 44% Done
15 Dec 2023 01:20:44,822 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:44,822 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:20:44,832 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,832 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:20:44,861 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,861 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:20:44,870 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:44,870 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:20:44,897 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:44,897 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:20:45,099 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:20:45,099 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:20:45,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:45,108 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:20:45,168 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:45,168 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:20:45,207 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:45,207 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:20:45,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:45,217 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:20:45,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:45,230 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:20:45,238 INFO : 45% Done
15 Dec 2023 01:20:45,555 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:45,556 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:20:45,579 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:45,580 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:20:45,590 INFO : 46% Done
15 Dec 2023 01:20:45,751 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:45,751 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:20:46,005 INFO : 47% Done
15 Dec 2023 01:20:46,130 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:20:46,130 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:20:46,159 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:46,159 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:20:46,193 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:46,194 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:20:46,219 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:46,219 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 01:20:46,315 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:46,315 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:20:46,345 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:46,345 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:20:46,427 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:46,427 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:20:46,442 INFO : 48% Done
15 Dec 2023 01:20:46,505 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:46,505 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:20:46,920 INFO : 49% Done
15 Dec 2023 01:20:47,390 INFO : 50% Done
15 Dec 2023 01:20:47,826 INFO : 51% Done
15 Dec 2023 01:20:48,177 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:20:48,177 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:20:48,210 INFO : 52% Done
15 Dec 2023 01:20:48,717 INFO : 53% Done
15 Dec 2023 01:20:49,076 INFO : 54% Done
15 Dec 2023 01:20:49,407 INFO : 55% Done
15 Dec 2023 01:20:49,734 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:20:49,734 INFO : Inserting sp|P0C0S5|H2AZ_HUMAN
15 Dec 2023 01:20:49,768 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:49,768 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 01:20:49,818 INFO : 56% Done
15 Dec 2023 01:20:49,873 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:49,873 INFO : Inserting sp|P0CG04|IGLC1_HUMAN
15 Dec 2023 01:20:49,930 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:49,930 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:20:49,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:49,952 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:20:49,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:49,972 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:20:50,029 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:50,030 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:20:50,088 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:50,088 INFO : Inserting sp|P0DPH7|TBA3C_HUMAN
15 Dec 2023 01:20:50,111 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,111 INFO : Inserting sp|P0DPH8|TBA3D_HUMAN
15 Dec 2023 01:20:50,133 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,133 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:20:50,151 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,151 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:20:50,234 INFO : 57% Done
15 Dec 2023 01:20:50,344 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:50,345 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:20:50,361 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,361 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:20:50,394 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:50,394 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:20:50,458 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,458 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:20:50,528 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:50,528 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:20:50,566 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:50,566 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:20:50,589 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,589 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:20:50,666 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:50,666 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:20:50,676 INFO : 58% Done
15 Dec 2023 01:20:50,703 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,703 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:20:50,738 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,739 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:20:50,902 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:50,902 INFO : Inserting sp|P12838|DEF4_HUMAN
15 Dec 2023 01:20:50,918 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,918 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:20:50,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:50,975 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:20:51,027 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:51,027 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:20:51,110 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:51,110 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:20:51,115 INFO : 59% Done
15 Dec 2023 01:20:51,340 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:20:51,340 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:20:51,413 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:51,413 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:20:51,450 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,450 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:20:51,481 INFO : 60% Done
15 Dec 2023 01:20:51,518 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:51,518 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:20:51,561 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:51,561 INFO : Inserting sp|P15559|NQO1_HUMAN
15 Dec 2023 01:20:51,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,582 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:20:51,603 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,603 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:20:51,645 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,645 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:20:51,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,679 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:20:51,742 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:51,742 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 01:20:51,768 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,768 INFO : Imported 200 peptide groups.
15 Dec 2023 01:20:51,768 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:20:51,794 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:51,794 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:20:51,854 INFO : 61% Done
15 Dec 2023 01:20:51,884 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:51,884 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:20:52,171 INFO : 62% Done
15 Dec 2023 01:20:52,267 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:20:52,268 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:20:52,530 INFO : 63% Done
15 Dec 2023 01:20:52,623 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:20:52,623 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:20:52,682 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:52,682 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:20:52,751 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:52,752 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:20:52,777 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:52,777 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:20:52,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:52,833 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 01:20:52,941 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:52,941 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:20:52,953 INFO : 64% Done
15 Dec 2023 01:20:53,115 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:53,115 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:20:53,180 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:53,180 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:20:53,197 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,197 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:20:53,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,224 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:20:53,250 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,250 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:20:53,265 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,265 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:20:53,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,292 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:20:53,335 INFO : 65% Done
15 Dec 2023 01:20:53,479 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:20:53,480 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:20:53,495 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,495 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:20:53,517 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,517 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:20:53,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,531 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:20:53,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,554 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:20:53,573 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:53,573 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:20:53,619 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:53,619 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:20:53,656 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:53,656 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:20:53,698 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,698 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:20:53,748 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:53,748 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:20:53,758 INFO : 66% Done
15 Dec 2023 01:20:53,782 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,782 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:20:53,802 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,802 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:20:53,817 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,817 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:20:53,872 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:53,872 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:20:53,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,899 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:20:53,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:53,929 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:20:54,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:54,019 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:20:54,036 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,036 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:20:54,051 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,051 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:20:54,094 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,094 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:20:54,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,104 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:20:54,129 INFO : 67% Done
15 Dec 2023 01:20:54,292 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:54,292 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:20:54,457 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:54,457 INFO : Inserting sp|P29972|AQP1_HUMAN
15 Dec 2023 01:20:54,518 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,518 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:20:54,539 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,540 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:20:54,548 INFO : 68% Done
15 Dec 2023 01:20:54,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,568 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:20:54,595 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:54,595 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:20:54,656 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:54,656 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:20:54,760 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:54,760 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:20:54,823 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:54,823 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:20:54,918 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:54,918 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:20:54,953 INFO : 69% Done
15 Dec 2023 01:20:55,046 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:55,046 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:20:55,075 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,075 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:20:55,111 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,112 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:20:55,132 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:55,132 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:20:55,190 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:55,190 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:20:55,205 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,205 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:20:55,254 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,254 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:20:55,333 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:55,333 INFO : Inserting sp|P35611|ADDA_HUMAN
15 Dec 2023 01:20:55,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,363 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:20:55,416 INFO : 70% Done
15 Dec 2023 01:20:55,564 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:55,564 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:20:55,768 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:20:55,768 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:20:55,778 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,778 INFO : Inserting sp|P36873|PP1G_HUMAN
15 Dec 2023 01:20:55,788 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:55,788 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:20:55,818 INFO : 71% Done
15 Dec 2023 01:20:56,095 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:20:56,095 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:20:56,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,106 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:20:56,192 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:56,192 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:20:56,202 INFO : 72% Done
15 Dec 2023 01:20:56,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,224 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:20:56,331 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:56,331 INFO : Inserting sp|P42025|ACTY_HUMAN
15 Dec 2023 01:20:56,360 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,360 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:20:56,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,371 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:20:56,615 INFO : 73% Done
15 Dec 2023 01:20:56,638 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:20:56,639 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:20:56,715 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:56,715 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:20:56,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,744 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:20:56,771 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,772 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:20:56,806 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,806 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:20:56,852 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:56,852 INFO : Inserting sp|P49789|FHIT_HUMAN
15 Dec 2023 01:20:56,874 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,874 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:20:56,908 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,908 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:20:56,961 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:56,961 INFO : Inserting sp|P51825|AFF1_HUMAN
15 Dec 2023 01:20:56,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:56,985 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 01:20:57,002 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,002 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:20:57,037 INFO : 74% Done
15 Dec 2023 01:20:57,070 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,070 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:20:57,127 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,127 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:20:57,185 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,185 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:20:57,233 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,233 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:20:57,344 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:57,344 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:20:57,361 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,362 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:20:57,616 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:20:57,616 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:20:57,647 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,647 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 01:20:57,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,687 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:20:57,707 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,707 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:20:57,727 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,727 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:20:57,742 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,743 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:20:57,759 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,759 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:20:57,797 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:57,797 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:20:57,824 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:57,824 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:20:57,888 INFO : 75% Done
15 Dec 2023 01:20:58,111 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:20:58,111 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:20:58,145 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:58,145 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:20:58,166 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,167 INFO : Inserting sp|P61163|ACTZ_HUMAN
15 Dec 2023 01:20:58,195 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,196 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:20:58,225 INFO : 76% Done
15 Dec 2023 01:20:58,245 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:58,245 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:20:58,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,275 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:20:58,359 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:58,359 INFO : Imported 300 peptide groups.
15 Dec 2023 01:20:58,359 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:20:58,378 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:58,378 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:20:58,442 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:58,442 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:20:58,453 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,453 INFO : Inserting sp|P62140|PP1B_HUMAN
15 Dec 2023 01:20:58,464 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,464 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:20:58,564 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:58,564 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:20:58,580 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,580 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:20:58,601 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:58,601 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:20:58,624 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:58,625 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:20:58,640 INFO : 77% Done
15 Dec 2023 01:20:58,713 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:58,713 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 01:20:59,015 INFO : 78% Done
15 Dec 2023 01:20:59,027 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:20:59,027 INFO : Inserting sp|P63267|ACTH_HUMAN
15 Dec 2023 01:20:59,073 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:20:59,074 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 01:20:59,191 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:59,191 INFO : Inserting sp|P68133|ACTS_HUMAN
15 Dec 2023 01:20:59,253 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:20:59,253 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:20:59,277 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:59,277 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 01:20:59,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:59,302 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 01:20:59,325 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:20:59,325 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:20:59,477 INFO : 79% Done
15 Dec 2023 01:20:59,540 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:20:59,540 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:20:59,624 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:59,624 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:20:59,706 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:20:59,706 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:20:59,843 INFO : 80% Done
15 Dec 2023 01:20:59,997 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:20:59,997 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:21:00,063 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:21:00,063 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:21:00,128 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:00,128 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:21:00,145 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,145 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:21:00,218 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,218 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:21:00,223 INFO : 81% Done
15 Dec 2023 01:21:00,267 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:00,267 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:21:00,369 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:21:00,369 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:21:00,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,399 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:21:00,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,408 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:21:00,428 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,428 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:21:00,467 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:00,467 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:21:00,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,524 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:21:00,600 INFO : 82% Done
15 Dec 2023 01:21:00,766 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:21:00,766 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:21:00,782 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,782 INFO : Inserting sp|Q10472|GALT1_HUMAN
15 Dec 2023 01:21:00,802 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,802 INFO : Inserting sp|Q12800|TFCP2_HUMAN
15 Dec 2023 01:21:00,822 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,822 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:21:00,850 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:00,850 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:21:00,882 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:00,882 INFO : Inserting sp|Q13017|RHG05_HUMAN
15 Dec 2023 01:21:00,912 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,912 INFO : Inserting sp|Q13099|IFT88_HUMAN
15 Dec 2023 01:21:00,928 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,928 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:21:00,950 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,951 INFO : Inserting sp|Q13395|TARB1_HUMAN
15 Dec 2023 01:21:00,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:00,981 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:21:01,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,017 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:21:01,026 INFO : 83% Done
15 Dec 2023 01:21:01,046 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,046 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:21:01,383 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:21:01,384 INFO : Inserting sp|Q13885|TBB2A_HUMAN
15 Dec 2023 01:21:01,405 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,405 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:21:01,446 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,446 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:21:01,452 INFO : 84% Done
15 Dec 2023 01:21:01,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,463 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:21:01,492 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,492 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:21:01,515 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,515 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:21:01,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:01,532 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:21:01,842 INFO : 85% Done
15 Dec 2023 01:21:01,965 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:21:01,965 INFO : Inserting sp|Q14677|EPN4_HUMAN
15 Dec 2023 01:21:02,004 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,004 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:21:02,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,038 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:21:02,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,055 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:21:02,097 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,098 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:21:02,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,119 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:21:02,233 INFO : 86% Done
15 Dec 2023 01:21:02,276 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:21:02,276 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:21:02,490 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:21:02,490 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:21:02,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,538 INFO : Inserting sp|Q15843|NEDD8_HUMAN
15 Dec 2023 01:21:02,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,611 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:21:02,660 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:02,660 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:21:02,712 INFO : 87% Done
15 Dec 2023 01:21:02,735 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:02,735 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:21:02,756 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:02,756 INFO : Inserting sp|Q16795|NDUA9_HUMAN
15 Dec 2023 01:21:02,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,779 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:21:02,806 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,806 INFO : Inserting sp|Q3ZCM7|TBB8_HUMAN
15 Dec 2023 01:21:02,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,830 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:21:02,862 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,862 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:21:02,874 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,874 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:21:02,893 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:02,893 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:21:02,909 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,909 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:21:02,926 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,927 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 01:21:02,954 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:02,954 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:21:03,011 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,011 INFO : Inserting sp|Q6PEY2|TBA3E_HUMAN
15 Dec 2023 01:21:03,033 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,033 INFO : Inserting sp|Q6UWR7|ENPP6_HUMAN
15 Dec 2023 01:21:03,061 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,061 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:21:03,079 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,079 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:21:03,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,119 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:21:03,133 INFO : 88% Done
15 Dec 2023 01:21:03,170 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,170 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 01:21:03,190 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,190 INFO : Inserting sp|Q71UI9|H2AV_HUMAN
15 Dec 2023 01:21:03,223 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,223 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 01:21:03,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,259 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 01:21:03,364 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:03,364 INFO : Inserting sp|Q7Z4W1|DCXR_HUMAN
15 Dec 2023 01:21:03,392 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,392 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:21:03,409 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,409 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:21:03,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,441 INFO : Inserting sp|Q8IUC8|GLT13_HUMAN
15 Dec 2023 01:21:03,461 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,461 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:21:03,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,528 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:21:03,536 INFO : 89% Done
15 Dec 2023 01:21:03,554 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,554 INFO : Inserting sp|Q8IZ52|CHSS2_HUMAN
15 Dec 2023 01:21:03,565 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,565 INFO : Inserting sp|Q8N257|H2B3B_HUMAN
15 Dec 2023 01:21:03,588 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,588 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:21:03,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,628 INFO : Inserting sp|Q8TD57|DYH3_HUMAN
15 Dec 2023 01:21:03,645 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,645 INFO : Inserting sp|Q8TE73|DYH5_HUMAN
15 Dec 2023 01:21:03,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,660 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:21:03,685 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,685 INFO : Inserting sp|Q92616|GCN1_HUMAN
15 Dec 2023 01:21:03,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,716 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:21:03,762 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,762 INFO : Inserting sp|Q92777|SYN2_HUMAN
15 Dec 2023 01:21:03,787 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,787 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:21:03,846 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,846 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:21:03,883 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,883 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:21:03,895 INFO : 90% Done
15 Dec 2023 01:21:03,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:03,929 INFO : Imported 400 peptide groups.
15 Dec 2023 01:21:03,929 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:21:03,961 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:03,962 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 01:21:04,056 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:04,056 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:21:04,074 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:04,074 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:21:04,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,102 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:21:04,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,130 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 01:21:04,224 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:04,224 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:21:04,288 INFO : 91% Done
15 Dec 2023 01:21:04,388 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:21:04,388 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:21:04,555 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:21:04,555 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:21:04,584 INFO : 92% Done
15 Dec 2023 01:21:04,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:04,594 INFO : Inserting sp|Q96RT1|ERBIN_HUMAN
15 Dec 2023 01:21:04,610 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,610 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:21:04,642 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,642 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:21:04,661 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,661 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:21:04,679 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:04,679 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 01:21:04,774 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:04,774 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:21:04,792 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:04,792 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 01:21:04,811 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:04,811 INFO : Inserting sp|Q9BQE3|TBA1C_HUMAN
15 Dec 2023 01:21:04,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,831 INFO : Inserting sp|Q9BQL6|FERM1_HUMAN
15 Dec 2023 01:21:04,846 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,846 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 01:21:04,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,876 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:21:04,909 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,909 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:21:04,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,929 INFO : Inserting sp|Q9BVA1|TBB2B_HUMAN
15 Dec 2023 01:21:04,948 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,948 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:21:04,979 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:04,980 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:21:04,987 INFO : 93% Done
15 Dec 2023 01:21:05,007 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,007 INFO : Inserting sp|Q9BYV1|AGT2_HUMAN
15 Dec 2023 01:21:05,017 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,018 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:21:05,037 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,037 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:21:05,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,066 INFO : Inserting sp|Q9HBI0|PARVG_HUMAN
15 Dec 2023 01:21:05,109 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,109 INFO : Inserting sp|Q9NQW1|SC31B_HUMAN
15 Dec 2023 01:21:05,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,125 INFO : Inserting sp|Q9NQX7|ITM2C_HUMAN
15 Dec 2023 01:21:05,139 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,139 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:21:05,154 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,154 INFO : Inserting sp|Q9NY65|TBA8_HUMAN
15 Dec 2023 01:21:05,174 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,174 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 01:21:05,206 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,206 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:21:05,273 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:05,273 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:21:05,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,288 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:21:05,353 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:05,353 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:21:05,386 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,386 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 01:21:05,399 INFO : 94% Done
15 Dec 2023 01:21:05,435 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,435 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:21:05,465 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,466 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:21:05,483 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,483 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:21:05,515 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,516 INFO : Inserting sp|Q9UNM6|PSD13_HUMAN
15 Dec 2023 01:21:05,540 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,540 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:21:05,556 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,556 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 01:21:05,580 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,580 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:21:05,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,608 INFO : Inserting sp|Q9Y2G5|OFUT2_HUMAN
15 Dec 2023 01:21:05,634 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,634 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:21:05,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,660 INFO : Inserting sp|Q9Y547|IFT25_HUMAN
15 Dec 2023 01:21:05,675 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,675 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:21:05,685 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:05,685 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:21:05,781 INFO : 95% Done
15 Dec 2023 01:21:06,156 INFO : 96% Done
15 Dec 2023 01:21:06,272 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:21:06,272 INFO : Inserting sp|A0A8I5KQE6|RPSA2_HUMAN
15 Dec 2023 01:21:06,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,293 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:21:06,345 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:06,345 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:21:06,394 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:06,395 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:21:06,427 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,427 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:21:06,532 INFO : 97% Done
15 Dec 2023 01:21:06,547 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:21:06,547 INFO : Inserting sp|P29762|RABP1_HUMAN
15 Dec 2023 01:21:06,556 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,557 INFO : Inserting sp|Q14568|HS902_HUMAN
15 Dec 2023 01:21:06,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,566 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:21:06,585 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,585 INFO : Inserting sp|Q6V1P9|PCD23_HUMAN
15 Dec 2023 01:21:06,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,601 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 01:21:06,700 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:06,700 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:21:06,784 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:21:06,784 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:21:06,807 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,807 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:21:06,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,831 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 01:21:06,856 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,856 INFO : Inserting sp|A0A0C4DH69|KV109_HUMAN
15 Dec 2023 01:21:06,880 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,880 INFO : Inserting sp|A6NMX2|I4E1B_HUMAN
15 Dec 2023 01:21:06,895 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,895 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:21:06,908 INFO : 98% Done
15 Dec 2023 01:21:06,939 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:06,939 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 01:21:06,994 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:21:06,994 INFO : Inserting sp|Q32P51|RA1L2_HUMAN
15 Dec 2023 01:21:07,019 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,019 INFO : Inserting sp|Q6TFL3|CC171_HUMAN
15 Dec 2023 01:21:07,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,045 INFO : Inserting sp|Q9BWW9|APOL5_HUMAN
15 Dec 2023 01:21:07,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,058 INFO : Inserting sp|Q9H853|TBA4B_HUMAN
15 Dec 2023 01:21:07,079 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,079 INFO : Inserting sp|A2RUQ5|CQ102_HUMAN
15 Dec 2023 01:21:07,089 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,089 INFO : Inserting sp|A6NHG4|DDTL_HUMAN
15 Dec 2023 01:21:07,116 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:21:07,116 INFO : None of the 264162 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:24:04,012 INFO : Updated 81508 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:24:04,014 INFO : Done parsing Skyline document.
15 Dec 2023 01:24:04,035 WARN : Missed importing 1771 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.41_F5_S2-G7_1_2874.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1771 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.47_F5_S2-H7_1_2882.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1752 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6666.24_F5_S2-E8_1_2922.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1740 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.15_F5_S2-C7_1_2839.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1691 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.3_F5_S1-A10_1_3067.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1761 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.35_F5_S2-F7_1_2863.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1765 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6666.11_F5_S2-C8_1_2906.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1753 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.28_F5_S2-E7_1_2855.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1735 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6666.7_F5_S2-B8_1_2898.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1763 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.22_F5_S2-D7_1_2847.d
15 Dec 2023 01:24:04,035 WARN : Missed importing 1733 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6666.3_F5_S2-A8_1_2890.d
15 Dec 2023 01:24:04,036 WARN : Missed importing 1749 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6666.17_F5_S2-D8_1_2914.d
15 Dec 2023 01:24:04,036 WARN : Missed importing 1774 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.9_F5_S2-B7_1_2830.d
15 Dec 2023 01:24:04,036 WARN : Missed importing 1798 chromatograms from sample file D:\SILK\P017\CSF\Data\F5\CSF_6653.3_F5_S2-A7_1_2822.d
15 Dec 2023 01:24:04,036 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:24:04,842 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 01:24:08,190 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 01:24:08,912 INFO : Cleaning up temp tables
15 Dec 2023 01:24:09,271 INFO : Completed import of Skyline document from SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 01:24:09,273 INFO : 100% Done
15 Dec 2023 01:24:09,279 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179064/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip into the system
15 Dec 2023 01:24:09,281 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179069/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd into the system
15 Dec 2023 01:24:09,281 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179069/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd into the system
15 Dec 2023 01:24:09,282 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179069/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip into the system
15 Dec 2023 01:24:09,283 INFO : Starting import from SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 01:24:09,285 INFO : Starting to import Skyline document from SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 01:24:09,366 INFO : Expanding human.protdb
15 Dec 2023 01:24:12,344 INFO : Expanding Plasma_P017_F1b.imsdb
15 Dec 2023 01:24:12,375 INFO : Expanding SILK_P017_Plasma_F1b.blib
15 Dec 2023 01:24:13,218 INFO : Expanding SILK_P017_Plasma_F1b.redundant.blib
15 Dec 2023 01:24:21,532 INFO : Expanding SILK_P017_Plasma_F1b.skyd
15 Dec 2023 01:24:40,728 INFO : Expanding SILK_P017_Plasma_F1b.sky.view
15 Dec 2023 01:24:40,729 INFO : Expanding SILK_P017_Plasma_F1b.sky
15 Dec 2023 01:24:42,251 INFO : Expanding SILK_P017_Plasma_F1b.skyl
15 Dec 2023 01:25:29,437 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:25:30,455 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:25:32,521 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.49_F1-4_1_S1-G7_1_4450.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.49_F1-4_2_S1-G8_1_4451.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.51_F1-4_1_S1-H5_1_4460.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.51_F1-4_2_S1-H6_1_4461.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.54_F1-4_1_S4-A3_1_4470.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.54_F1-4_2_S4-A4_1_4471.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.58_F1-4_1_S4-B1_1_4480.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.58_F1-4_2_S4-B2_1_4481.d
15 Dec 2023 01:25:32,527 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.60_F1-4_1_S4-B11_1_4490.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.60_F1-4_2_S4-B12_1_4491.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.62_F1-4_1_S4-C9_1_4500.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.62_F1-4_2_S4-C10_1_4501.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.64_F1-4_1_S4-D7_1_4512.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.64_F1-4_2_S4-D8_1_4513.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.66_F1-4_1_S4-E5_1_4522.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6653.66_F1-4_2_S4-E6_1_4523.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.27_F1-4_1_S4-F3_1_4532.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.27_F1-4_2_S4-F4_1_4533.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.29_F1-4_1_S4-G1_1_4542.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.29_F1-4_2_S4-G2_1_4543.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.31_F1-4_1_S4-G11_1_4552.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.31_F1-4_2_S4-G12_1_4553.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.34_F1-4_1_S4-H9_1_4562.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.34_F1-4_2_S4-H10_1_4563.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.36_F1-4_1_S1-A7_1_4574.d
15 Dec 2023 01:25:32,528 WARN : Unable to find at least one chromatogram for file path D:\SILK\P017\Plasma\DATA\F1b\6666.36_F1-4_2_S1-A8_1_4575.d
15 Dec 2023 01:25:32,558 WARN : 'SILK_P017_Plasma_F1' library was not found in settings.
15 Dec 2023 01:25:32,687 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:25:32,687 INFO : Inserting sp|A6NMY6|AXA2L_HUMAN
15 Dec 2023 01:25:32,741 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:32,741 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 01:25:33,044 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:25:33,044 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:25:33,118 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:33,118 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:25:33,602 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:25:33,602 INFO : Inserting sp|O00400|ACATN_HUMAN
15 Dec 2023 01:25:33,606 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,606 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:25:33,609 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,609 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:25:33,614 INFO : 1% Done
15 Dec 2023 01:25:33,690 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:25:33,690 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:25:33,694 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:33,694 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 01:25:33,766 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:25:33,766 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:25:33,769 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,769 INFO : Inserting sp|O14618|CCS_HUMAN
15 Dec 2023 01:25:33,792 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,792 INFO : Inserting sp|O14654|IRS4_HUMAN
15 Dec 2023 01:25:33,796 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,796 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 01:25:33,844 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,844 INFO : Inserting sp|O14686|KMT2D_HUMAN
15 Dec 2023 01:25:33,853 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,853 INFO : Inserting sp|O14744|ANM5_HUMAN
15 Dec 2023 01:25:33,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:33,872 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:25:33,876 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:33,876 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 01:25:34,165 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:25:34,165 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 01:25:34,728 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:25:34,728 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 01:25:34,833 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:34,833 INFO : Inserting sp|O14836|TR13B_HUMAN
15 Dec 2023 01:25:34,842 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,843 INFO : Inserting sp|O14880|MGST3_HUMAN
15 Dec 2023 01:25:34,846 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,846 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 01:25:34,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:34,868 INFO : Inserting sp|O14979|HNRDL_HUMAN
15 Dec 2023 01:25:34,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,916 INFO : Inserting sp|O15015|ZN646_HUMAN
15 Dec 2023 01:25:34,921 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,921 INFO : Inserting sp|O15041|SEM3E_HUMAN
15 Dec 2023 01:25:34,936 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:34,936 INFO : Inserting sp|O15061|SYNEM_HUMAN
15 Dec 2023 01:25:34,957 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,957 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 01:25:34,984 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:34,985 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 01:25:35,011 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,011 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:25:35,039 WARN : 'SILK_P017_CSF_F5' library was not found in settings.
15 Dec 2023 01:25:35,040 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:35,040 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:25:35,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,045 INFO : Inserting sp|O15389|SIGL5_HUMAN
15 Dec 2023 01:25:35,048 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,048 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:25:35,077 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:35,077 INFO : Inserting sp|O15440|MRP5_HUMAN
15 Dec 2023 01:25:35,096 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:35,096 INFO : Inserting sp|O15467|CCL16_HUMAN
15 Dec 2023 01:25:35,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,125 INFO : Inserting sp|O43157|PLXB1_HUMAN
15 Dec 2023 01:25:35,237 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:35,237 INFO : Inserting sp|O43278|SPIT1_HUMAN
15 Dec 2023 01:25:35,298 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,299 INFO : Inserting sp|O43286|B4GT5_HUMAN
15 Dec 2023 01:25:35,358 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,358 INFO : Inserting sp|O43310|CTIF_HUMAN
15 Dec 2023 01:25:35,387 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,387 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 01:25:35,502 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:35,502 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:25:35,508 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:35,509 INFO : Inserting sp|O43557|TNF14_HUMAN
15 Dec 2023 01:25:35,518 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,518 INFO : Inserting sp|O43586|PPIP1_HUMAN
15 Dec 2023 01:25:35,521 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,521 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:25:35,682 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:25:35,682 INFO : Inserting sp|O43747|AP1G1_HUMAN
15 Dec 2023 01:25:35,686 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,686 INFO : Inserting sp|O43809|CPSF5_HUMAN
15 Dec 2023 01:25:35,691 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:35,691 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 01:25:36,224 INFO : 2% Done
15 Dec 2023 01:25:36,327 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:25:36,327 INFO : Inserting sp|O60282|KIF5C_HUMAN
15 Dec 2023 01:25:36,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,333 INFO : Inserting sp|O60449|LY75_HUMAN
15 Dec 2023 01:25:36,336 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,336 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 01:25:36,346 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,346 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:25:36,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,349 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:25:36,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,354 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:25:36,384 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:36,384 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 01:25:36,412 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,412 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:25:36,572 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:36,572 INFO : Inserting sp|O75027|ABCB7_HUMAN
15 Dec 2023 01:25:36,597 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,597 INFO : Inserting sp|O75037|KI21B_HUMAN
15 Dec 2023 01:25:36,627 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,627 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:25:36,716 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:36,716 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 01:25:36,824 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:36,824 INFO : Inserting sp|O75146|HIP1R_HUMAN
15 Dec 2023 01:25:36,842 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:36,842 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 01:25:36,845 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,845 INFO : Inserting sp|O75347|TBCA_HUMAN
15 Dec 2023 01:25:36,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,900 INFO : Inserting sp|O75356|ENTP5_HUMAN
15 Dec 2023 01:25:36,928 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,928 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 01:25:36,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:36,952 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:25:37,073 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:37,073 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:25:37,077 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:37,077 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:25:37,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:37,081 INFO : Inserting sp|O75629|CREG1_HUMAN
15 Dec 2023 01:25:37,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:37,085 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:25:37,337 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:25:37,338 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 01:25:37,435 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:37,435 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:25:38,459 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:25:38,460 INFO : Inserting sp|O75916|RGS9_HUMAN
15 Dec 2023 01:25:38,493 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,493 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 01:25:38,609 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:38,609 INFO : Inserting sp|O76031|CLPX_HUMAN
15 Dec 2023 01:25:38,622 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,623 INFO : Inserting sp|O76061|STC2_HUMAN
15 Dec 2023 01:25:38,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,656 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:25:38,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,696 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 01:25:38,728 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,728 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 01:25:38,736 INFO : 3% Done
15 Dec 2023 01:25:38,768 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:38,768 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:25:38,837 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:38,837 INFO : Inserting sp|O95382|M3K6_HUMAN
15 Dec 2023 01:25:38,841 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:38,841 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 01:25:39,319 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:25:39,319 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 01:25:39,523 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:25:39,523 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:25:39,835 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:25:39,835 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 01:25:39,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:39,840 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:25:39,892 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:39,893 INFO : Inserting sp|O95932|TGM3L_HUMAN
15 Dec 2023 01:25:39,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:39,897 INFO : Inserting sp|P00167|CYB5_HUMAN
15 Dec 2023 01:25:39,919 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:39,919 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:25:40,129 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:25:40,129 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 01:25:40,246 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:40,246 INFO : Inserting sp|P00387|NB5R3_HUMAN
15 Dec 2023 01:25:40,296 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:40,296 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:25:40,320 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:40,320 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:25:40,432 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:25:40,432 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:25:41,007 INFO : 4% Done
15 Dec 2023 01:25:41,951 DEBUG: Inserted 50 peptides
15 Dec 2023 01:25:42,868 DEBUG: Total peptides inserted: 84
15 Dec 2023 01:25:42,868 INFO : Inserting sp|P00451|FA8_HUMAN
15 Dec 2023 01:25:42,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:25:42,872 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:25:43,621 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:25:43,621 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:25:43,628 INFO : 5% Done
15 Dec 2023 01:25:44,062 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:25:44,062 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 01:25:44,178 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:25:44,178 INFO : Inserting sp|P00533|EGFR_HUMAN
15 Dec 2023 01:25:44,210 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:25:44,210 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:25:44,482 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:25:44,483 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 01:25:44,589 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:25:44,589 INFO : Imported 100 peptide groups.
15 Dec 2023 01:25:44,589 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:25:45,996 INFO : 6% Done
15 Dec 2023 01:25:46,589 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:25:46,589 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:25:47,489 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:25:47,490 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 01:25:48,532 INFO : 7% Done
15 Dec 2023 01:25:48,654 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:25:48,654 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 01:25:49,434 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:25:49,434 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 01:25:49,889 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:25:49,890 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:25:50,484 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:25:50,484 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 01:25:50,699 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:25:50,699 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:25:51,101 INFO : 8% Done
15 Dec 2023 01:25:53,151 DEBUG: Inserted 50 peptides
15 Dec 2023 01:25:53,605 DEBUG: Total peptides inserted: 62
15 Dec 2023 01:25:53,605 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:25:54,143 INFO : 9% Done
15 Dec 2023 01:25:54,224 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:25:54,224 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:25:56,054 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:25:56,054 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:25:56,352 INFO : 10% Done
15 Dec 2023 01:25:56,382 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:25:56,382 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 01:25:56,666 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:25:56,666 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:25:57,668 DEBUG: Inserted 50 peptides
15 Dec 2023 01:25:57,714 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:25:57,714 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:25:57,720 INFO : 11% Done
15 Dec 2023 01:25:58,474 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:25:58,474 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:25:59,140 INFO : 12% Done
15 Dec 2023 01:25:59,680 DEBUG: Inserted 50 peptides
15 Dec 2023 01:25:59,794 DEBUG: Total peptides inserted: 56
15 Dec 2023 01:25:59,794 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:26:00,319 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:26:00,320 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:26:00,612 INFO : 13% Done
15 Dec 2023 01:26:01,221 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:01,839 INFO : 14% Done
15 Dec 2023 01:26:01,901 DEBUG: Total peptides inserted: 85
15 Dec 2023 01:26:01,901 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:26:03,069 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:03,107 INFO : 15% Done
15 Dec 2023 01:26:04,061 DEBUG: Inserted 100 peptides
15 Dec 2023 01:26:04,255 INFO : 16% Done
15 Dec 2023 01:26:05,142 DEBUG: Inserted 150 peptides
15 Dec 2023 01:26:05,560 INFO : 17% Done
15 Dec 2023 01:26:05,931 DEBUG: Total peptides inserted: 193
15 Dec 2023 01:26:05,931 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:26:06,912 INFO : 18% Done
15 Dec 2023 01:26:06,954 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:07,852 DEBUG: Inserted 100 peptides
15 Dec 2023 01:26:07,908 DEBUG: Total peptides inserted: 102
15 Dec 2023 01:26:07,908 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:26:07,975 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:07,975 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:26:08,082 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:08,082 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:26:08,226 INFO : 19% Done
15 Dec 2023 01:26:08,491 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:26:08,491 INFO : Inserting sp|P01137|TGFB1_HUMAN
15 Dec 2023 01:26:08,505 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:08,505 INFO : Inserting sp|P01236|PRL_HUMAN
15 Dec 2023 01:26:08,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:08,509 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 01:26:08,534 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:08,534 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 01:26:08,636 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:08,636 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 01:26:08,681 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:08,681 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 01:26:08,726 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:08,726 INFO : Inserting sp|P01597|KV139_HUMAN
15 Dec 2023 01:26:08,807 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:08,807 INFO : Inserting sp|P01602|KV105_HUMAN
15 Dec 2023 01:26:08,887 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:08,887 INFO : Inserting sp|P01611|KVD12_HUMAN
15 Dec 2023 01:26:08,964 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:08,965 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 01:26:09,025 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:09,025 INFO : Inserting sp|P01699|LV144_HUMAN
15 Dec 2023 01:26:09,079 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:09,079 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 01:26:09,145 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:09,146 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 01:26:09,186 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:09,186 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 01:26:09,242 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:09,242 INFO : Inserting sp|P01721|LV657_HUMAN
15 Dec 2023 01:26:09,262 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:09,262 INFO : Inserting sp|P01742|HV169_HUMAN
15 Dec 2023 01:26:09,286 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:09,287 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 01:26:09,311 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:09,311 INFO : Inserting sp|P01762|HV311_HUMAN
15 Dec 2023 01:26:09,391 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:09,391 INFO : Inserting sp|P01764|HV323_HUMAN
15 Dec 2023 01:26:09,471 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:09,471 INFO : Inserting sp|P01766|HV313_HUMAN
15 Dec 2023 01:26:09,541 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:09,541 INFO : Inserting sp|P01767|HV353_HUMAN
15 Dec 2023 01:26:09,639 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:09,639 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 01:26:09,647 INFO : 20% Done
15 Dec 2023 01:26:09,741 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:09,741 INFO : Inserting sp|P01772|HV333_HUMAN
15 Dec 2023 01:26:09,846 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:09,847 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 01:26:09,938 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:09,938 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 01:26:10,058 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:10,058 INFO : Inserting sp|P01817|HV205_HUMAN
15 Dec 2023 01:26:10,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:10,081 INFO : Inserting sp|P01824|HV439_HUMAN
15 Dec 2023 01:26:10,132 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:10,133 INFO : Inserting sp|P01833|PIGR_HUMAN
15 Dec 2023 01:26:10,176 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:10,176 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:26:10,379 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:10,379 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:26:10,747 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:26:10,747 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:26:10,939 INFO : 21% Done
15 Dec 2023 01:26:11,144 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:26:11,144 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:26:11,565 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:26:11,565 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:26:11,850 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:26:11,850 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:26:12,232 INFO : 22% Done
15 Dec 2023 01:26:12,297 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:26:12,297 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:26:12,597 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:26:12,597 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 01:26:12,726 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:12,726 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:26:12,806 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:12,806 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 01:26:12,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:12,827 INFO : Inserting sp|P02008|HBAZ_HUMAN
15 Dec 2023 01:26:12,933 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:12,933 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:26:13,260 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:26:13,260 INFO : Inserting sp|P02100|HBE_HUMAN
15 Dec 2023 01:26:13,279 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:13,280 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:26:13,289 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:13,289 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 01:26:13,484 INFO : 23% Done
15 Dec 2023 01:26:14,177 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:14,402 DEBUG: Total peptides inserted: 61
15 Dec 2023 01:26:14,402 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:26:14,824 INFO : 24% Done
15 Dec 2023 01:26:15,122 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:26:15,122 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:26:15,519 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:26:15,519 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:26:15,710 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:15,710 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 01:26:15,819 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:15,819 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 01:26:15,982 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:15,982 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 01:26:16,061 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:16,061 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:26:16,154 INFO : 25% Done
15 Dec 2023 01:26:16,811 DEBUG: Total peptides inserted: 42
15 Dec 2023 01:26:16,811 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:26:17,602 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:26:17,602 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:26:18,356 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:26:18,356 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:26:18,717 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:26:18,717 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 01:26:18,789 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:18,789 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:26:18,886 INFO : 26% Done
15 Dec 2023 01:26:18,954 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:26:18,955 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:26:19,156 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:19,156 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:26:19,394 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:26:19,395 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:26:19,513 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:19,513 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:26:19,981 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:26:19,982 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:26:20,183 INFO : 27% Done
15 Dec 2023 01:26:20,316 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:26:20,316 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:26:20,548 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:26:20,548 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:26:21,453 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:21,637 INFO : 28% Done
15 Dec 2023 01:26:21,934 DEBUG: Total peptides inserted: 75
15 Dec 2023 01:26:21,934 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:26:22,197 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:26:22,197 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:26:22,527 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:26:22,527 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:26:22,730 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:26:22,730 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:26:22,950 INFO : 29% Done
15 Dec 2023 01:26:23,071 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:26:23,071 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:26:23,432 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:26:23,432 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:26:24,006 INFO : 30% Done
15 Dec 2023 01:26:24,467 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:24,852 DEBUG: Total peptides inserted: 70
15 Dec 2023 01:26:24,852 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:26:25,207 INFO : 31% Done
15 Dec 2023 01:26:25,712 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:26:25,712 INFO : Inserting sp|P02775|CXCL7_HUMAN
15 Dec 2023 01:26:25,808 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:25,808 INFO : Inserting sp|P02776|PLF4_HUMAN
15 Dec 2023 01:26:25,862 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:25,862 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 01:26:26,230 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:26:26,230 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:26:26,470 INFO : 32% Done
15 Dec 2023 01:26:27,182 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:26:27,182 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:26:27,382 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:26:27,382 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:26:27,884 INFO : 33% Done
15 Dec 2023 01:26:28,244 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:26:28,245 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 01:26:28,271 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:28,271 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 01:26:28,337 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:28,337 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:26:28,723 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:26:28,723 INFO : Imported 200 peptide groups.
15 Dec 2023 01:26:28,723 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:26:29,297 INFO : 34% Done
15 Dec 2023 01:26:29,314 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:26:29,314 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:26:29,950 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:26:29,950 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:26:30,299 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:26:30,300 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 01:26:30,734 INFO : 35% Done
15 Dec 2023 01:26:30,774 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:26:30,774 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:26:30,800 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:30,800 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 01:26:30,997 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:26:30,997 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:26:31,176 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:26:31,177 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:26:31,294 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:26:31,294 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:26:32,105 INFO : 36% Done
15 Dec 2023 01:26:32,215 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:33,191 DEBUG: Inserted 100 peptides
15 Dec 2023 01:26:33,481 INFO : 37% Done
15 Dec 2023 01:26:34,263 DEBUG: Inserted 150 peptides
15 Dec 2023 01:26:35,125 INFO : 38% Done
15 Dec 2023 01:26:35,465 DEBUG: Inserted 200 peptides
15 Dec 2023 01:26:36,423 DEBUG: Inserted 250 peptides
15 Dec 2023 01:26:36,472 INFO : 39% Done
15 Dec 2023 01:26:37,393 DEBUG: Inserted 300 peptides
15 Dec 2023 01:26:37,782 INFO : 40% Done
15 Dec 2023 01:26:37,956 DEBUG: Total peptides inserted: 327
15 Dec 2023 01:26:37,956 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:26:37,970 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:37,971 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:26:38,096 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:38,096 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:26:38,541 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:26:38,541 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:26:39,000 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:26:39,000 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 01:26:39,039 INFO : 41% Done
15 Dec 2023 01:26:39,422 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:26:39,422 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 01:26:39,973 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:26:39,973 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:26:40,246 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:26:40,246 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:26:40,318 INFO : 42% Done
15 Dec 2023 01:26:40,788 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:26:40,788 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 01:26:40,820 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:40,820 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 01:26:40,837 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:40,837 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 01:26:41,008 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:41,008 INFO : Inserting sp|P04792|HSPB1_HUMAN
15 Dec 2023 01:26:41,018 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:41,018 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:26:41,023 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:41,023 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:26:41,055 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:41,055 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 01:26:41,064 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:41,064 INFO : Inserting sp|P05019|IGF1_HUMAN
15 Dec 2023 01:26:41,111 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:41,111 INFO : Inserting sp|P05062|ALDOB_HUMAN
15 Dec 2023 01:26:41,142 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:41,142 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 01:26:41,205 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:41,205 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:26:41,304 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:41,304 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 01:26:41,413 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:41,413 INFO : Inserting sp|P05106|ITB3_HUMAN
15 Dec 2023 01:26:41,495 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:41,495 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:26:41,591 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:41,591 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 01:26:41,623 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:41,623 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:26:42,007 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:26:42,007 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:26:42,124 INFO : 43% Done
15 Dec 2023 01:26:42,893 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:26:42,893 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:26:43,438 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:26:43,438 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 01:26:43,479 INFO : 44% Done
15 Dec 2023 01:26:43,736 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:26:43,736 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:26:43,898 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:26:43,898 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 01:26:43,947 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:43,947 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 01:26:43,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:43,985 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 01:26:44,120 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:44,120 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:26:44,476 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:26:44,476 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:26:44,760 INFO : 45% Done
15 Dec 2023 01:26:45,188 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:26:45,188 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 01:26:45,226 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:45,226 INFO : Inserting sp|P05787|K2C8_HUMAN
15 Dec 2023 01:26:45,278 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:45,278 INFO : Inserting sp|P05976|MYL1_HUMAN
15 Dec 2023 01:26:45,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:45,281 INFO : Inserting sp|P05981|HEPS_HUMAN
15 Dec 2023 01:26:45,300 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:45,300 INFO : Inserting sp|P06132|DCUP_HUMAN
15 Dec 2023 01:26:45,370 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:45,370 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:26:45,661 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:26:45,661 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 01:26:45,714 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:45,714 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:26:46,110 INFO : 46% Done
15 Dec 2023 01:26:46,340 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:26:46,340 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:26:46,962 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:26:46,962 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:26:47,075 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:26:47,075 INFO : Inserting sp|P06703|S10A6_HUMAN
15 Dec 2023 01:26:47,079 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:47,079 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 01:26:47,321 INFO : 47% Done
15 Dec 2023 01:26:47,556 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:26:47,557 INFO : Inserting sp|P06730|IF4E_HUMAN
15 Dec 2023 01:26:47,599 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:47,599 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:26:47,754 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:26:47,754 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:26:47,761 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:47,761 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:26:47,850 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:26:47,850 INFO : Inserting sp|P06753|TPM3_HUMAN
15 Dec 2023 01:26:47,883 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:47,883 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:26:47,906 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:47,906 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:26:48,125 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:26:48,125 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 01:26:48,208 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:48,208 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 01:26:48,294 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:48,294 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:26:48,775 INFO : 48% Done
15 Dec 2023 01:26:48,841 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:26:48,841 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 01:26:48,938 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:48,938 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 01:26:49,057 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:49,057 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:26:49,159 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:49,159 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 01:26:49,196 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:49,196 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:26:49,563 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:26:49,563 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:26:50,067 INFO : 49% Done
15 Dec 2023 01:26:50,186 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:26:50,186 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 01:26:50,255 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:50,255 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 01:26:50,525 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:26:50,525 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 01:26:50,571 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:50,571 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:26:50,713 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:50,714 INFO : Inserting sp|P07451|CAH3_HUMAN
15 Dec 2023 01:26:50,774 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:50,774 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:26:50,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:50,784 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:26:50,905 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:50,905 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 01:26:51,063 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:51,063 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:26:51,166 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:26:51,166 INFO : Inserting sp|P07911|UROM_HUMAN
15 Dec 2023 01:26:51,238 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:51,238 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 01:26:51,242 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:51,243 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:26:51,561 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:26:51,561 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:26:51,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:51,573 INFO : 50% Done
15 Dec 2023 01:26:51,573 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:26:51,578 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:51,578 INFO : Inserting sp|P08134|RHOC_HUMAN
15 Dec 2023 01:26:51,603 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:51,603 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:26:52,030 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:26:52,030 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 01:26:52,118 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:52,118 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:26:52,198 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:52,198 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:26:52,204 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:52,204 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:26:52,305 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:52,305 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:26:52,355 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:52,355 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:26:52,358 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:52,358 INFO : Inserting sp|P08397|HEM3_HUMAN
15 Dec 2023 01:26:52,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:52,363 INFO : Inserting sp|P08514|ITA2B_HUMAN
15 Dec 2023 01:26:52,438 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:52,438 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 01:26:52,625 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:26:52,625 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 01:26:52,670 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:52,670 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:26:52,968 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:26:52,968 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:26:52,972 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:52,972 INFO : Inserting sp|P08590|MYL3_HUMAN
15 Dec 2023 01:26:52,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:52,975 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:26:53,115 INFO : 51% Done
15 Dec 2023 01:26:53,848 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:54,254 DEBUG: Total peptides inserted: 76
15 Dec 2023 01:26:54,254 INFO : Imported 300 peptide groups.
15 Dec 2023 01:26:54,254 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 01:26:54,326 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:54,326 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:26:54,388 INFO : 52% Done
15 Dec 2023 01:26:54,924 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:26:54,924 INFO : Inserting sp|P08709|FA7_HUMAN
15 Dec 2023 01:26:55,031 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:26:55,031 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 01:26:55,083 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:55,083 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:26:55,205 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:26:55,205 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:26:55,209 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:55,209 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 01:26:55,253 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:55,254 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 01:26:55,605 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:26:55,605 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:26:55,630 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:55,630 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:26:55,675 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:26:55,675 INFO : Inserting sp|P09543|CN37_HUMAN
15 Dec 2023 01:26:55,681 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:26:55,681 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 01:26:55,736 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:26:55,736 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:26:55,740 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:55,740 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:26:55,940 INFO : 53% Done
15 Dec 2023 01:26:56,243 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:26:56,243 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:26:56,365 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:26:56,366 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 01:26:56,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:26:56,374 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:26:57,323 INFO : 54% Done
15 Dec 2023 01:26:57,635 DEBUG: Inserted 50 peptides
15 Dec 2023 01:26:58,631 INFO : 55% Done
15 Dec 2023 01:26:58,718 DEBUG: Inserted 100 peptides
15 Dec 2023 01:26:59,072 DEBUG: Total peptides inserted: 121
15 Dec 2023 01:26:59,072 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:26:59,825 INFO : 56% Done
15 Dec 2023 01:27:00,136 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:01,164 INFO : 57% Done
15 Dec 2023 01:27:01,399 DEBUG: Inserted 100 peptides
15 Dec 2023 01:27:01,945 DEBUG: Total peptides inserted: 123
15 Dec 2023 01:27:01,946 INFO : Inserting sp|P0C0S5|H2AZ_HUMAN
15 Dec 2023 01:27:01,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:01,951 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 01:27:01,962 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:01,962 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 01:27:02,038 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:02,038 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 01:27:02,104 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:02,104 INFO : Inserting sp|P0DJI8|SAA1_HUMAN
15 Dec 2023 01:27:02,221 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:02,221 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 01:27:02,361 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:02,361 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:27:02,433 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:02,433 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:27:02,484 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:02,484 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:27:02,675 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:02,675 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:27:02,710 INFO : 58% Done
15 Dec 2023 01:27:02,829 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:02,829 INFO : Inserting sp|P0DPH7|TBA3C_HUMAN
15 Dec 2023 01:27:02,891 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:02,891 INFO : Inserting sp|P0DPH8|TBA3D_HUMAN
15 Dec 2023 01:27:02,951 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:02,951 INFO : Inserting sp|P0DTE7|AMY1B_HUMAN
15 Dec 2023 01:27:03,090 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:03,090 INFO : Inserting sp|P0DTE8|AMY1C_HUMAN
15 Dec 2023 01:27:03,243 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:03,244 INFO : Inserting sp|P0DUB6|AMY1A_HUMAN
15 Dec 2023 01:27:03,436 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:03,436 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 01:27:03,453 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:03,453 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 01:27:03,478 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:03,478 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 01:27:03,549 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:03,549 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:27:03,595 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:03,596 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:27:04,161 INFO : 59% Done
15 Dec 2023 01:27:04,351 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:27:04,351 INFO : Inserting sp|P10645|CMGA_HUMAN
15 Dec 2023 01:27:04,377 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:04,377 INFO : Inserting sp|P10721|KIT_HUMAN
15 Dec 2023 01:27:04,464 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:04,464 INFO : Inserting sp|P10746|HEM4_HUMAN
15 Dec 2023 01:27:04,504 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:04,504 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:27:04,601 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:04,601 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 01:27:04,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:04,611 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:27:04,999 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:27:04,999 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 01:27:05,072 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:05,072 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 01:27:05,075 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:05,075 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:27:05,214 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:05,214 INFO : Inserting sp|P11150|LIPC_HUMAN
15 Dec 2023 01:27:05,232 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:05,232 INFO : Inserting sp|P11166|GTR1_HUMAN
15 Dec 2023 01:27:05,322 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:05,322 INFO : Inserting sp|P11171|EPB41_HUMAN
15 Dec 2023 01:27:05,456 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:05,456 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:27:05,472 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:05,472 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 01:27:05,480 INFO : 60% Done
15 Dec 2023 01:27:05,603 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:05,603 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 01:27:06,476 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:06,586 DEBUG: Total peptides inserted: 56
15 Dec 2023 01:27:06,586 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 01:27:06,627 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:06,627 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:27:06,672 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:06,672 INFO : Inserting sp|P11586|C1TC_HUMAN
15 Dec 2023 01:27:06,699 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:06,700 INFO : Inserting sp|P11597|CETP_HUMAN
15 Dec 2023 01:27:06,758 INFO : 61% Done
15 Dec 2023 01:27:06,773 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:06,773 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 01:27:06,899 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:06,899 INFO : Inserting sp|P11908|PRPS2_HUMAN
15 Dec 2023 01:27:06,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:06,913 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:27:06,917 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:06,917 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:27:07,180 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:27:07,180 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:27:07,913 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:27:07,913 INFO : Inserting sp|P12273|PIP_HUMAN
15 Dec 2023 01:27:07,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:07,935 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:27:07,941 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:07,941 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 01:27:07,982 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:07,982 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:27:08,164 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:27:08,164 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 01:27:08,190 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:08,191 INFO : Inserting sp|P12838|DEF4_HUMAN
15 Dec 2023 01:27:08,195 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:08,195 INFO : Inserting sp|P12882|MYH1_HUMAN
15 Dec 2023 01:27:08,201 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:08,201 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 01:27:08,209 INFO : 62% Done
15 Dec 2023 01:27:08,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:08,292 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 01:27:08,359 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:08,359 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:27:08,488 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:08,488 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:27:08,619 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:08,619 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 01:27:08,711 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:08,711 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:27:09,180 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:27:09,180 INFO : Inserting sp|P13646|K1C13_HUMAN
15 Dec 2023 01:27:09,259 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:09,259 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:27:09,452 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:09,452 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:27:09,750 INFO : 63% Done
15 Dec 2023 01:27:10,090 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:27:10,090 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 01:27:10,203 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:10,203 INFO : Inserting sp|P13727|PRG2_HUMAN
15 Dec 2023 01:27:10,320 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:10,320 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:27:10,579 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:27:10,579 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 01:27:10,637 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:10,637 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 01:27:10,691 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:10,691 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 01:27:10,808 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:10,808 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 01:27:10,852 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:10,852 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:27:10,885 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:10,885 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:27:10,980 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:10,980 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:27:11,070 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:11,071 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 01:27:11,089 INFO : 64% Done
15 Dec 2023 01:27:11,130 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:11,131 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 01:27:11,323 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:11,323 INFO : Inserting sp|P15151|PVR_HUMAN
15 Dec 2023 01:27:11,365 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:11,365 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 01:27:11,704 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:27:11,704 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:27:11,735 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:11,735 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 01:27:11,755 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,755 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 01:27:11,840 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:11,840 INFO : Inserting sp|P15559|NQO1_HUMAN
15 Dec 2023 01:27:11,858 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,858 INFO : Inserting sp|P15814|IGLL1_HUMAN
15 Dec 2023 01:27:11,875 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,875 INFO : Inserting sp|P15924|DESP_HUMAN
15 Dec 2023 01:27:11,879 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:11,879 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:27:11,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,882 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 01:27:11,913 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:11,913 INFO : Imported 400 peptide groups.
15 Dec 2023 01:27:11,913 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:27:11,917 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:11,917 INFO : Inserting sp|P16109|LYAM3_HUMAN
15 Dec 2023 01:27:11,920 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,920 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 01:27:11,940 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:11,940 INFO : Inserting sp|P16157|ANK1_HUMAN
15 Dec 2023 01:27:12,377 INFO : 65% Done
15 Dec 2023 01:27:12,510 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:27:12,510 INFO : Inserting sp|P16452|EPB42_HUMAN
15 Dec 2023 01:27:12,754 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:12,754 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:27:12,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:12,758 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 01:27:12,841 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:12,841 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:27:12,846 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:12,846 INFO : Inserting sp|P17600|SYN1_HUMAN
15 Dec 2023 01:27:12,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:12,850 INFO : Inserting sp|P17655|CAN2_HUMAN
15 Dec 2023 01:27:12,854 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:12,854 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:27:12,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:12,857 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 01:27:12,874 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:12,874 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 01:27:12,986 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:12,986 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 01:27:13,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:13,016 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 01:27:13,142 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:13,142 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 01:27:13,336 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:13,336 INFO : Inserting sp|P18577|RHCE_HUMAN
15 Dec 2023 01:27:13,359 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:13,359 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:27:13,385 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:13,385 INFO : Inserting sp|P19012|K1C15_HUMAN
15 Dec 2023 01:27:13,449 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:13,449 INFO : Inserting sp|P19013|K2C4_HUMAN
15 Dec 2023 01:27:13,505 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:13,505 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 01:27:13,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:13,523 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 01:27:13,538 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:13,538 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 01:27:13,609 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:13,609 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 01:27:13,627 INFO : 66% Done
15 Dec 2023 01:27:13,770 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:13,770 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:27:14,819 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:27:14,820 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:27:14,997 INFO : 67% Done
15 Dec 2023 01:27:15,904 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:15,965 DEBUG: Total peptides inserted: 51
15 Dec 2023 01:27:15,965 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:27:15,997 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:15,997 INFO : Inserting sp|P20020|AT2B1_HUMAN
15 Dec 2023 01:27:16,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:16,025 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:27:16,071 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:16,072 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:27:16,102 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:16,103 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:27:16,108 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:16,108 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 01:27:16,116 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:16,116 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:27:16,626 INFO : 68% Done
15 Dec 2023 01:27:17,172 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:17,284 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:27:17,284 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:27:17,308 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:17,309 INFO : Inserting sp|P20810|ICAL_HUMAN
15 Dec 2023 01:27:17,342 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:17,342 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 01:27:17,561 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:27:17,562 INFO : Inserting sp|P20929|NEBU_HUMAN
15 Dec 2023 01:27:17,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:17,571 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:27:17,612 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:17,612 INFO : Inserting sp|P21108|PRPS3_HUMAN
15 Dec 2023 01:27:17,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:17,626 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:27:17,908 INFO : 69% Done
15 Dec 2023 01:27:17,977 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:27:17,978 INFO : Inserting sp|P21817|RYR1_HUMAN
15 Dec 2023 01:27:17,998 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:17,998 INFO : Inserting sp|P21980|TGM2_HUMAN
15 Dec 2023 01:27:18,011 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:18,011 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 01:27:18,049 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:18,049 INFO : Inserting sp|P22079|PERL_HUMAN
15 Dec 2023 01:27:18,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:18,071 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 01:27:18,361 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:27:18,361 INFO : Inserting sp|P22234|PUR6_HUMAN
15 Dec 2023 01:27:18,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:18,378 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:27:18,444 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:18,444 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:27:18,607 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:18,607 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 01:27:18,667 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:18,667 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:27:18,687 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:18,687 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:27:19,111 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:27:19,111 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 01:27:19,181 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:19,181 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:27:19,232 INFO : 70% Done
15 Dec 2023 01:27:19,349 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:19,349 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 01:27:19,405 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:19,405 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 01:27:19,466 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:19,466 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:27:19,833 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:27:19,833 INFO : Inserting sp|P23276|KELL_HUMAN
15 Dec 2023 01:27:19,913 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:19,913 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:27:19,955 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:19,955 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 01:27:19,977 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:19,977 INFO : Inserting sp|P23469|PTPRE_HUMAN
15 Dec 2023 01:27:20,003 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,003 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 01:27:20,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,024 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:27:20,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,028 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:27:20,051 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:20,051 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:27:20,149 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:20,149 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:27:20,252 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:20,252 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:27:20,264 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:20,264 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 01:27:20,309 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:20,309 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 01:27:20,335 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,335 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 01:27:20,364 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:20,365 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:27:20,773 INFO : 71% Done
15 Dec 2023 01:27:20,790 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:27:20,790 INFO : Inserting sp|P25325|THTM_HUMAN
15 Dec 2023 01:27:20,830 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:20,830 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 01:27:20,853 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,854 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 01:27:20,950 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:20,950 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:27:20,977 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:20,977 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:27:20,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,981 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:27:20,984 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:20,985 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:27:21,146 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:21,146 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 01:27:21,194 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:21,194 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 01:27:21,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:21,216 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 01:27:21,243 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:21,243 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:27:21,248 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:21,248 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:27:21,253 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:21,253 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 01:27:21,648 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:27:21,648 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 01:27:21,756 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:21,756 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:27:22,117 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:27:22,117 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 01:27:22,182 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:22,182 INFO : Inserting sp|P27487|DPP4_HUMAN
15 Dec 2023 01:27:22,288 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:22,288 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:27:22,292 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,293 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:27:22,351 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:22,351 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 01:27:22,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,355 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 01:27:22,412 INFO : 72% Done
15 Dec 2023 01:27:22,570 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:22,570 INFO : Inserting sp|P27930|IL1R2_HUMAN
15 Dec 2023 01:27:22,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,575 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 01:27:22,603 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:22,603 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 01:27:22,625 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,625 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 01:27:22,685 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:22,685 INFO : Inserting sp|P28827|PTPRM_HUMAN
15 Dec 2023 01:27:22,745 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:22,745 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:27:22,750 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,750 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 01:27:22,836 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:22,837 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:27:22,846 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:22,846 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:27:22,893 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:22,893 INFO : Imported 500 peptide groups.
15 Dec 2023 01:27:22,893 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:27:23,450 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:27:23,450 INFO : Inserting sp|P29972|AQP1_HUMAN
15 Dec 2023 01:27:23,456 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:23,456 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:27:23,597 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:23,597 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:27:23,781 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:23,781 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 01:27:23,801 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:23,801 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:27:23,880 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:23,880 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 01:27:23,887 INFO : 73% Done
15 Dec 2023 01:27:23,901 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:23,901 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 01:27:24,038 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:24,038 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 01:27:24,116 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:24,116 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 01:27:24,153 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:24,153 INFO : Inserting sp|P30626|SORCN_HUMAN
15 Dec 2023 01:27:24,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,157 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:27:24,193 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:24,193 INFO : Inserting sp|P31025|LCN1_HUMAN
15 Dec 2023 01:27:24,213 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,213 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:27:24,241 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:24,241 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:27:24,338 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:24,338 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 01:27:24,430 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:24,431 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:27:24,488 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:24,488 INFO : Inserting sp|P31947|1433S_HUMAN
15 Dec 2023 01:27:24,546 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:24,546 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 01:27:24,620 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:24,620 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:27:24,628 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:24,628 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 01:27:24,651 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,651 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:27:24,777 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:24,777 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:27:24,780 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,780 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 01:27:24,783 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,783 INFO : Inserting sp|P33151|CADH5_HUMAN
15 Dec 2023 01:27:24,822 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:24,822 INFO : Inserting sp|P33176|KINH_HUMAN
15 Dec 2023 01:27:24,826 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:24,826 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:27:24,846 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:24,846 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:27:25,018 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:25,018 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 01:27:25,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:25,038 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 01:27:25,096 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:25,096 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 01:27:25,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:25,119 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 01:27:25,196 INFO : 74% Done
15 Dec 2023 01:27:25,261 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:25,261 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:27:25,455 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:27:25,455 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:27:25,534 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:25,534 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:27:26,134 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:26,260 DEBUG: Total peptides inserted: 60
15 Dec 2023 01:27:26,260 INFO : Inserting sp|P35580|MYH10_HUMAN
15 Dec 2023 01:27:26,326 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:26,326 INFO : Inserting sp|P35590|TIE1_HUMAN
15 Dec 2023 01:27:26,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:26,347 INFO : Inserting sp|P35611|ADDA_HUMAN
15 Dec 2023 01:27:26,416 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:26,416 INFO : Inserting sp|P35612|ADDB_HUMAN
15 Dec 2023 01:27:26,529 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:26,529 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 01:27:26,542 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:26,542 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:27:27,163 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:27:27,163 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 01:27:27,413 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:27:27,413 INFO : Inserting sp|P35916|VGFR3_HUMAN
15 Dec 2023 01:27:27,499 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:27,499 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:27:27,601 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:27,601 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:27:27,618 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:27,618 INFO : Inserting sp|P36873|PP1G_HUMAN
15 Dec 2023 01:27:27,627 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:27,627 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:27:27,867 INFO : 75% Done
15 Dec 2023 01:27:28,091 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:27:28,091 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:27:28,251 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:28,251 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 01:27:28,288 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:28,288 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:27:28,436 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:28,436 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 01:27:28,487 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:28,487 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 01:27:28,573 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:28,573 INFO : Inserting sp|P40197|GPV_HUMAN
15 Dec 2023 01:27:28,655 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:28,655 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:27:28,704 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:28,704 INFO : Inserting sp|P41161|ETV5_HUMAN
15 Dec 2023 01:27:28,710 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:28,710 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:27:28,877 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:28,877 INFO : Inserting sp|P42025|ACTY_HUMAN
15 Dec 2023 01:27:28,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:28,882 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:27:28,894 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:28,894 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 01:27:28,985 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:28,985 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 01:27:29,226 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:29,226 INFO : Inserting sp|P43487|RANG_HUMAN
15 Dec 2023 01:27:29,248 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:29,248 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:27:29,402 INFO : 76% Done
15 Dec 2023 01:27:29,924 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:27:29,924 INFO : Inserting sp|P46939|UTRN_HUMAN
15 Dec 2023 01:27:29,928 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:29,928 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:27:29,934 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:29,934 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:27:29,939 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:29,939 INFO : Inserting sp|P48304|REG1B_HUMAN
15 Dec 2023 01:27:29,982 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:29,982 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 01:27:30,016 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:30,016 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 01:27:30,132 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:30,132 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 01:27:30,157 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,157 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:27:30,160 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,160 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 01:27:30,171 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:30,171 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 01:27:30,192 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,192 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 01:27:30,383 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:27:30,383 INFO : Inserting sp|P48729|KC1A_HUMAN
15 Dec 2023 01:27:30,406 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,406 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 01:27:30,586 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:30,586 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 01:27:30,590 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,590 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 01:27:30,625 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:30,626 INFO : Inserting sp|P49327|FAS_HUMAN
15 Dec 2023 01:27:30,667 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:30,667 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:27:30,672 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,672 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 01:27:30,727 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:30,727 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:27:30,780 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:30,780 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 01:27:30,816 INFO : 77% Done
15 Dec 2023 01:27:30,973 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:27:30,973 INFO : Inserting sp|P49789|FHIT_HUMAN
15 Dec 2023 01:27:30,977 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:30,977 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:27:31,082 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:31,082 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 01:27:31,100 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,100 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:27:31,293 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:31,294 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 01:27:31,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,297 INFO : Inserting sp|P50895|BCAM_HUMAN
15 Dec 2023 01:27:31,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:31,320 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 01:27:31,399 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:31,399 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 01:27:31,457 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:31,457 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 01:27:31,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,477 INFO : Inserting sp|P51668|UB2D1_HUMAN
15 Dec 2023 01:27:31,496 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,497 INFO : Inserting sp|P51825|AFF1_HUMAN
15 Dec 2023 01:27:31,500 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,500 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 01:27:31,503 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,503 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:27:31,725 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:31,725 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:27:31,777 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:31,777 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:27:31,830 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:31,830 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:27:31,838 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:31,839 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:27:31,847 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:31,848 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 01:27:31,893 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:31,893 INFO : Imported 600 peptide groups.
15 Dec 2023 01:27:31,893 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 01:27:31,994 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:31,994 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:27:32,056 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:32,056 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 01:27:32,085 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:32,085 INFO : Inserting sp|P53999|TCP4_HUMAN
15 Dec 2023 01:27:32,094 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:32,094 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 01:27:32,109 INFO : 78% Done
15 Dec 2023 01:27:32,153 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:32,153 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 01:27:32,220 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:32,220 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 01:27:32,293 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:32,293 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 01:27:32,392 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:32,392 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 01:27:32,406 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:32,406 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 01:27:32,443 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:32,443 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 01:27:32,482 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:32,483 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 01:27:32,524 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:32,524 INFO : Inserting sp|P55056|APOC4_HUMAN
15 Dec 2023 01:27:32,625 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:32,625 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:27:32,779 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:32,779 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:27:32,945 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:32,945 INFO : Inserting sp|P55212|CASP6_HUMAN
15 Dec 2023 01:27:32,975 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:32,975 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 01:27:32,995 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:32,995 INFO : Inserting sp|P55957|BID_HUMAN
15 Dec 2023 01:27:32,999 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:32,999 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:27:33,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,020 INFO : Inserting sp|P57081|WDR4_HUMAN
15 Dec 2023 01:27:33,042 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,042 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 01:27:33,118 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,118 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:27:33,139 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,139 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:27:33,172 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:33,172 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:27:33,205 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:33,205 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:27:33,312 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:33,312 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:27:33,352 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,352 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:27:33,449 INFO : 79% Done
15 Dec 2023 01:27:33,708 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:27:33,708 INFO : Inserting sp|P60891|PRPS1_HUMAN
15 Dec 2023 01:27:33,727 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,727 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 01:27:33,771 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,771 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 01:27:33,790 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,790 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 01:27:33,822 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:33,822 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:27:33,863 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:33,863 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:27:33,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:33,868 INFO : Inserting sp|P61163|ACTZ_HUMAN
15 Dec 2023 01:27:33,923 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,923 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 01:27:33,959 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,959 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 01:27:33,968 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,968 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 01:27:33,971 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,972 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 01:27:33,995 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:33,995 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:27:34,080 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:34,081 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:27:34,085 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,085 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:27:34,123 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:34,123 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:27:34,133 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:34,133 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 01:27:34,216 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:34,216 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:27:34,272 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:34,272 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:27:34,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,281 INFO : Inserting sp|P62140|PP1B_HUMAN
15 Dec 2023 01:27:34,289 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,289 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 01:27:34,348 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:34,348 INFO : Inserting sp|P62714|PP2AB_HUMAN
15 Dec 2023 01:27:34,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,367 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:27:34,586 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:27:34,586 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:27:34,599 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:34,599 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:27:34,622 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:34,622 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:27:34,683 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:34,683 INFO : Inserting sp|P62834|RAP1A_HUMAN
15 Dec 2023 01:27:34,693 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,693 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 01:27:34,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:34,716 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 01:27:34,870 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:34,870 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 01:27:34,936 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:34,936 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 01:27:34,943 INFO : 80% Done
15 Dec 2023 01:27:35,009 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:35,009 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:27:35,107 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:35,107 INFO : Inserting sp|P63208|SKP1_HUMAN
15 Dec 2023 01:27:35,122 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:35,122 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 01:27:35,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:35,167 INFO : Inserting sp|P63261|ACTG_HUMAN
15 Dec 2023 01:27:35,481 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:27:35,481 INFO : Inserting sp|P63267|ACTH_HUMAN
15 Dec 2023 01:27:35,686 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:35,686 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 01:27:35,700 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:35,700 INFO : Inserting sp|P67936|TPM4_HUMAN
15 Dec 2023 01:27:35,758 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:35,758 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 01:27:35,966 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:27:35,966 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 01:27:35,996 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:35,997 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:27:36,107 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:36,107 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 01:27:36,219 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:36,219 INFO : Inserting sp|P68402|PA1B2_HUMAN
15 Dec 2023 01:27:36,279 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:36,279 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:27:36,287 INFO : 81% Done
15 Dec 2023 01:27:36,789 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:27:36,789 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:27:37,047 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:37,047 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:27:37,296 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:37,296 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:27:37,678 INFO : 82% Done
15 Dec 2023 01:27:37,891 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:27:37,892 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 01:27:37,944 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:37,944 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 01:27:38,057 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:38,057 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 01:27:38,502 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:27:38,502 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:27:38,576 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:38,576 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:27:38,608 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:38,608 INFO : Inserting sp|P81605|DCD_HUMAN
15 Dec 2023 01:27:38,643 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:38,643 INFO : Inserting sp|P98088|MUC5A_HUMAN
15 Dec 2023 01:27:38,652 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:38,652 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:27:38,655 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:38,655 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:27:38,904 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:27:38,904 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 01:27:38,973 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:38,973 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:27:38,998 INFO : 83% Done
15 Dec 2023 01:27:39,021 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:39,021 INFO : Inserting sp|Q01484|ANK2_HUMAN
15 Dec 2023 01:27:39,111 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:39,111 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:27:39,144 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:39,144 INFO : Inserting sp|Q02094|RHAG_HUMAN
15 Dec 2023 01:27:39,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:39,162 INFO : Inserting sp|Q02161|RHD_HUMAN
15 Dec 2023 01:27:39,185 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:39,185 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 01:27:39,232 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:39,232 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:27:39,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:39,236 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:27:39,477 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:27:39,477 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:27:39,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:39,480 INFO : Inserting sp|Q04695|K1C17_HUMAN
15 Dec 2023 01:27:39,528 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:39,528 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 01:27:39,701 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:39,701 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 01:27:39,753 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:39,753 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 01:27:39,794 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:39,794 INFO : Inserting sp|Q04941|PLP2_HUMAN
15 Dec 2023 01:27:39,802 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:39,802 INFO : Inserting sp|Q05682|CALD1_HUMAN
15 Dec 2023 01:27:39,835 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:39,836 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:27:40,304 INFO : 84% Done
15 Dec 2023 01:27:40,466 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:27:40,466 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:27:40,514 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:40,514 INFO : Imported 700 peptide groups.
15 Dec 2023 01:27:40,514 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 01:27:40,570 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:40,570 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 01:27:40,787 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:27:40,787 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:27:41,204 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:27:41,204 INFO : Inserting sp|Q08397|LOXL1_HUMAN
15 Dec 2023 01:27:41,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,220 INFO : Inserting sp|Q08830|FGL1_HUMAN
15 Dec 2023 01:27:41,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,225 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:27:41,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,228 INFO : Inserting sp|Q10472|GALT1_HUMAN
15 Dec 2023 01:27:41,232 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,232 INFO : Inserting sp|Q10570|CPSF1_HUMAN
15 Dec 2023 01:27:41,260 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,260 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 01:27:41,329 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:41,329 INFO : Inserting sp|Q12800|TFCP2_HUMAN
15 Dec 2023 01:27:41,333 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,333 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:27:41,450 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:41,451 INFO : Inserting sp|Q12840|KIF5A_HUMAN
15 Dec 2023 01:27:41,456 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,456 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:27:41,461 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:41,461 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 01:27:41,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:41,499 INFO : Inserting sp|Q12884|SEPR_HUMAN
15 Dec 2023 01:27:41,542 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:41,542 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 01:27:41,604 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:41,604 INFO : Inserting sp|Q12955|ANK3_HUMAN
15 Dec 2023 01:27:41,708 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:41,708 INFO : Inserting sp|Q12986|NFX1_HUMAN
15 Dec 2023 01:27:41,712 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,712 INFO : Inserting sp|Q13017|RHG05_HUMAN
15 Dec 2023 01:27:41,716 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,716 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 01:27:41,781 INFO : 85% Done
15 Dec 2023 01:27:41,816 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:41,817 INFO : Inserting sp|Q13099|IFT88_HUMAN
15 Dec 2023 01:27:41,820 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,820 INFO : Inserting sp|Q13113|PDZ1I_HUMAN
15 Dec 2023 01:27:41,824 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,824 INFO : Inserting sp|Q13188|STK3_HUMAN
15 Dec 2023 01:27:41,848 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,848 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 01:27:41,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,876 INFO : Inserting sp|Q13201|MMRN1_HUMAN
15 Dec 2023 01:27:41,939 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:41,939 INFO : Inserting sp|Q13207|TBX2_HUMAN
15 Dec 2023 01:27:41,950 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:41,950 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 01:27:42,168 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:42,168 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:27:42,208 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,208 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 01:27:42,232 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,232 INFO : Inserting sp|Q13395|TARB1_HUMAN
15 Dec 2023 01:27:42,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,236 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 01:27:42,273 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,273 INFO : Inserting sp|Q13418|ILK_HUMAN
15 Dec 2023 01:27:42,295 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,295 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 01:27:42,320 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,320 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:27:42,325 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,325 INFO : Inserting sp|Q13515|BFSP2_HUMAN
15 Dec 2023 01:27:42,329 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,329 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:27:42,406 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,406 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 01:27:42,495 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,495 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:27:42,690 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:27:42,691 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 01:27:42,744 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,744 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:27:42,749 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,749 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:27:42,771 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,771 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 01:27:42,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,779 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 01:27:42,788 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:42,788 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:27:42,906 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:42,906 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:27:42,954 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:42,955 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:27:43,272 INFO : 86% Done
15 Dec 2023 01:27:43,289 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:27:43,290 INFO : Inserting sp|Q14532|K1H2_HUMAN
15 Dec 2023 01:27:43,312 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:43,312 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:27:44,591 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:44,739 DEBUG: Total peptides inserted: 57
15 Dec 2023 01:27:44,740 INFO : Inserting sp|Q14677|EPN4_HUMAN
15 Dec 2023 01:27:44,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,744 INFO : Inserting sp|Q14678|KANK1_HUMAN
15 Dec 2023 01:27:44,761 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,761 INFO : Inserting sp|Q14679|TTLL4_HUMAN
15 Dec 2023 01:27:44,775 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,776 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:27:44,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,780 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 01:27:44,819 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:44,819 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:27:44,822 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,822 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:27:44,848 INFO : 87% Done
15 Dec 2023 01:27:44,866 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:44,866 INFO : Inserting sp|Q15029|U5S1_HUMAN
15 Dec 2023 01:27:44,879 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,879 INFO : Inserting sp|Q15061|WDR43_HUMAN
15 Dec 2023 01:27:44,899 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:44,899 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 01:27:44,929 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:44,929 INFO : Inserting sp|Q15102|PA1B3_HUMAN
15 Dec 2023 01:27:44,978 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:44,978 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:27:45,075 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:45,075 INFO : Inserting sp|Q15166|PON3_HUMAN
15 Dec 2023 01:27:45,140 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:45,140 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 01:27:45,148 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,148 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 01:27:45,210 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:45,211 INFO : Inserting sp|Q15323|K1H1_HUMAN
15 Dec 2023 01:27:45,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,230 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 01:27:45,312 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:45,312 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:27:45,448 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:45,448 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:27:45,464 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:45,464 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 01:27:45,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,477 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:27:45,481 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,481 INFO : Inserting sp|Q15843|NEDD8_HUMAN
15 Dec 2023 01:27:45,505 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,505 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 01:27:45,579 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:45,579 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:27:45,597 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:45,597 INFO : Inserting sp|Q16394|EXT1_HUMAN
15 Dec 2023 01:27:45,619 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:45,619 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 01:27:45,650 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:45,650 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 01:27:45,931 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:27:45,931 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 01:27:46,052 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:46,052 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 01:27:46,118 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,118 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:27:46,126 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,126 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:27:46,153 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,154 INFO : Inserting sp|Q16795|NDUA9_HUMAN
15 Dec 2023 01:27:46,158 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,158 INFO : Inserting sp|Q16850|CP51A_HUMAN
15 Dec 2023 01:27:46,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,163 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:27:46,206 INFO : 88% Done
15 Dec 2023 01:27:46,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,221 INFO : Inserting sp|Q16853|AOC3_HUMAN
15 Dec 2023 01:27:46,276 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:46,276 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 01:27:46,328 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:46,328 INFO : Inserting sp|Q4G0S4|C27C1_HUMAN
15 Dec 2023 01:27:46,338 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,338 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:27:46,360 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,360 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:27:46,392 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,393 INFO : Inserting sp|Q5JRX3|PREP_HUMAN
15 Dec 2023 01:27:46,413 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,413 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:27:46,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,433 INFO : Inserting sp|Q5T3U5|MRP7_HUMAN
15 Dec 2023 01:27:46,454 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,454 INFO : Inserting sp|Q5T7B8|KIF24_HUMAN
15 Dec 2023 01:27:46,476 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,477 INFO : Inserting sp|Q5THR3|EFCB6_HUMAN
15 Dec 2023 01:27:46,494 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,495 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:27:46,497 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,497 INFO : Inserting sp|Q5VYS8|TUT7_HUMAN
15 Dec 2023 01:27:46,517 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,517 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 01:27:46,535 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,535 INFO : Inserting sp|Q5XKL5|BTBD8_HUMAN
15 Dec 2023 01:27:46,539 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,539 INFO : Inserting sp|Q5XPI4|RN123_HUMAN
15 Dec 2023 01:27:46,543 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,543 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:27:46,607 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:46,607 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 01:27:46,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,611 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:27:46,616 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,616 INFO : Imported 800 peptide groups.
15 Dec 2023 01:27:46,616 INFO : Inserting sp|Q6GTS8|P20D1_HUMAN
15 Dec 2023 01:27:46,654 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,654 INFO : Inserting sp|Q6ICL3|TNG2_HUMAN
15 Dec 2023 01:27:46,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,676 INFO : Inserting sp|Q6KC79|NIPBL_HUMAN
15 Dec 2023 01:27:46,712 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:46,712 INFO : Inserting sp|Q6P988|NOTUM_HUMAN
15 Dec 2023 01:27:46,732 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,732 INFO : Inserting sp|Q6PEY2|TBA3E_HUMAN
15 Dec 2023 01:27:46,775 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:46,775 INFO : Inserting sp|Q6UWE0|LRSM1_HUMAN
15 Dec 2023 01:27:46,802 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,802 INFO : Inserting sp|Q6UWR7|ENPP6_HUMAN
15 Dec 2023 01:27:46,806 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,806 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:27:46,809 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,809 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 01:27:46,853 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:46,853 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 01:27:46,907 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:46,907 INFO : Inserting sp|Q6UY14|ATL4_HUMAN
15 Dec 2023 01:27:46,926 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:46,926 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:27:46,971 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:46,971 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:27:47,048 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:47,048 INFO : Inserting sp|Q71U36|TBA1A_HUMAN
15 Dec 2023 01:27:47,135 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:47,135 INFO : Inserting sp|Q71UI9|H2AV_HUMAN
15 Dec 2023 01:27:47,139 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,139 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 01:27:47,276 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:47,276 INFO : Inserting sp|Q76N89|HECW1_HUMAN
15 Dec 2023 01:27:47,301 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:47,301 INFO : Inserting sp|Q7KZF4|SND1_HUMAN
15 Dec 2023 01:27:47,306 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,306 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 01:27:47,325 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,325 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 01:27:47,333 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:47,333 INFO : Inserting sp|Q7Z2Y5|NRK_HUMAN
15 Dec 2023 01:27:47,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,347 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 01:27:47,367 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,367 INFO : Inserting sp|Q7Z4W1|DCXR_HUMAN
15 Dec 2023 01:27:47,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,371 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 01:27:47,400 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:47,401 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 01:27:47,628 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:27:47,629 INFO : Inserting sp|Q86SG5|S1A7A_HUMAN
15 Dec 2023 01:27:47,635 INFO : 89% Done
15 Dec 2023 01:27:47,657 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:47,657 INFO : Inserting sp|Q86SQ4|AGRG6_HUMAN
15 Dec 2023 01:27:47,683 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,683 INFO : Inserting sp|Q86UN3|R4RL2_HUMAN
15 Dec 2023 01:27:47,710 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,711 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:27:47,750 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:47,750 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:27:47,905 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:47,905 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 01:27:47,963 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:47,964 INFO : Inserting sp|Q86W74|ANR46_HUMAN
15 Dec 2023 01:27:47,987 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:47,988 INFO : Inserting sp|Q86WI1|PKHL1_HUMAN
15 Dec 2023 01:27:48,048 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:48,048 INFO : Inserting sp|Q86YR7|MF2L2_HUMAN
15 Dec 2023 01:27:48,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,052 INFO : Inserting sp|Q86Z02|HIPK1_HUMAN
15 Dec 2023 01:27:48,072 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,072 INFO : Inserting sp|Q8IUC8|GLT13_HUMAN
15 Dec 2023 01:27:48,075 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,076 INFO : Inserting sp|Q8IUI8|CRLF3_HUMAN
15 Dec 2023 01:27:48,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,084 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:27:48,091 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,091 INFO : Inserting sp|Q8IWC1|MA7D3_HUMAN
15 Dec 2023 01:27:48,100 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,100 INFO : Inserting sp|Q8IWV2|CNTN4_HUMAN
15 Dec 2023 01:27:48,121 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,121 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 01:27:48,150 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,151 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:27:48,154 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,154 INFO : Inserting sp|Q8IZ52|CHSS2_HUMAN
15 Dec 2023 01:27:48,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,163 INFO : Inserting sp|Q8IZD2|KMT2E_HUMAN
15 Dec 2023 01:27:48,196 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,197 INFO : Inserting sp|Q8IZF0|NALCN_HUMAN
15 Dec 2023 01:27:48,244 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:48,244 INFO : Inserting sp|Q8N257|H2B3B_HUMAN
15 Dec 2023 01:27:48,264 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,264 INFO : Inserting sp|Q8N3Y3|LARG2_HUMAN
15 Dec 2023 01:27:48,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,287 INFO : Inserting sp|Q8N4C8|MINK1_HUMAN
15 Dec 2023 01:27:48,301 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,301 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:27:48,363 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:48,364 INFO : Inserting sp|Q8N752|KC1AL_HUMAN
15 Dec 2023 01:27:48,384 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,384 INFO : Inserting sp|Q8NBP7|PCSK9_HUMAN
15 Dec 2023 01:27:48,405 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,405 INFO : Inserting sp|Q8NC01|CLC1A_HUMAN
15 Dec 2023 01:27:48,423 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,423 INFO : Inserting sp|Q8NE71|ABCF1_HUMAN
15 Dec 2023 01:27:48,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,427 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 01:27:48,529 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:48,529 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 01:27:48,547 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,547 INFO : Inserting sp|Q8TD57|DYH3_HUMAN
15 Dec 2023 01:27:48,550 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,550 INFO : Inserting sp|Q8TDD5|MCLN3_HUMAN
15 Dec 2023 01:27:48,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,572 INFO : Inserting sp|Q8TE73|DYH5_HUMAN
15 Dec 2023 01:27:48,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,575 INFO : Inserting sp|Q8TF40|FNIP1_HUMAN
15 Dec 2023 01:27:48,579 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,579 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 01:27:48,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,593 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 01:27:48,616 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:48,616 INFO : Inserting sp|Q8WWI1|LMO7_HUMAN
15 Dec 2023 01:27:48,631 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,632 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 01:27:48,808 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:48,808 INFO : Inserting sp|Q8WZ75|ROBO4_HUMAN
15 Dec 2023 01:27:48,823 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,823 INFO : Inserting sp|Q92496|FHR4_HUMAN
15 Dec 2023 01:27:48,913 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:48,913 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:27:48,933 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,933 INFO : Inserting sp|Q92616|GCN1_HUMAN
15 Dec 2023 01:27:48,937 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,937 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:27:48,942 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,943 INFO : Inserting sp|Q92777|SYN2_HUMAN
15 Dec 2023 01:27:48,946 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:48,946 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:27:49,073 INFO : 90% Done
15 Dec 2023 01:27:49,087 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:49,087 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:27:49,139 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:49,139 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 01:27:49,202 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:49,202 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:27:49,228 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,228 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:27:49,434 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:27:49,434 INFO : Inserting sp|Q93063|EXT2_HUMAN
15 Dec 2023 01:27:49,506 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:49,506 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 01:27:49,514 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:49,514 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:27:49,535 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:49,535 INFO : Inserting sp|Q93084|AT2A3_HUMAN
15 Dec 2023 01:27:49,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,538 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:27:49,561 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,561 INFO : Inserting sp|Q93099|HGD_HUMAN
15 Dec 2023 01:27:49,566 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,566 INFO : Inserting sp|Q969G2|LHX4_HUMAN
15 Dec 2023 01:27:49,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,571 INFO : Inserting sp|Q96AC1|FERM2_HUMAN
15 Dec 2023 01:27:49,575 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,575 INFO : Inserting sp|Q96BY2|MOAP1_HUMAN
15 Dec 2023 01:27:49,579 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,579 INFO : Inserting sp|Q96C24|SYTL4_HUMAN
15 Dec 2023 01:27:49,630 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:49,630 INFO : Inserting sp|Q96DR5|BPIA2_HUMAN
15 Dec 2023 01:27:49,657 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,657 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 01:27:49,683 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:49,683 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 01:27:49,701 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,701 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:27:49,705 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,705 INFO : Inserting sp|Q96HR3|MED30_HUMAN
15 Dec 2023 01:27:49,725 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,725 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 01:27:49,747 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:49,747 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 01:27:50,065 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:27:50,065 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 01:27:50,075 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:50,075 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:27:50,390 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:27:50,390 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:27:50,607 INFO : 91% Done
15 Dec 2023 01:27:51,018 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:27:51,019 INFO : Inserting sp|Q96Q15|SMG1_HUMAN
15 Dec 2023 01:27:51,054 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,054 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:27:51,058 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,059 INFO : Inserting sp|Q96RT1|ERBIN_HUMAN
15 Dec 2023 01:27:51,062 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,062 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:27:51,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,084 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 01:27:51,145 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:51,145 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 01:27:51,179 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:51,179 INFO : Imported 900 peptide groups.
15 Dec 2023 01:27:51,180 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:27:51,183 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,183 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 01:27:51,191 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,192 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 01:27:51,195 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,195 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 01:27:51,209 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,209 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:27:51,235 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,235 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 01:27:51,244 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:51,244 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:27:51,269 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,270 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 01:27:51,290 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,290 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 01:27:51,293 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,293 INFO : Inserting sp|Q9BR76|COR1B_HUMAN
15 Dec 2023 01:27:51,298 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,298 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:27:51,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,302 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 01:27:51,354 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,354 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 01:27:51,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,372 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:27:51,468 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:51,468 INFO : Inserting sp|Q9BUZ4|TRAF4_HUMAN
15 Dec 2023 01:27:51,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,479 INFO : Inserting sp|Q9BWD1|THIC_HUMAN
15 Dec 2023 01:27:51,516 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,516 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 01:27:51,614 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:51,614 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:27:51,618 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,618 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 01:27:51,650 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:51,650 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:27:51,654 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,654 INFO : Inserting sp|Q9BYE9|CDHR2_HUMAN
15 Dec 2023 01:27:51,657 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,657 INFO : Inserting sp|Q9BYV1|AGT2_HUMAN
15 Dec 2023 01:27:51,665 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,665 INFO : Inserting sp|Q9BYX2|TBD2A_HUMAN
15 Dec 2023 01:27:51,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,669 INFO : Inserting sp|Q9C0C9|UBE2O_HUMAN
15 Dec 2023 01:27:51,755 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:51,755 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 01:27:51,782 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,782 INFO : Inserting sp|Q9GZV4|IF5A2_HUMAN
15 Dec 2023 01:27:51,821 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,821 INFO : Inserting sp|Q9GZZ8|LACRT_HUMAN
15 Dec 2023 01:27:51,835 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,835 INFO : Inserting sp|Q9H254|SPTN4_HUMAN
15 Dec 2023 01:27:51,866 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:51,866 INFO : Inserting sp|Q9H269|VPS16_HUMAN
15 Dec 2023 01:27:51,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,885 INFO : Inserting sp|Q9H3K6|BOLA2_HUMAN
15 Dec 2023 01:27:51,913 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,913 INFO : Inserting sp|Q9H3R0|KDM4C_HUMAN
15 Dec 2023 01:27:51,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,917 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:27:51,920 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,920 INFO : Inserting sp|Q9H479|FN3K_HUMAN
15 Dec 2023 01:27:51,939 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:51,939 INFO : Inserting sp|Q9H4B7|TBB1_HUMAN
15 Dec 2023 01:27:52,049 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:52,049 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 01:27:52,056 INFO : 92% Done
15 Dec 2023 01:27:52,118 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:52,118 INFO : Inserting sp|Q9HA38|ZMAT3_HUMAN
15 Dec 2023 01:27:52,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,138 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:27:52,142 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,142 INFO : Inserting sp|Q9HBI0|PARVG_HUMAN
15 Dec 2023 01:27:52,147 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,147 INFO : Inserting sp|Q9HBI1|PARVB_HUMAN
15 Dec 2023 01:27:52,164 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,164 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 01:27:52,183 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,183 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 01:27:52,203 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,203 INFO : Inserting sp|Q9NPA0|EMC7_HUMAN
15 Dec 2023 01:27:52,217 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,217 INFO : Inserting sp|Q9NPH3|IL1AP_HUMAN
15 Dec 2023 01:27:52,253 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:52,253 INFO : Inserting sp|Q9NPR2|SEM4B_HUMAN
15 Dec 2023 01:27:52,261 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,261 INFO : Inserting sp|Q9NQH7|XPP3_HUMAN
15 Dec 2023 01:27:52,285 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,285 INFO : Inserting sp|Q9NQW1|SC31B_HUMAN
15 Dec 2023 01:27:52,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,288 INFO : Inserting sp|Q9NQX7|ITM2C_HUMAN
15 Dec 2023 01:27:52,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,291 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 01:27:52,308 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,308 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 01:27:52,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,331 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 01:27:52,386 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:52,386 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:27:52,389 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,389 INFO : Inserting sp|Q9NVD7|PARVA_HUMAN
15 Dec 2023 01:27:52,410 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,410 INFO : Inserting sp|Q9NWF9|RN216_HUMAN
15 Dec 2023 01:27:52,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,414 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 01:27:52,443 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,443 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 01:27:52,447 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,447 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:27:52,510 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:52,510 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 01:27:52,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,531 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:27:52,678 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:52,678 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 01:27:52,763 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:52,763 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:27:52,800 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:52,800 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 01:27:52,817 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,817 INFO : Inserting sp|Q9UBW5|BIN2_HUMAN
15 Dec 2023 01:27:52,856 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:52,856 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 01:27:52,876 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,876 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 01:27:52,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:52,897 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 01:27:53,029 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:27:53,029 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 01:27:53,265 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:27:53,265 INFO : Inserting sp|Q9UIA9|XPO7_HUMAN
15 Dec 2023 01:27:53,286 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,286 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 01:27:53,307 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,307 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 01:27:53,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,323 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:27:53,457 INFO : 93% Done
15 Dec 2023 01:27:53,588 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:53,588 INFO : Inserting sp|Q9UKE5|TNIK_HUMAN
15 Dec 2023 01:27:53,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,604 INFO : Inserting sp|Q9UKU6|TRHDE_HUMAN
15 Dec 2023 01:27:53,739 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:53,739 INFO : Inserting sp|Q9UKX2|MYH2_HUMAN
15 Dec 2023 01:27:53,744 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:53,744 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 01:27:53,789 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:53,790 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 01:27:53,810 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,810 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:27:53,837 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:53,837 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:27:53,841 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,841 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:27:53,846 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,846 INFO : Inserting sp|Q9UNM6|PSD13_HUMAN
15 Dec 2023 01:27:53,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:53,850 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 01:27:53,957 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:53,957 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 01:27:54,038 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:54,038 INFO : Inserting sp|Q9UNZ2|NSF1C_HUMAN
15 Dec 2023 01:27:54,081 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:54,082 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:27:54,175 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:27:54,175 INFO : Inserting sp|Q9UQB8|BAIP2_HUMAN
15 Dec 2023 01:27:54,202 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,202 INFO : Inserting sp|Q9UQE7|SMC3_HUMAN
15 Dec 2023 01:27:54,226 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,226 INFO : Inserting sp|Q9Y262|EIF3L_HUMAN
15 Dec 2023 01:27:54,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,231 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 01:27:54,254 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,254 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:27:54,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,259 INFO : Inserting sp|Q9Y2G5|OFUT2_HUMAN
15 Dec 2023 01:27:54,263 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,263 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 01:27:54,316 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:54,316 INFO : Inserting sp|Q9Y2X8|UB2D4_HUMAN
15 Dec 2023 01:27:54,339 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:54,339 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:27:54,927 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:27:54,927 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 01:27:54,962 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:54,962 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 01:27:55,027 INFO : 94% Done
15 Dec 2023 01:27:55,077 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:55,077 INFO : Inserting sp|Q9Y547|IFT25_HUMAN
15 Dec 2023 01:27:55,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:55,081 INFO : Inserting sp|Q9Y5C1|ANGL3_HUMAN
15 Dec 2023 01:27:55,107 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:55,107 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:27:55,221 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:55,221 INFO : Inserting sp|Q9Y623|MYH4_HUMAN
15 Dec 2023 01:27:55,226 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:55,226 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 01:27:55,250 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:55,250 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:27:55,963 DEBUG: Inserted 50 peptides
15 Dec 2023 01:27:56,110 DEBUG: Total peptides inserted: 56
15 Dec 2023 01:27:56,110 INFO : Imported 1000 peptide groups.
15 Dec 2023 01:27:56,110 INFO : Inserting sp|A0A075B6Q5|HV364_HUMAN
15 Dec 2023 01:27:56,167 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:56,167 INFO : Inserting sp|A0A075B6R2|HV404_HUMAN
15 Dec 2023 01:27:56,204 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,204 INFO : Inserting sp|A0A087WSY4|HV432_HUMAN
15 Dec 2023 01:27:56,240 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,240 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 01:27:56,287 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:56,287 INFO : Inserting sp|A0A0B4J1V2|HV226_HUMAN
15 Dec 2023 01:27:56,327 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,327 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 01:27:56,361 INFO : 95% Done
15 Dec 2023 01:27:56,406 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:56,406 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 01:27:56,475 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:56,475 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 01:27:56,532 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:56,532 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 01:27:56,558 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,558 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 01:27:56,618 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:56,618 INFO : Inserting sp|A0A0C4DH32|HV320_HUMAN
15 Dec 2023 01:27:56,688 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:56,688 INFO : Inserting sp|A0A0C4DH33|HV124_HUMAN
15 Dec 2023 01:27:56,722 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,722 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 01:27:56,756 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:56,756 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 01:27:56,806 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:56,806 INFO : Inserting sp|A0A0J9YXX1|HV5X1_HUMAN
15 Dec 2023 01:27:56,843 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:56,843 INFO : Inserting sp|A0A8I5KQE6|RPSA2_HUMAN
15 Dec 2023 01:27:56,846 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:56,846 INFO : Inserting sp|A0AVI2|FR1L5_HUMAN
15 Dec 2023 01:27:56,850 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:56,850 INFO : Inserting sp|A5D6W6|FITM1_HUMAN
15 Dec 2023 01:27:56,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:56,872 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:27:57,092 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:57,092 INFO : Inserting sp|O00634|NET3_HUMAN
15 Dec 2023 01:27:57,098 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,098 INFO : Inserting sp|O76009|KT33A_HUMAN
15 Dec 2023 01:27:57,118 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,118 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:27:57,123 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,123 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:27:57,128 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,128 INFO : Inserting sp|O95757|HS74L_HUMAN
15 Dec 2023 01:27:57,166 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,167 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 01:27:57,259 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:27:57,260 INFO : Inserting sp|P01601|KVD16_HUMAN
15 Dec 2023 01:27:57,286 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,286 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 01:27:57,345 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:57,345 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 01:27:57,396 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,396 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 01:27:57,452 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,453 INFO : Inserting sp|P01714|LV319_HUMAN
15 Dec 2023 01:27:57,462 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,462 INFO : Inserting sp|P01718|LV327_HUMAN
15 Dec 2023 01:27:57,520 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,520 INFO : Inserting sp|P04211|LV743_HUMAN
15 Dec 2023 01:27:57,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,538 INFO : Inserting sp|P04430|KV116_HUMAN
15 Dec 2023 01:27:57,589 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,590 INFO : Inserting sp|P04432|KVD39_HUMAN
15 Dec 2023 01:27:57,665 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:57,665 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 01:27:57,738 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:57,738 INFO : Inserting sp|P07311|ACYP1_HUMAN
15 Dec 2023 01:27:57,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:57,757 INFO : Inserting sp|P09105|HBAT_HUMAN
15 Dec 2023 01:27:57,811 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:57,811 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:27:57,836 INFO : 96% Done
15 Dec 2023 01:27:58,199 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:27:58,199 INFO : Inserting sp|P0DP01|HV108_HUMAN
15 Dec 2023 01:27:58,224 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:58,224 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 01:27:58,325 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:27:58,326 INFO : Inserting sp|P29762|RABP1_HUMAN
15 Dec 2023 01:27:58,334 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,334 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 01:27:58,452 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:27:58,452 INFO : Inserting sp|P47972|NPTX2_HUMAN
15 Dec 2023 01:27:58,466 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,466 INFO : Inserting sp|P49406|RM19_HUMAN
15 Dec 2023 01:27:58,488 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,488 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 01:27:58,531 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:58,531 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 01:27:58,560 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:58,560 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 01:27:58,715 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:27:58,715 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 01:27:58,728 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,728 INFO : Inserting sp|Q6B0K9|HBM_HUMAN
15 Dec 2023 01:27:58,752 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,753 INFO : Inserting sp|Q6S8J3|POTEE_HUMAN
15 Dec 2023 01:27:58,963 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:27:58,963 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:27:58,967 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,967 INFO : Inserting sp|Q6V1P9|PCD23_HUMAN
15 Dec 2023 01:27:58,970 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,970 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 01:27:58,973 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:58,973 INFO : Inserting sp|Q96DA0|ZG16B_HUMAN
15 Dec 2023 01:27:59,011 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,011 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 01:27:59,018 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:59,018 INFO : Inserting sp|Q9BUN1|MENT_HUMAN
15 Dec 2023 01:27:59,066 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:59,066 INFO : Inserting sp|Q9BYX7|ACTBM_HUMAN
15 Dec 2023 01:27:59,164 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:27:59,164 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 01:27:59,202 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,202 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:27:59,206 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:59,207 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:27:59,210 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,210 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 01:27:59,217 INFO : 97% Done
15 Dec 2023 01:27:59,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,246 INFO : Inserting sp|Q9NW68|BSDC1_HUMAN
15 Dec 2023 01:27:59,267 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,267 INFO : Inserting sp|A0A075B6H9|LV469_HUMAN
15 Dec 2023 01:27:59,304 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,304 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 01:27:59,340 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,341 INFO : Inserting sp|A0A075B6I9|LV746_HUMAN
15 Dec 2023 01:27:59,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,356 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 01:27:59,411 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,411 INFO : Inserting sp|A0A075B6N3|TVBX1_HUMAN
15 Dec 2023 01:27:59,429 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,430 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:27:59,492 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,492 INFO : Inserting sp|A0A075B6S9|KV137_HUMAN
15 Dec 2023 01:27:59,529 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,529 INFO : Inserting sp|A0A087WSX0|LV545_HUMAN
15 Dec 2023 01:27:59,546 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,546 INFO : Inserting sp|A0A087WSY6|KVD15_HUMAN
15 Dec 2023 01:27:59,582 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,582 INFO : Inserting sp|A0A087WSZ0|KVD08_HUMAN
15 Dec 2023 01:27:59,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,601 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 01:27:59,650 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:59,650 INFO : Inserting sp|A0A0A0MT36|KVD21_HUMAN
15 Dec 2023 01:27:59,666 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,666 INFO : Inserting sp|A0A0B4J1U3|LV136_HUMAN
15 Dec 2023 01:27:59,700 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,700 INFO : Inserting sp|A0A0B4J1Y8|LV949_HUMAN
15 Dec 2023 01:27:59,727 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,727 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 01:27:59,760 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,760 INFO : Inserting sp|A0A0C4DH26|KVD41_HUMAN
15 Dec 2023 01:27:59,777 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:27:59,777 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 01:27:59,843 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,843 INFO : Inserting sp|A0A0C4DH69|KV109_HUMAN
15 Dec 2023 01:27:59,911 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:27:59,911 INFO : Inserting sp|A0A0C4DH73|KV112_HUMAN
15 Dec 2023 01:27:59,987 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:27:59,987 INFO : Inserting sp|A6NEC2|PSAL_HUMAN
15 Dec 2023 01:28:00,007 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,007 INFO : Inserting sp|A6NES4|MRO2A_HUMAN
15 Dec 2023 01:28:00,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,031 INFO : Inserting sp|A6NIZ1|RP1BL_HUMAN
15 Dec 2023 01:28:00,041 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,041 INFO : Inserting sp|B1AJZ9|FHAD1_HUMAN
15 Dec 2023 01:28:00,051 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,051 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:28:00,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,057 INFO : Inserting sp|O43361|ZN749_HUMAN
15 Dec 2023 01:28:00,083 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,083 INFO : Inserting sp|O60361|NDK8_HUMAN
15 Dec 2023 01:28:00,128 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:00,129 INFO : Inserting sp|P0CG38|POTEI_HUMAN
15 Dec 2023 01:28:00,270 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:28:00,271 INFO : Inserting sp|P0CG39|POTEJ_HUMAN
15 Dec 2023 01:28:00,393 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:28:00,393 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 01:28:00,535 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:28:00,535 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 01:28:00,548 INFO : 98% Done
15 Dec 2023 01:28:00,715 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:28:00,715 INFO : Inserting sp|P0DSN7|KVD37_HUMAN
15 Dec 2023 01:28:00,758 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:00,758 INFO : Inserting sp|Q32P51|RA1L2_HUMAN
15 Dec 2023 01:28:00,766 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,766 INFO : Inserting sp|Q3LI61|KR202_HUMAN
15 Dec 2023 01:28:00,777 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:00,777 INFO : Inserting sp|Q58FF6|H90B4_HUMAN
15 Dec 2023 01:28:00,841 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:28:00,841 INFO : Inserting sp|Q5T9S5|CCD18_HUMAN
15 Dec 2023 01:28:00,865 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,865 INFO : Inserting sp|Q6IS14|IF5AL_HUMAN
15 Dec 2023 01:28:00,908 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,908 INFO : Inserting sp|Q6P3R8|NEK5_HUMAN
15 Dec 2023 01:28:00,954 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:00,954 INFO : Inserting sp|Q6TFL3|CC171_HUMAN
15 Dec 2023 01:28:00,958 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,958 INFO : Imported 1100 peptide groups.
15 Dec 2023 01:28:00,958 INFO : Inserting sp|Q9BWW9|APOL5_HUMAN
15 Dec 2023 01:28:00,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,962 INFO : Inserting sp|Q9H0R4|HDHD2_HUMAN
15 Dec 2023 01:28:00,986 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:00,987 INFO : Inserting sp|Q9H6N6|MYH16_HUMAN
15 Dec 2023 01:28:00,991 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:00,991 INFO : Inserting sp|Q9P1Z9|CC180_HUMAN
15 Dec 2023 01:28:01,011 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,011 INFO : Inserting sp|Q9UJC5|SH3L2_HUMAN
15 Dec 2023 01:28:01,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,031 INFO : Inserting sp|Q9Y2H5|PKHA6_HUMAN
15 Dec 2023 01:28:01,046 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,046 INFO : Inserting sp|A0A3B3IRV3|MCTS2_HUMAN
15 Dec 2023 01:28:01,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,065 INFO : Inserting sp|A2RUQ5|CQ102_HUMAN
15 Dec 2023 01:28:01,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,074 INFO : Inserting sp|Q5VSP4|LC1L1_HUMAN
15 Dec 2023 01:28:01,094 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,094 INFO : Inserting sp|Q6ZUS5|CC121_HUMAN
15 Dec 2023 01:28:01,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,119 INFO : Inserting sp|Q86U17|SPA11_HUMAN
15 Dec 2023 01:28:01,225 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:28:01,225 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 01:28:01,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:28:01,246 INFO : Inserting sp|Q86XI8|ZSWM9_HUMAN
15 Dec 2023 01:28:01,251 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,251 INFO : Inserting sp|Q9BVG4|PBDC1_HUMAN
15 Dec 2023 01:28:01,262 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:28:01,262 INFO : None of the 1080606 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:31:04,800 INFO : Updated 264914 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:31:04,803 INFO : Done parsing Skyline document.
15 Dec 2023 01:31:04,827 WARN : Missed importing 14046 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.34_F1-4_1_S4-H9_1_4562.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14044 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.31_F1-4_1_S4-G11_1_4552.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14056 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.54_F1-4_2_S4-A4_1_4471.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14054 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.51_F1-4_1_S1-H5_1_4460.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14055 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.36_F1-4_2_S1-A8_1_4575.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14061 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.64_F1-4_2_S4-D8_1_4513.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14060 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.27_F1-4_1_S4-F3_1_4532.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14048 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.66_F1-4_2_S4-E6_1_4523.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14056 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.58_F1-4_2_S4-B2_1_4481.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14064 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.36_F1-4_1_S1-A7_1_4574.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14061 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.49_F1-4_1_S1-G7_1_4450.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14044 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.60_F1-4_2_S4-B12_1_4491.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14063 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.64_F1-4_1_S4-D7_1_4512.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14053 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.34_F1-4_2_S4-H10_1_4563.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14056 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.60_F1-4_1_S4-B11_1_4490.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14052 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.29_F1-4_1_S4-G1_1_4542.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14057 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.58_F1-4_1_S4-B1_1_4480.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14052 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.62_F1-4_2_S4-C10_1_4501.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14051 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.54_F1-4_1_S4-A3_1_4470.d
15 Dec 2023 01:31:04,827 WARN : Missed importing 14052 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.27_F1-4_2_S4-F4_1_4533.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14054 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.66_F1-4_1_S4-E5_1_4522.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14052 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.31_F1-4_2_S4-G12_1_4553.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14052 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6666.29_F1-4_2_S4-G2_1_4543.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14049 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.49_F1-4_2_S1-G8_1_4451.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14051 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.51_F1-4_2_S1-H6_1_4461.d
15 Dec 2023 01:31:04,828 WARN : Missed importing 14060 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F1b\6653.62_F1-4_1_S4-C9_1_4500.d
15 Dec 2023 01:31:04,828 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:31:07,860 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 01:31:18,626 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 01:31:23,607 INFO : Cleaning up temp tables
15 Dec 2023 01:31:23,962 INFO : Completed import of Skyline document from SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 01:31:23,964 INFO : 100% Done
15 Dec 2023 01:31:23,980 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179069/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip into the system
15 Dec 2023 01:31:23,982 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179832/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd into the system
15 Dec 2023 01:31:23,982 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179832/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd into the system
15 Dec 2023 01:31:23,983 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179832/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip into the system
15 Dec 2023 01:31:23,984 INFO : Starting import from SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 01:31:23,987 INFO : Starting to import Skyline document from SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 01:31:24,080 INFO : Expanding human.protdb
15 Dec 2023 01:31:26,942 INFO : Expanding Plasma_P017_F2b.imsdb
15 Dec 2023 01:31:26,977 INFO : Expanding SILK_P017_Plasma_F2b.blib
15 Dec 2023 01:31:27,392 INFO : Expanding SILK_P017_Plasma_F2b.redundant.blib
15 Dec 2023 01:31:32,079 INFO : Expanding SILK_P017_Plasma_F2b.skyd
15 Dec 2023 01:32:09,036 INFO : Expanding SILK_P017_Plasma_F2b.sky.view
15 Dec 2023 01:32:09,037 INFO : Expanding SILK_P017_Plasma_F2b.sky
15 Dec 2023 01:32:14,479 INFO : Expanding SILK_P017_Plasma_F2b.skyl
15 Dec 2023 01:33:53,868 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:33:56,549 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:33:57,563 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 01:33:57,583 WARN : 'SILK_P017_Plasma_F2' library was not found in settings.
15 Dec 2023 01:33:57,778 WARN : 'SILK_P017_Plasma_F1b' library was not found in settings.
15 Dec 2023 01:33:58,186 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:33:58,186 INFO : Inserting sp|A1L4H1|SRCRL_HUMAN
15 Dec 2023 01:33:58,338 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:33:58,338 INFO : Inserting sp|B0I1T2|MYO1G_HUMAN
15 Dec 2023 01:33:58,429 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:33:58,429 INFO : Inserting sp|C9JLW8|MCRI1_HUMAN
15 Dec 2023 01:33:58,510 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:33:58,510 INFO : Inserting sp|O00115|DNS2A_HUMAN
15 Dec 2023 01:33:58,610 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:33:58,610 INFO : Inserting sp|O00148|DX39A_HUMAN
15 Dec 2023 01:33:58,815 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:33:58,815 INFO : Inserting sp|O00151|PDLI1_HUMAN
15 Dec 2023 01:33:58,871 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:33:58,872 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 01:34:00,225 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:34:00,225 INFO : Inserting sp|O00233|PSMD9_HUMAN
15 Dec 2023 01:34:00,278 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:00,278 INFO : Inserting sp|O00270|GPR31_HUMAN
15 Dec 2023 01:34:00,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:00,332 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:34:01,452 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:34:01,453 INFO : Inserting sp|O00339|MATN2_HUMAN
15 Dec 2023 01:34:01,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:01,532 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:34:02,649 INFO : 1% Done
15 Dec 2023 01:34:03,317 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:34:03,317 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 01:34:03,671 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:03,672 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:34:04,728 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:34:04,728 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:34:06,474 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:34:06,474 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:34:06,621 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:34:06,621 INFO : Inserting sp|O00584|RNT2_HUMAN
15 Dec 2023 01:34:06,918 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:06,918 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 01:34:07,182 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:07,182 INFO : Inserting sp|O00754|MA2B1_HUMAN
15 Dec 2023 01:34:07,493 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:07,493 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:34:07,916 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:07,916 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 01:34:08,276 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:34:08,276 INFO : Inserting sp|O14618|CCS_HUMAN
15 Dec 2023 01:34:08,357 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:08,357 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 01:34:08,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:08,408 INFO : Inserting sp|O14744|ANM5_HUMAN
15 Dec 2023 01:34:08,428 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:08,428 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 01:34:08,590 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:08,590 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:34:09,034 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:09,034 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 01:34:09,635 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:34:09,635 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 01:34:10,708 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:34:10,708 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 01:34:11,381 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:34:11,381 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 01:34:11,836 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:34:11,836 INFO : Inserting sp|O15020|SPTN2_HUMAN
15 Dec 2023 01:34:12,289 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:12,289 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 01:34:12,859 INFO : 2% Done
15 Dec 2023 01:34:12,930 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:34:12,930 INFO : Inserting sp|O15061|SYNEM_HUMAN
15 Dec 2023 01:34:12,949 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:12,949 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 01:34:13,059 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:13,059 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 01:34:13,564 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:34:13,564 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:34:14,468 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:34:14,468 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:34:14,528 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:34:14,528 INFO : Inserting sp|O15162|PLS1_HUMAN
15 Dec 2023 01:34:14,591 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:14,591 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 01:34:14,909 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:14,909 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:34:15,298 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:34:15,298 INFO : Inserting sp|O15467|CCL16_HUMAN
15 Dec 2023 01:34:15,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:15,352 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 01:34:15,666 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:15,666 INFO : Inserting sp|O43157|PLXB1_HUMAN
15 Dec 2023 01:34:15,762 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:15,762 INFO : Inserting sp|O43175|SERA_HUMAN
15 Dec 2023 01:34:15,951 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:34:15,951 INFO : Inserting sp|O43242|PSMD3_HUMAN
15 Dec 2023 01:34:16,058 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:16,059 INFO : Inserting sp|O43278|SPIT1_HUMAN
15 Dec 2023 01:34:16,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:16,119 INFO : Inserting sp|O43286|B4GT5_HUMAN
15 Dec 2023 01:34:16,154 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:16,154 INFO : Inserting sp|O43310|CTIF_HUMAN
15 Dec 2023 01:34:16,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:16,236 INFO : Inserting sp|O43390|HNRPR_HUMAN
15 Dec 2023 01:34:16,981 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:16,981 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 01:34:17,300 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:17,301 INFO : Inserting sp|O43405|COCH_HUMAN
15 Dec 2023 01:34:17,330 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:17,330 INFO : Inserting sp|O43504|LTOR5_HUMAN
15 Dec 2023 01:34:17,424 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:17,424 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:34:17,926 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:34:17,926 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 01:34:18,058 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:18,059 INFO : Inserting sp|O43567|RNF13_HUMAN
15 Dec 2023 01:34:18,224 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:18,224 INFO : Inserting sp|O43583|DENR_HUMAN
15 Dec 2023 01:34:18,285 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:18,285 INFO : Inserting sp|O43598|DNPH1_HUMAN
15 Dec 2023 01:34:18,454 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:18,454 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:34:21,175 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:34:21,175 INFO : Inserting sp|O43776|SYNC_HUMAN
15 Dec 2023 01:34:21,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:21,291 INFO : Inserting sp|O43790|KRT86_HUMAN
15 Dec 2023 01:34:21,486 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:21,486 INFO : Inserting sp|O43813|LANC1_HUMAN
15 Dec 2023 01:34:21,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:21,538 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 01:34:22,622 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:34:22,622 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 01:34:22,688 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:22,688 INFO : Inserting sp|O60486|PLXC1_HUMAN
15 Dec 2023 01:34:22,753 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:22,753 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 01:34:22,993 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:22,993 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:34:23,111 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:23,111 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:34:23,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:23,167 INFO : Inserting sp|O60664|PLIN3_HUMAN
15 Dec 2023 01:34:23,179 INFO : 3% Done
15 Dec 2023 01:34:23,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:23,288 INFO : Inserting sp|O60706|ABCC9_HUMAN
15 Dec 2023 01:34:23,388 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:23,388 INFO : Inserting sp|O60749|SNX2_HUMAN
15 Dec 2023 01:34:23,483 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:23,484 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:34:23,821 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:34:23,821 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 01:34:23,989 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:23,989 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:34:24,560 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:34:24,560 INFO : Inserting sp|O75027|ABCB7_HUMAN
15 Dec 2023 01:34:24,673 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:24,674 INFO : Inserting sp|O75037|KI21B_HUMAN
15 Dec 2023 01:34:24,772 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:24,772 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:34:25,759 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:34:25,759 INFO : Inserting sp|O75093|SLIT1_HUMAN
15 Dec 2023 01:34:25,952 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:25,952 INFO : Inserting sp|O75127|PTCD1_HUMAN
15 Dec 2023 01:34:26,107 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:26,107 INFO : Inserting sp|O75131|CPNE3_HUMAN
15 Dec 2023 01:34:26,557 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:34:26,557 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 01:34:26,815 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:26,815 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 01:34:26,850 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:26,851 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 01:34:27,206 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:27,206 INFO : Inserting sp|O75347|TBCA_HUMAN
15 Dec 2023 01:34:27,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:27,259 INFO : Inserting sp|O75351|VPS4B_HUMAN
15 Dec 2023 01:34:27,310 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:27,310 INFO : Inserting sp|O75356|ENTP5_HUMAN
15 Dec 2023 01:34:27,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:27,408 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 01:34:28,054 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:34:28,054 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 01:34:28,393 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:28,393 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:34:29,081 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:34:29,081 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:34:29,524 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:34:29,524 INFO : Inserting sp|O75503|CLN5_HUMAN
15 Dec 2023 01:34:29,712 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:29,712 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 01:34:29,934 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:29,934 INFO : Inserting sp|O75563|SKAP2_HUMAN
15 Dec 2023 01:34:29,954 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:29,954 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:34:30,157 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:30,157 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:34:30,661 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:34:30,662 INFO : Inserting sp|O75695|XRP2_HUMAN
15 Dec 2023 01:34:30,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:30,689 INFO : Inserting sp|O75762|TRPA1_HUMAN
15 Dec 2023 01:34:30,705 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:30,705 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 01:34:30,954 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:34:30,954 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:34:31,574 INFO : 4% Done
15 Dec 2023 01:34:32,305 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:34:32,305 INFO : Inserting sp|O75891|AL1L1_HUMAN
15 Dec 2023 01:34:32,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:32,328 INFO : Imported 100 peptide groups.
15 Dec 2023 01:34:32,328 INFO : Inserting sp|O75916|RGS9_HUMAN
15 Dec 2023 01:34:32,363 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:32,363 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 01:34:32,487 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:34:32,487 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 01:34:32,716 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:34:32,716 INFO : Inserting sp|O75962|TRIO_HUMAN
15 Dec 2023 01:34:32,787 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:32,787 INFO : Inserting sp|O76003|GLRX3_HUMAN
15 Dec 2023 01:34:32,818 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:32,818 INFO : Inserting sp|O76061|STC2_HUMAN
15 Dec 2023 01:34:32,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:32,851 INFO : Inserting sp|O76080|ZFAN5_HUMAN
15 Dec 2023 01:34:32,867 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:32,867 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 01:34:32,918 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:32,918 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:34:32,994 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:32,994 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 01:34:33,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:33,030 INFO : Inserting sp|O94851|MICA2_HUMAN
15 Dec 2023 01:34:33,052 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:33,052 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 01:34:33,193 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:33,193 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 01:34:33,257 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:34:33,257 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 01:34:33,428 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:33,428 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:34:33,906 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:34:33,906 INFO : Inserting sp|O95153|RIMB1_HUMAN
15 Dec 2023 01:34:33,930 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:33,930 INFO : Inserting sp|O95197|RTN3_HUMAN
15 Dec 2023 01:34:33,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:33,951 INFO : Inserting sp|O95294|RASL1_HUMAN
15 Dec 2023 01:34:34,005 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:34,005 INFO : Inserting sp|O95359|TACC2_HUMAN
15 Dec 2023 01:34:34,031 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:34,031 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 01:34:34,470 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:34:34,470 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 01:34:34,812 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:34:34,812 INFO : Inserting sp|O95486|SC24A_HUMAN
15 Dec 2023 01:34:34,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:34,827 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:34:35,154 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:34:35,154 INFO : Inserting sp|O95498|VNN2_HUMAN
15 Dec 2023 01:34:35,193 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:35,193 INFO : Inserting sp|O95544|NADK_HUMAN
15 Dec 2023 01:34:35,244 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:35,244 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 01:34:35,293 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:35,293 INFO : Inserting sp|O95747|OXSR1_HUMAN
15 Dec 2023 01:34:35,323 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,323 INFO : Inserting sp|O95777|LSM8_HUMAN
15 Dec 2023 01:34:35,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,356 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:34:35,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,379 INFO : Inserting sp|O95810|CAVN2_HUMAN
15 Dec 2023 01:34:35,477 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:35,477 INFO : Inserting sp|O95932|TGM3L_HUMAN
15 Dec 2023 01:34:35,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,480 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 01:34:35,594 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:34:35,594 INFO : Inserting sp|O95980|RECK_HUMAN
15 Dec 2023 01:34:35,618 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,618 INFO : Inserting sp|O95996|APCL_HUMAN
15 Dec 2023 01:34:35,640 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,640 INFO : Inserting sp|P00167|CYB5_HUMAN
15 Dec 2023 01:34:35,653 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:35,653 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:34:35,709 INFO : 5% Done
15 Dec 2023 01:34:36,234 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:34:36,234 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 01:34:36,537 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:34:36,537 INFO : Inserting sp|P00367|DHE3_HUMAN
15 Dec 2023 01:34:36,643 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:36,643 INFO : Inserting sp|P00387|NB5R3_HUMAN
15 Dec 2023 01:34:36,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:34:36,716 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:34:37,062 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:34:37,062 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:34:37,236 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:34:37,236 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:34:39,144 DEBUG: Inserted 50 peptides
15 Dec 2023 01:34:40,277 DEBUG: Total peptides inserted: 89
15 Dec 2023 01:34:40,277 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:34:40,420 INFO : 6% Done
15 Dec 2023 01:34:41,323 DEBUG: Total peptides inserted: 41
15 Dec 2023 01:34:41,323 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:34:41,890 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:34:41,890 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 01:34:42,098 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:34:42,098 INFO : Inserting sp|P00505|AATM_HUMAN
15 Dec 2023 01:34:42,186 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:34:42,186 INFO : Inserting sp|P00533|EGFR_HUMAN
15 Dec 2023 01:34:42,238 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:34:42,238 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:34:43,031 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:34:43,031 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 01:34:43,215 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:34:43,215 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:34:44,503 INFO : 7% Done
15 Dec 2023 01:34:45,192 DEBUG: Inserted 50 peptides
15 Dec 2023 01:34:45,290 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:34:45,290 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:34:46,270 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:34:46,271 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 01:34:47,063 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:34:47,063 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 01:34:47,631 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:34:47,631 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 01:34:47,943 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:34:47,943 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:34:48,347 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:34:48,347 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 01:34:48,645 INFO : 8% Done
15 Dec 2023 01:34:48,867 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:34:48,867 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:34:49,845 DEBUG: Inserted 50 peptides
15 Dec 2023 01:34:50,843 DEBUG: Total peptides inserted: 78
15 Dec 2023 01:34:50,843 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:34:51,729 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:34:51,729 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:34:53,108 INFO : 9% Done
15 Dec 2023 01:34:53,571 DEBUG: Inserted 50 peptides
15 Dec 2023 01:34:53,774 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:34:53,774 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:34:54,291 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:34:54,291 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 01:34:54,736 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:34:54,736 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:34:56,412 DEBUG: Inserted 50 peptides
15 Dec 2023 01:34:56,476 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:34:56,476 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:34:57,213 INFO : 10% Done
15 Dec 2023 01:34:57,989 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:34:57,989 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:35:00,453 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:00,471 DEBUG: Total peptides inserted: 50
15 Dec 2023 01:35:00,471 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:35:01,608 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:35:01,608 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:35:01,816 INFO : 11% Done
15 Dec 2023 01:35:03,165 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:05,472 DEBUG: Total peptides inserted: 98
15 Dec 2023 01:35:05,472 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:35:06,748 INFO : 12% Done
15 Dec 2023 01:35:07,736 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:09,070 DEBUG: Inserted 100 peptides
15 Dec 2023 01:35:10,846 INFO : 13% Done
15 Dec 2023 01:35:11,248 DEBUG: Inserted 150 peptides
15 Dec 2023 01:35:12,732 DEBUG: Total peptides inserted: 194
15 Dec 2023 01:35:12,732 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:35:14,393 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:15,452 INFO : 14% Done
15 Dec 2023 01:35:15,770 DEBUG: Inserted 100 peptides
15 Dec 2023 01:35:16,412 DEBUG: Total peptides inserted: 123
15 Dec 2023 01:35:16,412 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:35:16,724 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:35:16,724 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:35:17,214 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:35:17,214 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 01:35:17,258 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:17,258 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:35:18,506 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:35:18,506 INFO : Inserting sp|P01137|TGFB1_HUMAN
15 Dec 2023 01:35:18,522 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:18,522 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 01:35:18,639 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:18,639 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 01:35:18,789 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:35:18,789 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 01:35:19,041 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:35:19,042 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 01:35:19,108 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:19,108 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 01:35:19,176 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:19,176 INFO : Inserting sp|P01597|KV139_HUMAN
15 Dec 2023 01:35:19,305 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,305 INFO : Inserting sp|P01602|KV105_HUMAN
15 Dec 2023 01:35:19,402 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,402 INFO : Inserting sp|P01611|KVD12_HUMAN
15 Dec 2023 01:35:19,522 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,522 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 01:35:19,590 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,590 INFO : Inserting sp|P01699|LV144_HUMAN
15 Dec 2023 01:35:19,628 INFO : 15% Done
15 Dec 2023 01:35:19,668 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:19,668 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 01:35:19,777 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,777 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 01:35:19,840 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:19,841 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 01:35:19,924 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:19,924 INFO : Inserting sp|P01709|LV208_HUMAN
15 Dec 2023 01:35:19,959 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:19,959 INFO : Inserting sp|P01721|LV657_HUMAN
15 Dec 2023 01:35:19,989 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:19,989 INFO : Inserting sp|P01742|HV169_HUMAN
15 Dec 2023 01:35:20,048 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:20,048 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 01:35:20,102 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:20,102 INFO : Inserting sp|P01762|HV311_HUMAN
15 Dec 2023 01:35:20,260 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:35:20,260 INFO : Inserting sp|P01764|HV323_HUMAN
15 Dec 2023 01:35:20,383 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:20,383 INFO : Inserting sp|P01766|HV313_HUMAN
15 Dec 2023 01:35:20,542 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:20,543 INFO : Inserting sp|P01767|HV353_HUMAN
15 Dec 2023 01:35:20,682 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:35:20,682 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 01:35:20,876 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:20,876 INFO : Inserting sp|P01772|HV333_HUMAN
15 Dec 2023 01:35:21,071 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:21,071 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 01:35:21,234 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:35:21,234 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 01:35:21,418 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:21,418 INFO : Inserting sp|P01817|HV205_HUMAN
15 Dec 2023 01:35:21,480 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:21,480 INFO : Inserting sp|P01824|HV439_HUMAN
15 Dec 2023 01:35:21,553 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:35:21,553 INFO : Imported 200 peptide groups.
15 Dec 2023 01:35:21,553 INFO : Inserting sp|P01833|PIGR_HUMAN
15 Dec 2023 01:35:21,714 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:21,715 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:35:22,007 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:22,007 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:35:22,603 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:35:22,603 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:35:23,224 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:35:23,224 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:35:23,493 INFO : 16% Done
15 Dec 2023 01:35:23,855 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:35:23,855 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:35:24,485 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:35:24,485 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:35:25,247 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:35:25,247 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:35:25,909 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:35:25,909 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 01:35:26,281 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:26,281 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:35:26,620 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:35:26,621 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 01:35:26,725 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:26,725 INFO : Inserting sp|P01903|DRA_HUMAN
15 Dec 2023 01:35:26,817 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:26,817 INFO : Inserting sp|P01911|DRB1_HUMAN
15 Dec 2023 01:35:26,867 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:26,867 INFO : Inserting sp|P02008|HBAZ_HUMAN
15 Dec 2023 01:35:27,120 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:35:27,120 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:35:27,811 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:35:27,811 INFO : Inserting sp|P02100|HBE_HUMAN
15 Dec 2023 01:35:27,867 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:27,868 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:35:28,149 INFO : 17% Done
15 Dec 2023 01:35:28,234 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:35:28,234 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 01:35:28,521 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:35:28,522 INFO : Inserting sp|P02462|CO4A1_HUMAN
15 Dec 2023 01:35:28,552 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:28,552 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 01:35:29,165 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:35:29,165 INFO : Inserting sp|P02538|K2C6A_HUMAN
15 Dec 2023 01:35:29,683 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:35:29,683 INFO : Inserting sp|P02545|LMNA_HUMAN
15 Dec 2023 01:35:29,715 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:35:29,715 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 01:35:31,305 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:32,325 INFO : 18% Done
15 Dec 2023 01:35:32,999 DEBUG: Inserted 100 peptides
15 Dec 2023 01:35:34,164 DEBUG: Total peptides inserted: 137
15 Dec 2023 01:35:34,165 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:35:35,476 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:35:35,476 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:35:36,162 INFO : 19% Done
15 Dec 2023 01:35:36,256 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:35:36,256 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:35:36,503 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:35:36,503 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 01:35:36,647 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:36,647 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 01:35:36,859 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:36,859 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 01:35:37,007 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:37,007 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:35:38,573 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:38,675 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:35:38,675 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:35:40,400 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:40,508 DEBUG: Total peptides inserted: 57
15 Dec 2023 01:35:40,508 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:35:40,686 INFO : 20% Done
15 Dec 2023 01:35:41,704 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:35:41,704 INFO : Inserting sp|P02724|GLPA_HUMAN
15 Dec 2023 01:35:41,770 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:35:41,770 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:35:42,586 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:35:42,587 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 01:35:42,763 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:35:42,763 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:35:42,986 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:35:42,986 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:35:43,404 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:35:43,405 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:35:43,787 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:35:43,787 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:35:43,997 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:35:43,998 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:35:44,744 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:35:44,744 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:35:44,974 INFO : 21% Done
15 Dec 2023 01:35:45,349 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:35:45,349 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:35:45,945 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:35:45,946 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:35:47,091 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:48,551 DEBUG: Inserted 100 peptides
15 Dec 2023 01:35:48,694 DEBUG: Total peptides inserted: 109
15 Dec 2023 01:35:48,694 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:35:49,249 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:35:49,249 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:35:49,312 INFO : 22% Done
15 Dec 2023 01:35:50,135 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:35:50,135 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:35:50,461 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:35:50,461 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:35:51,189 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:35:51,189 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:35:51,831 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:35:51,831 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:35:53,910 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:53,940 INFO : 23% Done
15 Dec 2023 01:35:55,002 DEBUG: Total peptides inserted: 80
15 Dec 2023 01:35:55,002 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:35:56,463 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:35:56,463 INFO : Inserting sp|P02775|CXCL7_HUMAN
15 Dec 2023 01:35:56,666 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:35:56,666 INFO : Inserting sp|P02776|PLF4_HUMAN
15 Dec 2023 01:35:56,782 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:56,782 INFO : Inserting sp|P02778|CXL10_HUMAN
15 Dec 2023 01:35:56,826 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:35:56,826 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 01:35:57,665 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:35:57,665 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:35:58,224 INFO : 24% Done
15 Dec 2023 01:35:59,339 DEBUG: Inserted 50 peptides
15 Dec 2023 01:35:59,601 DEBUG: Total peptides inserted: 57
15 Dec 2023 01:35:59,601 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:36:00,906 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:36:00,906 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:36:02,274 INFO : 25% Done
15 Dec 2023 01:36:02,301 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:36:02,302 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 01:36:02,531 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:36:02,531 INFO : Inserting sp|P02794|FRIH_HUMAN
15 Dec 2023 01:36:02,666 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:36:02,666 INFO : Inserting sp|P02795|MT2_HUMAN
15 Dec 2023 01:36:02,681 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:02,681 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 01:36:02,819 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:02,819 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:36:03,608 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:36:03,608 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:36:04,881 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:36:04,881 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:36:05,803 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:36:05,803 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:36:06,280 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:36:06,280 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 01:36:07,182 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:36:07,182 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:36:07,293 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:36:07,293 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 01:36:07,743 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:36:07,743 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:36:08,478 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:36:08,479 INFO : Inserting sp|P04080|CYTB_HUMAN
15 Dec 2023 01:36:08,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:08,528 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:36:09,036 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:36:09,037 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:36:10,703 INFO : 26% Done
15 Dec 2023 01:36:10,993 DEBUG: Inserted 50 peptides
15 Dec 2023 01:36:13,025 DEBUG: Inserted 100 peptides
15 Dec 2023 01:36:14,583 DEBUG: Inserted 150 peptides
15 Dec 2023 01:36:15,172 INFO : 27% Done
15 Dec 2023 01:36:16,433 DEBUG: Inserted 200 peptides
15 Dec 2023 01:36:18,168 DEBUG: Inserted 250 peptides
15 Dec 2023 01:36:19,458 INFO : 28% Done
15 Dec 2023 01:36:19,938 DEBUG: Inserted 300 peptides
15 Dec 2023 01:36:21,275 DEBUG: Inserted 350 peptides
15 Dec 2023 01:36:22,782 DEBUG: Total peptides inserted: 394
15 Dec 2023 01:36:22,782 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 01:36:22,820 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:36:22,820 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:36:22,965 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:22,965 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:36:23,262 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:36:23,262 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:36:23,643 INFO : 29% Done
15 Dec 2023 01:36:24,123 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:36:24,123 INFO : Inserting sp|P04216|THY1_HUMAN
15 Dec 2023 01:36:24,170 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:24,170 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:36:25,482 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:36:25,482 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 01:36:26,411 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:36:26,411 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 01:36:27,794 DEBUG: Inserted 50 peptides
15 Dec 2023 01:36:27,967 INFO : 30% Done
15 Dec 2023 01:36:28,513 DEBUG: Total peptides inserted: 79
15 Dec 2023 01:36:28,513 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:36:29,448 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:36:29,448 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:36:30,075 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:36:30,075 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 01:36:30,207 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:30,207 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 01:36:30,232 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:30,232 INFO : Inserting sp|P04732|MT1E_HUMAN
15 Dec 2023 01:36:30,247 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:30,247 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 01:36:30,481 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:36:30,481 INFO : Inserting sp|P04792|HSPB1_HUMAN
15 Dec 2023 01:36:30,517 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:30,517 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:36:30,555 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:30,555 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 01:36:30,605 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:30,606 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:36:30,878 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:36:30,878 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 01:36:31,036 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:36:31,036 INFO : Inserting sp|P04921|GLPC_HUMAN
15 Dec 2023 01:36:31,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:31,102 INFO : Inserting sp|P05019|IGF1_HUMAN
15 Dec 2023 01:36:31,206 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:36:31,206 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 01:36:31,472 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:36:31,472 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 01:36:31,505 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:31,506 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 01:36:32,010 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:36:32,010 INFO : Inserting sp|P05062|ALDOB_HUMAN
15 Dec 2023 01:36:32,088 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:36:32,088 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 01:36:32,507 INFO : 31% Done
15 Dec 2023 01:36:32,521 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:36:32,521 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:36:32,713 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:32,714 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 01:36:32,934 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:36:32,934 INFO : Imported 300 peptide groups.
15 Dec 2023 01:36:32,934 INFO : Inserting sp|P05106|ITB3_HUMAN
15 Dec 2023 01:36:33,287 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:36:33,287 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 01:36:33,684 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:36:33,685 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:36:34,025 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:36:34,025 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 01:36:34,059 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:34,059 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:36:34,670 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:36:34,670 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:36:36,314 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:36:36,314 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:36:36,998 INFO : 32% Done
15 Dec 2023 01:36:37,235 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:36:37,235 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 01:36:38,255 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:36:38,255 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:36:39,234 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:36:39,234 INFO : Inserting sp|P05186|PPBT_HUMAN
15 Dec 2023 01:36:39,268 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:39,269 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 01:36:39,517 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:36:39,517 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 01:36:39,548 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:39,548 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 01:36:39,606 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:39,606 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 01:36:40,039 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:36:40,040 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:36:40,777 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:36:40,777 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:36:41,225 INFO : 33% Done
15 Dec 2023 01:36:41,948 DEBUG: Total peptides inserted: 41
15 Dec 2023 01:36:41,948 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 01:36:42,189 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:36:42,190 INFO : Inserting sp|P05783|K1C18_HUMAN
15 Dec 2023 01:36:42,253 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:42,253 INFO : Inserting sp|P05787|K2C8_HUMAN
15 Dec 2023 01:36:42,408 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:36:42,408 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 01:36:42,449 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:42,449 INFO : Inserting sp|P05981|HEPS_HUMAN
15 Dec 2023 01:36:42,485 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:42,485 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 01:36:42,510 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:42,510 INFO : Inserting sp|P06132|DCUP_HUMAN
15 Dec 2023 01:36:42,704 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:36:42,704 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:36:43,280 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:36:43,280 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 01:36:43,371 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:36:43,372 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:36:45,072 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:36:45,072 INFO : Inserting sp|P06576|ATPB_HUMAN
15 Dec 2023 01:36:45,189 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:36:45,189 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:36:45,677 INFO : 34% Done
15 Dec 2023 01:36:46,611 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:36:46,611 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:36:46,976 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:36:46,976 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 01:36:48,349 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:36:48,349 INFO : Inserting sp|P06730|IF4E_HUMAN
15 Dec 2023 01:36:48,434 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:48,434 INFO : Inserting sp|P06731|CEAM5_HUMAN
15 Dec 2023 01:36:48,504 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:48,504 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:36:49,347 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:36:49,347 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:36:49,817 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:36:49,817 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:36:49,827 INFO : 35% Done
15 Dec 2023 01:36:50,318 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:36:50,318 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 01:36:50,367 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:50,367 INFO : Inserting sp|P06753|TPM3_HUMAN
15 Dec 2023 01:36:50,623 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:36:50,623 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 01:36:50,690 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:36:50,690 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:36:50,836 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:36:50,836 INFO : Inserting sp|P07108|ACBP_HUMAN
15 Dec 2023 01:36:50,985 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:36:50,985 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:36:51,646 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:36:51,646 INFO : Inserting sp|P07196|NFL_HUMAN
15 Dec 2023 01:36:51,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:36:51,660 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 01:36:51,846 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:51,846 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 01:36:52,017 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:36:52,017 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:36:53,029 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:36:53,029 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 01:36:53,532 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:36:53,532 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 01:36:53,877 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:36:53,877 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:36:53,957 INFO : 36% Done
15 Dec 2023 01:36:54,374 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:36:54,375 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 01:36:54,734 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:36:54,735 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:36:55,709 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:36:55,709 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:36:57,070 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:36:57,070 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 01:36:57,412 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:36:57,412 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 01:36:57,946 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:36:57,946 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 01:36:58,079 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:36:58,079 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:36:58,368 INFO : 37% Done
15 Dec 2023 01:36:58,451 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:36:58,451 INFO : Inserting sp|P07451|CAH3_HUMAN
15 Dec 2023 01:36:58,596 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:58,596 INFO : Inserting sp|P07477|TRY1_HUMAN
15 Dec 2023 01:36:58,686 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:58,686 INFO : Inserting sp|P07585|PGS2_HUMAN
15 Dec 2023 01:36:58,760 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:36:58,760 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:36:59,322 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:36:59,322 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 01:36:59,426 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:36:59,426 INFO : Inserting sp|P07711|CATL1_HUMAN
15 Dec 2023 01:36:59,525 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:36:59,525 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:36:59,882 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:36:59,883 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 01:37:00,173 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:37:00,173 INFO : Inserting sp|P07741|APT_HUMAN
15 Dec 2023 01:37:00,218 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:00,218 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 01:37:00,445 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:37:00,445 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:37:00,979 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:37:00,980 INFO : Inserting sp|P07910|HNRPC_HUMAN
15 Dec 2023 01:37:01,052 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:01,052 INFO : Inserting sp|P07911|UROM_HUMAN
15 Dec 2023 01:37:01,114 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:01,114 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 01:37:01,448 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:37:01,448 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 01:37:01,492 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:01,492 INFO : Inserting sp|P07951|TPM2_HUMAN
15 Dec 2023 01:37:01,731 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:01,731 INFO : Inserting sp|P07954|FUMH_HUMAN
15 Dec 2023 01:37:01,884 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:01,885 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:37:02,553 INFO : 38% Done
15 Dec 2023 01:37:02,885 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:37:02,885 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:37:03,042 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:37:03,042 INFO : Inserting sp|P08069|IGF1R_HUMAN
15 Dec 2023 01:37:03,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:03,081 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:37:03,624 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:37:03,624 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 01:37:04,391 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:37:04,392 INFO : Inserting sp|P08174|DAF_HUMAN
15 Dec 2023 01:37:04,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:04,441 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:37:05,019 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:37:05,019 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 01:37:05,536 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:37:05,536 INFO : Inserting sp|P08236|BGLR_HUMAN
15 Dec 2023 01:37:05,616 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:05,616 INFO : Inserting sp|P08237|PFKAM_HUMAN
15 Dec 2023 01:37:05,650 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:05,650 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:37:06,212 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:37:06,212 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:37:06,280 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:06,280 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:37:06,647 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:37:06,647 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:37:06,788 INFO : 39% Done
15 Dec 2023 01:37:06,896 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:06,896 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:37:07,108 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:07,108 INFO : Inserting sp|P08397|HEM3_HUMAN
15 Dec 2023 01:37:07,208 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:07,208 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 01:37:07,234 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:07,234 INFO : Inserting sp|P08514|ITA2B_HUMAN
15 Dec 2023 01:37:07,603 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:37:07,603 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 01:37:08,023 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:37:08,023 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 01:37:08,172 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:08,172 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:37:08,987 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:37:08,987 INFO : Inserting sp|P08572|CO4A2_HUMAN
15 Dec 2023 01:37:09,052 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:09,053 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:37:09,402 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:37:09,402 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:37:10,652 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:11,164 INFO : 40% Done
15 Dec 2023 01:37:11,640 DEBUG: Total peptides inserted: 87
15 Dec 2023 01:37:11,641 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 01:37:11,778 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:11,778 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 01:37:12,394 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:37:12,394 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:37:13,740 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:37:13,740 INFO : Inserting sp|P08709|FA7_HUMAN
15 Dec 2023 01:37:14,030 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:37:14,030 INFO : Imported 400 peptide groups.
15 Dec 2023 01:37:14,030 INFO : Inserting sp|P08729|K2C7_HUMAN
15 Dec 2023 01:37:14,135 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:14,135 INFO : Inserting sp|P08754|GNAI3_HUMAN
15 Dec 2023 01:37:14,259 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:14,259 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 01:37:14,561 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:37:14,562 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:37:15,174 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:37:15,174 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:37:15,217 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:15,217 INFO : Inserting sp|P08962|CD63_HUMAN
15 Dec 2023 01:37:15,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:15,230 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 01:37:15,293 INFO : 41% Done
15 Dec 2023 01:37:15,438 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:15,438 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 01:37:16,082 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:37:16,082 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:37:16,721 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:37:16,722 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 01:37:16,766 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:16,766 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 01:37:16,972 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:16,972 INFO : Inserting sp|P09417|DHPR_HUMAN
15 Dec 2023 01:37:17,116 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:17,116 INFO : Inserting sp|P09429|HMGB1_HUMAN
15 Dec 2023 01:37:17,254 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:17,254 INFO : Inserting sp|P09467|F16P1_HUMAN
15 Dec 2023 01:37:17,316 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:17,316 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:37:17,933 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:37:17,933 INFO : Inserting sp|P09493|TPM1_HUMAN
15 Dec 2023 01:37:18,077 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:18,077 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 01:37:18,356 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:37:18,356 INFO : Inserting sp|P09603|CSF1_HUMAN
15 Dec 2023 01:37:18,442 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:18,442 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 01:37:18,523 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:18,523 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 01:37:18,553 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:18,553 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:37:18,657 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:18,657 INFO : Inserting sp|P09668|CATH_HUMAN
15 Dec 2023 01:37:18,742 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:18,742 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 01:37:18,778 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:18,778 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:37:19,677 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:37:19,677 INFO : Inserting sp|P09914|IFIT1_HUMAN
15 Dec 2023 01:37:19,707 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:19,708 INFO : Inserting sp|P09917|LOX5_HUMAN
15 Dec 2023 01:37:19,770 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:19,770 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:37:19,864 INFO : 42% Done
15 Dec 2023 01:37:20,444 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:37:20,444 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 01:37:20,778 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:37:20,779 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:37:22,799 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:24,331 INFO : 43% Done
15 Dec 2023 01:37:25,466 DEBUG: Inserted 100 peptides
15 Dec 2023 01:37:26,617 DEBUG: Total peptides inserted: 129
15 Dec 2023 01:37:26,617 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:37:28,609 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:28,688 INFO : 44% Done
15 Dec 2023 01:37:31,219 DEBUG: Inserted 100 peptides
15 Dec 2023 01:37:32,459 DEBUG: Total peptides inserted: 130
15 Dec 2023 01:37:32,459 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 01:37:32,602 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:32,602 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 01:37:32,753 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:32,753 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 01:37:32,903 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:32,903 INFO : Inserting sp|P0DJI8|SAA1_HUMAN
15 Dec 2023 01:37:33,051 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:33,051 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 01:37:33,199 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:33,199 INFO : Inserting sp|P0DME0|SETLP_HUMAN
15 Dec 2023 01:37:33,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:33,214 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:37:33,553 INFO : 45% Done
15 Dec 2023 01:37:33,754 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:37:33,754 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:37:34,318 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:37:34,318 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:37:34,626 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:34,627 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:37:34,882 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:34,882 INFO : Inserting sp|P0DP23|CALM1_HUMAN
15 Dec 2023 01:37:34,936 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:34,936 INFO : Inserting sp|P0DP24|CALM2_HUMAN
15 Dec 2023 01:37:34,989 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:34,989 INFO : Inserting sp|P0DP25|CALM3_HUMAN
15 Dec 2023 01:37:35,044 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:35,044 INFO : Inserting sp|P0DPK3|NT2NB_HUMAN
15 Dec 2023 01:37:35,058 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:35,058 INFO : Inserting sp|P0DPK4|NT2NC_HUMAN
15 Dec 2023 01:37:35,072 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:35,072 INFO : Inserting sp|P0DTE7|AMY1B_HUMAN
15 Dec 2023 01:37:35,289 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:35,289 INFO : Inserting sp|P0DTE8|AMY1C_HUMAN
15 Dec 2023 01:37:35,506 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:35,506 INFO : Inserting sp|P0DUB6|AMY1A_HUMAN
15 Dec 2023 01:37:35,720 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:35,720 INFO : Inserting sp|P10124|SRGN_HUMAN
15 Dec 2023 01:37:35,780 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:35,780 INFO : Inserting sp|P10145|IL8_HUMAN
15 Dec 2023 01:37:35,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:35,800 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 01:37:35,883 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:35,883 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 01:37:35,929 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:35,929 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 01:37:36,072 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:36,072 INFO : Inserting sp|P10412|H14_HUMAN
15 Dec 2023 01:37:36,209 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:36,209 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 01:37:36,398 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:36,398 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 01:37:36,511 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:36,511 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:37:36,617 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:36,617 INFO : Inserting sp|P10619|PPGB_HUMAN
15 Dec 2023 01:37:36,693 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:36,693 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:37:37,917 INFO : 46% Done
15 Dec 2023 01:37:38,184 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:38,197 DEBUG: Total peptides inserted: 51
15 Dec 2023 01:37:38,197 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 01:37:38,229 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:38,230 INFO : Inserting sp|P10645|CMGA_HUMAN
15 Dec 2023 01:37:38,453 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:38,454 INFO : Inserting sp|P10646|TFPI1_HUMAN
15 Dec 2023 01:37:38,489 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:38,489 INFO : Inserting sp|P10721|KIT_HUMAN
15 Dec 2023 01:37:38,648 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:38,648 INFO : Inserting sp|P10746|HEM4_HUMAN
15 Dec 2023 01:37:38,681 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:38,681 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:37:39,045 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:37:39,046 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 01:37:39,199 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:39,199 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:37:40,098 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:37:40,098 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 01:37:40,697 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:37:40,697 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 01:37:41,094 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:37:41,094 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:37:41,693 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:37:41,693 INFO : Inserting sp|P11150|LIPC_HUMAN
15 Dec 2023 01:37:41,724 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:41,725 INFO : Inserting sp|P11166|GTR1_HUMAN
15 Dec 2023 01:37:41,927 INFO : 47% Done
15 Dec 2023 01:37:41,950 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:37:41,950 INFO : Inserting sp|P11169|GTR3_HUMAN
15 Dec 2023 01:37:41,974 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:41,974 INFO : Inserting sp|P11171|EPB41_HUMAN
15 Dec 2023 01:37:42,535 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:37:42,535 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:37:43,063 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:37:43,063 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 01:37:43,508 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:37:43,509 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 01:37:45,097 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:46,181 INFO : 48% Done
15 Dec 2023 01:37:47,020 DEBUG: Inserted 100 peptides
15 Dec 2023 01:37:47,533 DEBUG: Total peptides inserted: 116
15 Dec 2023 01:37:47,533 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 01:37:47,624 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:47,624 INFO : Inserting sp|P11362|FGFR1_HUMAN
15 Dec 2023 01:37:47,701 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:47,702 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:37:48,028 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:37:48,028 INFO : Inserting sp|P11488|GNAT1_HUMAN
15 Dec 2023 01:37:48,052 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:48,052 INFO : Inserting sp|P11586|C1TC_HUMAN
15 Dec 2023 01:37:48,100 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:48,100 INFO : Inserting sp|P11597|CETP_HUMAN
15 Dec 2023 01:37:48,261 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:48,261 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 01:37:48,506 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:37:48,506 INFO : Inserting sp|P11766|ADHX_HUMAN
15 Dec 2023 01:37:48,580 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:48,580 INFO : Inserting sp|P12107|COBA1_HUMAN
15 Dec 2023 01:37:48,644 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:37:48,644 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:37:49,126 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:37:49,126 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 01:37:49,167 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:49,168 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:37:50,185 DEBUG: Total peptides inserted: 35
15 Dec 2023 01:37:50,186 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:37:50,465 INFO : 49% Done
15 Dec 2023 01:37:51,480 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:52,193 DEBUG: Total peptides inserted: 80
15 Dec 2023 01:37:52,193 INFO : Inserting sp|P12273|PIP_HUMAN
15 Dec 2023 01:37:52,247 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:52,247 INFO : Inserting sp|P12318|FCG2A_HUMAN
15 Dec 2023 01:37:52,260 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:52,260 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:37:52,696 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:37:52,696 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 01:37:52,808 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:37:52,808 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:37:54,181 DEBUG: Inserted 50 peptides
15 Dec 2023 01:37:54,214 DEBUG: Total peptides inserted: 51
15 Dec 2023 01:37:54,214 INFO : Inserting sp|P12821|ACE_HUMAN
15 Dec 2023 01:37:54,274 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:54,274 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 01:37:54,352 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:54,352 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 01:37:54,583 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:37:54,583 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 01:37:54,619 INFO : 50% Done
15 Dec 2023 01:37:54,970 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:37:54,971 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 01:37:55,155 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:37:55,155 INFO : Imported 500 peptide groups.
15 Dec 2023 01:37:55,155 INFO : Inserting sp|P13164|IFM1_HUMAN
15 Dec 2023 01:37:55,181 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:55,181 INFO : Inserting sp|P13224|GP1BB_HUMAN
15 Dec 2023 01:37:55,259 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:55,259 INFO : Inserting sp|P13284|GILT_HUMAN
15 Dec 2023 01:37:55,302 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:55,302 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 01:37:55,399 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:55,400 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:37:55,909 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:37:55,909 INFO : Inserting sp|P13498|CY24A_HUMAN
15 Dec 2023 01:37:55,935 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:37:55,935 INFO : Inserting sp|P13500|CCL2_HUMAN
15 Dec 2023 01:37:55,971 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:55,971 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:37:56,441 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:37:56,442 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 01:37:56,620 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:37:56,621 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 01:37:57,109 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:37:57,109 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 01:37:57,423 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:37:57,423 INFO : Inserting sp|P13640|MT1G_HUMAN
15 Dec 2023 01:37:57,439 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:37:57,439 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:37:58,620 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:37:58,620 INFO : Inserting sp|P13646|K1C13_HUMAN
15 Dec 2023 01:37:58,788 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:58,788 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:37:59,065 INFO : 51% Done
15 Dec 2023 01:37:59,216 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:37:59,216 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 01:37:59,344 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:37:59,344 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:38:00,702 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:38:00,703 INFO : Inserting sp|P13688|CEAM1_HUMAN
15 Dec 2023 01:38:00,741 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:00,741 INFO : Inserting sp|P13693|TCTP_HUMAN
15 Dec 2023 01:38:00,836 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:00,836 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 01:38:01,182 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:38:01,182 INFO : Inserting sp|P13727|PRG2_HUMAN
15 Dec 2023 01:38:01,307 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:01,307 INFO : Inserting sp|P13747|HLAE_HUMAN
15 Dec 2023 01:38:01,382 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:01,382 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:38:02,580 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:38:02,580 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 01:38:02,817 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:02,817 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 01:38:02,966 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:02,966 INFO : Inserting sp|P13987|CD59_HUMAN
15 Dec 2023 01:38:03,092 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:03,092 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 01:38:03,193 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:03,193 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 01:38:03,260 INFO : 52% Done
15 Dec 2023 01:38:03,341 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:03,342 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 01:38:03,419 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:03,420 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 01:38:03,563 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:03,563 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 01:38:03,685 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:03,685 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 01:38:03,754 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:03,754 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 01:38:04,006 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:04,006 INFO : Inserting sp|P14550|AK1A1_HUMAN
15 Dec 2023 01:38:04,092 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:04,092 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 01:38:04,337 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:04,337 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:38:05,066 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:38:05,067 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:38:05,558 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:38:05,558 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:38:06,223 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:38:06,223 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 01:38:06,312 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:06,312 INFO : Inserting sp|P15090|FABP4_HUMAN
15 Dec 2023 01:38:06,356 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:06,356 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 01:38:06,407 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:06,407 INFO : Inserting sp|P15121|ALDR_HUMAN
15 Dec 2023 01:38:06,459 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:06,460 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 01:38:07,050 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:38:07,050 INFO : Inserting sp|P15151|PVR_HUMAN
15 Dec 2023 01:38:07,215 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:07,216 INFO : Inserting sp|P15153|RAC2_HUMAN
15 Dec 2023 01:38:07,268 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:07,268 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 01:38:07,399 INFO : 53% Done
15 Dec 2023 01:38:07,961 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:38:07,961 INFO : Inserting sp|P15289|ARSA_HUMAN
15 Dec 2023 01:38:07,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:07,985 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:38:08,114 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:08,114 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 01:38:08,516 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:38:08,516 INFO : Inserting sp|P15328|FOLR1_HUMAN
15 Dec 2023 01:38:08,633 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:08,633 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 01:38:08,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:08,676 INFO : Inserting sp|P15509|CSF2R_HUMAN
15 Dec 2023 01:38:08,699 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:08,699 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 01:38:08,919 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:08,919 INFO : Inserting sp|P15559|NQO1_HUMAN
15 Dec 2023 01:38:08,949 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:08,949 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 01:38:09,020 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:09,020 INFO : Inserting sp|P15814|IGLL1_HUMAN
15 Dec 2023 01:38:09,054 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:09,054 INFO : Inserting sp|P15880|RS2_HUMAN
15 Dec 2023 01:38:09,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:09,081 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:38:09,265 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:09,265 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 01:38:09,341 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:09,341 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:38:09,370 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:09,370 INFO : Inserting sp|P16109|LYAM3_HUMAN
15 Dec 2023 01:38:09,428 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:09,428 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 01:38:09,654 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:09,654 INFO : Inserting sp|P16157|ANK1_HUMAN
15 Dec 2023 01:38:11,385 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:11,719 INFO : 54% Done
15 Dec 2023 01:38:11,839 DEBUG: Total peptides inserted: 66
15 Dec 2023 01:38:11,839 INFO : Inserting sp|P16284|PECA1_HUMAN
15 Dec 2023 01:38:11,863 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:11,863 INFO : Inserting sp|P16401|H15_HUMAN
15 Dec 2023 01:38:11,986 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:11,986 INFO : Inserting sp|P16402|H13_HUMAN
15 Dec 2023 01:38:12,155 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:12,155 INFO : Inserting sp|P16403|H12_HUMAN
15 Dec 2023 01:38:12,307 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:12,307 INFO : Inserting sp|P16452|EPB42_HUMAN
15 Dec 2023 01:38:13,031 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:38:13,031 INFO : Inserting sp|P16615|AT2A2_HUMAN
15 Dec 2023 01:38:13,063 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:13,063 INFO : Inserting sp|P16671|CD36_HUMAN
15 Dec 2023 01:38:13,107 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:13,107 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:38:13,407 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:38:13,407 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 01:38:13,494 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:13,494 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 01:38:13,695 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:13,695 INFO : Inserting sp|P17050|NAGAB_HUMAN
15 Dec 2023 01:38:13,717 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:13,717 INFO : Inserting sp|P17066|HSP76_HUMAN
15 Dec 2023 01:38:13,978 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:13,978 INFO : Inserting sp|P17174|AATC_HUMAN
15 Dec 2023 01:38:14,205 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:14,205 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:38:14,283 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:14,283 INFO : Inserting sp|P17813|EGLN_HUMAN
15 Dec 2023 01:38:14,355 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:14,355 INFO : Inserting sp|P17844|DDX5_HUMAN
15 Dec 2023 01:38:14,395 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:14,395 INFO : Inserting sp|P17858|PFKAL_HUMAN
15 Dec 2023 01:38:14,454 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:14,454 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:38:14,547 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:14,547 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 01:38:14,652 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:14,652 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 01:38:14,992 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:38:14,993 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 01:38:15,143 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:15,143 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 01:38:15,412 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:15,412 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 01:38:15,817 INFO : 55% Done
15 Dec 2023 01:38:16,445 DEBUG: Total peptides inserted: 41
15 Dec 2023 01:38:16,446 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 01:38:16,994 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:16,994 INFO : Inserting sp|P18510|IL1RA_HUMAN
15 Dec 2023 01:38:17,128 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:17,128 INFO : Inserting sp|P18577|RHCE_HUMAN
15 Dec 2023 01:38:17,163 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:17,163 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:38:17,640 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:38:17,640 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 01:38:17,654 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:17,654 INFO : Inserting sp|P19012|K1C15_HUMAN
15 Dec 2023 01:38:17,864 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:17,864 INFO : Inserting sp|P19013|K2C4_HUMAN
15 Dec 2023 01:38:18,038 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:18,038 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 01:38:18,202 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:18,202 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 01:38:18,498 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:38:18,498 INFO : Inserting sp|P19087|GNAT2_HUMAN
15 Dec 2023 01:38:18,524 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:18,524 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 01:38:18,753 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:18,754 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 01:38:19,542 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:38:19,542 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 01:38:19,690 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:19,690 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 01:38:19,839 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:19,839 INFO : Imported 600 peptide groups.
15 Dec 2023 01:38:19,839 INFO : Inserting sp|P19438|TNR1A_HUMAN
15 Dec 2023 01:38:19,897 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:19,897 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 01:38:20,249 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:20,249 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:38:20,415 INFO : 56% Done
15 Dec 2023 01:38:22,088 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:22,343 DEBUG: Total peptides inserted: 55
15 Dec 2023 01:38:22,343 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:38:24,182 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:24,736 INFO : 57% Done
15 Dec 2023 01:38:24,774 DEBUG: Total peptides inserted: 60
15 Dec 2023 01:38:24,774 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 01:38:24,825 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:24,825 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 01:38:24,928 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:24,928 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:38:25,309 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:25,310 INFO : Inserting sp|P20020|AT2B1_HUMAN
15 Dec 2023 01:38:25,358 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:25,358 INFO : Inserting sp|P20036|DPA1_HUMAN
15 Dec 2023 01:38:25,395 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:25,396 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 01:38:25,501 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:25,502 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:38:25,669 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:25,669 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 01:38:25,740 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:25,740 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:38:26,000 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:26,000 INFO : Inserting sp|P20333|TNR1B_HUMAN
15 Dec 2023 01:38:26,015 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:26,015 INFO : Inserting sp|P20339|RAB5A_HUMAN
15 Dec 2023 01:38:26,068 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:26,068 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 01:38:26,137 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:26,137 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:38:26,299 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:26,299 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 01:38:26,459 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:26,459 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 01:38:27,044 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:38:27,044 INFO : Inserting sp|P20701|ITAL_HUMAN
15 Dec 2023 01:38:27,125 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:27,125 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:38:28,863 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:29,114 INFO : 58% Done
15 Dec 2023 01:38:29,454 DEBUG: Total peptides inserted: 69
15 Dec 2023 01:38:29,454 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:38:29,838 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:29,838 INFO : Inserting sp|P20810|ICAL_HUMAN
15 Dec 2023 01:38:29,940 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:29,940 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 01:38:30,307 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:38:30,308 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 01:38:30,346 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:30,346 INFO : Inserting sp|P20929|NEBU_HUMAN
15 Dec 2023 01:38:30,395 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:30,396 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:38:30,500 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:30,500 INFO : Inserting sp|P21246|PTN_HUMAN
15 Dec 2023 01:38:30,564 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:30,564 INFO : Inserting sp|P21281|VATB2_HUMAN
15 Dec 2023 01:38:30,624 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:30,624 INFO : Inserting sp|P21291|CSRP1_HUMAN
15 Dec 2023 01:38:30,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:30,646 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:38:31,644 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:32,705 DEBUG: Total peptides inserted: 90
15 Dec 2023 01:38:32,705 INFO : Inserting sp|P21741|MK_HUMAN
15 Dec 2023 01:38:32,722 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:32,722 INFO : Inserting sp|P21796|VDAC1_HUMAN
15 Dec 2023 01:38:32,801 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:32,801 INFO : Inserting sp|P21802|FGFR2_HUMAN
15 Dec 2023 01:38:32,876 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:32,876 INFO : Inserting sp|P21810|PGS1_HUMAN
15 Dec 2023 01:38:32,934 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:32,934 INFO : Inserting sp|P21817|RYR1_HUMAN
15 Dec 2023 01:38:32,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:32,985 INFO : Inserting sp|P21926|CD9_HUMAN
15 Dec 2023 01:38:33,038 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:33,039 INFO : Inserting sp|P21980|TGM2_HUMAN
15 Dec 2023 01:38:33,055 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:33,055 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 01:38:33,174 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:33,174 INFO : Inserting sp|P22079|PERL_HUMAN
15 Dec 2023 01:38:33,224 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:33,225 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 01:38:33,510 INFO : 59% Done
15 Dec 2023 01:38:34,493 DEBUG: Inserted 50 peptides
15 Dec 2023 01:38:34,596 DEBUG: Total peptides inserted: 55
15 Dec 2023 01:38:34,596 INFO : Inserting sp|P22234|PUR6_HUMAN
15 Dec 2023 01:38:34,654 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:34,655 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:38:35,124 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:38:35,124 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:38:35,500 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:38:35,500 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 01:38:35,682 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:35,683 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:38:35,895 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:38:35,895 INFO : Inserting sp|P22692|IBP4_HUMAN
15 Dec 2023 01:38:36,117 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:36,117 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:38:37,177 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:38:37,177 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 01:38:37,571 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:37,571 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 01:38:37,665 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:37,665 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:38:37,870 INFO : 60% Done
15 Dec 2023 01:38:38,216 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:38:38,216 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 01:38:38,326 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:38,326 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 01:38:38,512 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:38,512 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:38:39,571 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:38:39,571 INFO : Inserting sp|P23246|SFPQ_HUMAN
15 Dec 2023 01:38:39,679 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:39,679 INFO : Inserting sp|P23276|KELL_HUMAN
15 Dec 2023 01:38:39,823 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:39,823 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:38:40,012 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:40,012 INFO : Inserting sp|P23368|MAOM_HUMAN
15 Dec 2023 01:38:40,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:40,056 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 01:38:40,321 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:40,321 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 01:38:40,484 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:40,485 INFO : Inserting sp|P23469|PTPRE_HUMAN
15 Dec 2023 01:38:40,507 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:40,507 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 01:38:40,610 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:40,610 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:38:40,892 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:40,892 INFO : Inserting sp|P23515|OMGP_HUMAN
15 Dec 2023 01:38:41,047 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:41,047 INFO : Inserting sp|P23526|SAHH_HUMAN
15 Dec 2023 01:38:41,365 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:41,365 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:38:41,491 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:41,491 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:38:41,846 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:38:41,846 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 01:38:42,058 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:42,058 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:38:42,212 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:42,212 INFO : Inserting sp|P24534|EF1B_HUMAN
15 Dec 2023 01:38:42,224 INFO : 61% Done
15 Dec 2023 01:38:42,283 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:42,283 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:38:42,474 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:42,474 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 01:38:42,677 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:42,677 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 01:38:42,828 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:42,828 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 01:38:43,452 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:38:43,453 INFO : Inserting sp|P25054|APC_HUMAN
15 Dec 2023 01:38:43,479 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:43,479 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 01:38:43,530 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:43,530 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:38:44,321 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:38:44,321 INFO : Inserting sp|P25325|THTM_HUMAN
15 Dec 2023 01:38:44,401 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:44,402 INFO : Inserting sp|P25705|ATPA_HUMAN
15 Dec 2023 01:38:44,479 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:44,479 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 01:38:44,627 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:44,627 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 01:38:44,879 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:44,879 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:38:45,074 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:45,074 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 01:38:45,153 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:45,153 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:38:45,324 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:38:45,324 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:38:45,378 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:45,378 INFO : Inserting sp|P26022|PTX3_HUMAN
15 Dec 2023 01:38:45,494 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:45,494 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:38:46,499 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:38:46,499 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 01:38:46,512 INFO : 62% Done
15 Dec 2023 01:38:46,594 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:46,594 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 01:38:46,640 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:46,640 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 01:38:46,794 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:46,794 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:38:46,859 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:46,859 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:38:46,930 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:46,930 INFO : Inserting sp|P26885|FKBP2_HUMAN
15 Dec 2023 01:38:46,962 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:46,962 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 01:38:47,679 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:38:47,679 INFO : Inserting sp|P26951|IL3RA_HUMAN
15 Dec 2023 01:38:47,693 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:47,694 INFO : Inserting sp|P26992|CNTFR_HUMAN
15 Dec 2023 01:38:47,707 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:47,707 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 01:38:47,961 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:47,961 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:38:48,709 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:38:48,709 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 01:38:49,036 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:49,036 INFO : Inserting sp|P27487|DPP4_HUMAN
15 Dec 2023 01:38:49,300 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:49,300 INFO : Imported 700 peptide groups.
15 Dec 2023 01:38:49,300 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:38:49,427 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:49,427 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:38:49,664 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:38:49,665 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 01:38:49,757 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:49,757 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 01:38:50,319 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:50,320 INFO : Inserting sp|P28062|PSB8_HUMAN
15 Dec 2023 01:38:50,524 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:50,524 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 01:38:50,538 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:50,538 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 01:38:50,660 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:50,660 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 01:38:50,790 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:50,790 INFO : Inserting sp|P28072|PSB6_HUMAN
15 Dec 2023 01:38:50,822 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:50,822 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 01:38:50,928 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:50,928 INFO : Inserting sp|P28289|TMOD1_HUMAN
15 Dec 2023 01:38:50,987 INFO : 63% Done
15 Dec 2023 01:38:51,060 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:51,060 INFO : Inserting sp|P28300|LYOX_HUMAN
15 Dec 2023 01:38:51,089 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:51,089 INFO : Inserting sp|P28676|GRAN_HUMAN
15 Dec 2023 01:38:51,260 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:38:51,260 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 01:38:51,316 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:51,316 INFO : Inserting sp|P28827|PTPRM_HUMAN
15 Dec 2023 01:38:51,377 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:51,378 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:38:51,613 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:38:51,613 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 01:38:51,755 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:51,755 INFO : Inserting sp|P29279|CCN2_HUMAN
15 Dec 2023 01:38:51,771 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:51,771 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:38:52,061 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:38:52,061 INFO : Inserting sp|P29400|CO4A5_HUMAN
15 Dec 2023 01:38:52,092 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:52,092 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:38:52,755 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:38:52,755 INFO : Inserting sp|P29466|CASP1_HUMAN
15 Dec 2023 01:38:52,817 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:52,817 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:38:54,269 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:38:54,270 INFO : Inserting sp|P29692|EF1D_HUMAN
15 Dec 2023 01:38:54,319 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:54,319 INFO : Inserting sp|P29972|AQP1_HUMAN
15 Dec 2023 01:38:54,343 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:54,343 INFO : Inserting sp|P30040|ERP29_HUMAN
15 Dec 2023 01:38:54,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:54,357 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:38:54,667 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:38:54,667 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:38:55,094 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:55,095 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 01:38:55,156 INFO : 64% Done
15 Dec 2023 01:38:55,407 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:55,407 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:38:55,542 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:55,542 INFO : Inserting sp|P30048|PRDX3_HUMAN
15 Dec 2023 01:38:55,666 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:38:55,666 INFO : Inserting sp|P30050|RL12_HUMAN
15 Dec 2023 01:38:55,721 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:55,721 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 01:38:55,785 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:55,785 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 01:38:56,296 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:38:56,296 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 01:38:56,645 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:38:56,645 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 01:38:56,846 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:56,846 INFO : Inserting sp|P30520|PURA2_HUMAN
15 Dec 2023 01:38:57,058 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:38:57,058 INFO : Inserting sp|P30530|UFO_HUMAN
15 Dec 2023 01:38:57,289 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:38:57,289 INFO : Inserting sp|P30566|PUR8_HUMAN
15 Dec 2023 01:38:57,403 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:38:57,403 INFO : Inserting sp|P30613|KPYR_HUMAN
15 Dec 2023 01:38:57,457 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:57,457 INFO : Inserting sp|P30711|GSTT1_HUMAN
15 Dec 2023 01:38:57,508 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:57,508 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:38:58,298 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:38:58,298 INFO : Inserting sp|P31025|LCN1_HUMAN
15 Dec 2023 01:38:58,330 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:38:58,330 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:38:58,699 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:38:58,699 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:38:59,200 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:38:59,200 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 01:38:59,591 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:38:59,591 INFO : Inserting sp|P31943|HNRH1_HUMAN
15 Dec 2023 01:38:59,615 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:38:59,615 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:38:59,639 INFO : 65% Done
15 Dec 2023 01:38:59,986 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:38:59,986 INFO : Inserting sp|P31947|1433S_HUMAN
15 Dec 2023 01:39:00,127 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:00,127 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 01:39:00,442 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:00,443 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:39:00,464 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:00,464 INFO : Inserting sp|P31995|FCG2C_HUMAN
15 Dec 2023 01:39:00,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:00,478 INFO : Inserting sp|P31997|CEAM8_HUMAN
15 Dec 2023 01:39:00,519 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:00,519 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 01:39:00,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:00,592 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:39:00,967 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:39:00,967 INFO : Inserting sp|P32320|CDD_HUMAN
15 Dec 2023 01:39:01,049 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:01,049 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:39:01,309 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:01,309 INFO : Inserting sp|P32456|GBP2_HUMAN
15 Dec 2023 01:39:01,385 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:01,385 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 01:39:01,453 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:01,453 INFO : Inserting sp|P33151|CADH5_HUMAN
15 Dec 2023 01:39:01,543 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:01,543 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 01:39:01,558 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:01,558 INFO : Inserting sp|P33763|S10A5_HUMAN
15 Dec 2023 01:39:01,562 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:01,562 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:39:01,686 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:01,687 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:39:02,170 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:02,170 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 01:39:02,269 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:02,269 INFO : Inserting sp|P34931|HS71L_HUMAN
15 Dec 2023 01:39:02,542 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:39:02,542 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 01:39:02,910 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:02,910 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 01:39:02,962 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:02,962 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 01:39:02,995 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:02,995 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 01:39:03,147 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:03,147 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 01:39:03,515 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:03,515 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 01:39:03,713 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:03,713 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 01:39:03,953 INFO : 66% Done
15 Dec 2023 01:39:04,131 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:04,131 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:39:05,270 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:39:05,270 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:39:05,868 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:39:05,868 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:39:07,313 DEBUG: Inserted 50 peptides
15 Dec 2023 01:39:08,126 INFO : 67% Done
15 Dec 2023 01:39:09,111 DEBUG: Inserted 100 peptides
15 Dec 2023 01:39:09,610 DEBUG: Total peptides inserted: 114
15 Dec 2023 01:39:09,610 INFO : Inserting sp|P35580|MYH10_HUMAN
15 Dec 2023 01:39:10,106 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:39:10,106 INFO : Inserting sp|P35590|TIE1_HUMAN
15 Dec 2023 01:39:10,129 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:10,129 INFO : Inserting sp|P35611|ADDA_HUMAN
15 Dec 2023 01:39:10,316 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:10,316 INFO : Inserting sp|P35612|ADDB_HUMAN
15 Dec 2023 01:39:10,692 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:39:10,692 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 01:39:10,733 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:10,733 INFO : Inserting sp|P35626|ARBK2_HUMAN
15 Dec 2023 01:39:10,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:10,779 INFO : Inserting sp|P35637|FUS_HUMAN
15 Dec 2023 01:39:10,803 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:10,803 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 01:39:10,985 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:10,986 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:39:12,241 INFO : 68% Done
15 Dec 2023 01:39:12,383 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:39:12,383 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 01:39:13,093 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:39:13,093 INFO : Inserting sp|P35916|VGFR3_HUMAN
15 Dec 2023 01:39:13,282 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:13,282 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:39:13,706 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:13,706 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:39:13,898 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:13,898 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:39:14,776 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:39:14,777 INFO : Inserting sp|P36959|GMPR1_HUMAN
15 Dec 2023 01:39:14,791 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:14,792 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:39:14,996 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:14,996 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 01:39:15,245 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:15,245 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:39:15,736 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:39:15,736 INFO : Inserting sp|P37840|SYUA_HUMAN
15 Dec 2023 01:39:15,784 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:15,784 INFO : Inserting sp|P38159|RBMX_HUMAN
15 Dec 2023 01:39:15,819 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:15,819 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 01:39:15,990 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:15,990 INFO : Inserting sp|P38646|GRP75_HUMAN
15 Dec 2023 01:39:16,037 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:16,037 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 01:39:16,304 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:16,305 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 01:39:16,422 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:16,422 INFO : Imported 800 peptide groups.
15 Dec 2023 01:39:16,422 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 01:39:16,604 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:16,604 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 01:39:16,648 INFO : 69% Done
15 Dec 2023 01:39:16,744 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:16,744 INFO : Inserting sp|P40197|GPV_HUMAN
15 Dec 2023 01:39:16,907 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:16,908 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 01:39:17,005 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:17,005 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 01:39:17,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:17,056 INFO : Inserting sp|P40763|STAT3_HUMAN
15 Dec 2023 01:39:17,096 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:17,096 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:39:17,338 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:17,339 INFO : Inserting sp|P40926|MDHM_HUMAN
15 Dec 2023 01:39:17,543 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:17,543 INFO : Inserting sp|P41218|MNDA_HUMAN
15 Dec 2023 01:39:17,989 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:39:17,990 INFO : Inserting sp|P41219|PERI_HUMAN
15 Dec 2023 01:39:18,078 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:18,078 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:39:18,411 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:18,411 INFO : Inserting sp|P41271|NBL1_HUMAN
15 Dec 2023 01:39:18,451 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:18,451 INFO : Inserting sp|P42126|ECI1_HUMAN
15 Dec 2023 01:39:18,467 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:18,467 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 01:39:18,622 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:18,622 INFO : Inserting sp|P42765|THIM_HUMAN
15 Dec 2023 01:39:18,682 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:18,682 INFO : Inserting sp|P42768|WASP_HUMAN
15 Dec 2023 01:39:18,749 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:18,750 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 01:39:18,832 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:18,832 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:39:18,927 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:18,927 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 01:39:19,195 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:19,195 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 01:39:19,683 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:39:19,683 INFO : Inserting sp|P43487|RANG_HUMAN
15 Dec 2023 01:39:19,751 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:19,751 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 01:39:20,198 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:39:20,198 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:39:20,868 INFO : 70% Done
15 Dec 2023 01:39:21,319 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:39:21,319 INFO : Inserting sp|P45877|PPIC_HUMAN
15 Dec 2023 01:39:21,341 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:21,341 INFO : Inserting sp|P45880|VDAC2_HUMAN
15 Dec 2023 01:39:21,364 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:21,365 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 01:39:21,398 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:21,398 INFO : Inserting sp|P46100|ATRX_HUMAN
15 Dec 2023 01:39:21,413 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:21,413 INFO : Inserting sp|P46781|RS9_HUMAN
15 Dec 2023 01:39:21,452 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:21,452 INFO : Inserting sp|P46926|GNPI1_HUMAN
15 Dec 2023 01:39:21,571 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:21,572 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:39:22,300 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:39:22,300 INFO : Inserting sp|P46976|GLYG_HUMAN
15 Dec 2023 01:39:22,346 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:22,346 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:39:22,584 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:22,584 INFO : Inserting sp|P48047|ATPO_HUMAN
15 Dec 2023 01:39:22,634 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:22,634 INFO : Inserting sp|P48147|PPCE_HUMAN
15 Dec 2023 01:39:22,740 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:22,740 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 01:39:22,788 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:22,788 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 01:39:23,170 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:23,170 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 01:39:23,271 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:23,271 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:39:23,401 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:23,401 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 01:39:23,580 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:23,580 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 01:39:23,622 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:23,622 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 01:39:24,152 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:39:24,152 INFO : Inserting sp|P48723|HSP13_HUMAN
15 Dec 2023 01:39:24,194 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:24,194 INFO : Inserting sp|P48729|KC1A_HUMAN
15 Dec 2023 01:39:24,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:24,231 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 01:39:24,372 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:24,372 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 01:39:24,910 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:39:24,910 INFO : Inserting sp|P48745|CCN3_HUMAN
15 Dec 2023 01:39:24,956 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:24,956 INFO : Inserting sp|P48960|AGRE5_HUMAN
15 Dec 2023 01:39:24,969 INFO : 71% Done
15 Dec 2023 01:39:25,038 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:25,038 INFO : Inserting sp|P49116|NR2C2_HUMAN
15 Dec 2023 01:39:25,053 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:25,053 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 01:39:25,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:25,074 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 01:39:25,157 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:25,157 INFO : Inserting sp|P49327|FAS_HUMAN
15 Dec 2023 01:39:25,228 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:25,228 INFO : Inserting sp|P49368|TCPG_HUMAN
15 Dec 2023 01:39:25,316 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:25,316 INFO : Inserting sp|P49441|INPP_HUMAN
15 Dec 2023 01:39:25,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:25,347 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:39:25,470 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:25,470 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 01:39:25,657 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:25,657 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:39:25,799 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:25,799 INFO : Inserting sp|P49746|TSP3_HUMAN
15 Dec 2023 01:39:25,850 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:25,850 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 01:39:26,295 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:39:26,295 INFO : Inserting sp|P49755|TMEDA_HUMAN
15 Dec 2023 01:39:26,318 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:26,318 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:39:26,548 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:26,548 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 01:39:26,616 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:26,617 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:39:27,270 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:39:27,270 INFO : Inserting sp|P50416|CPT1A_HUMAN
15 Dec 2023 01:39:27,326 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:27,326 INFO : Inserting sp|P50452|SPB8_HUMAN
15 Dec 2023 01:39:27,432 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:27,432 INFO : Inserting sp|P50453|SPB9_HUMAN
15 Dec 2023 01:39:27,721 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:27,721 INFO : Inserting sp|P50502|F10A1_HUMAN
15 Dec 2023 01:39:27,786 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:27,787 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 01:39:28,019 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:28,019 INFO : Inserting sp|P50750|CDK9_HUMAN
15 Dec 2023 01:39:28,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:28,071 INFO : Inserting sp|P50895|BCAM_HUMAN
15 Dec 2023 01:39:28,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:28,096 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 01:39:28,328 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:28,328 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 01:39:28,549 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:28,549 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 01:39:28,711 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:28,711 INFO : Inserting sp|P51148|RAB5C_HUMAN
15 Dec 2023 01:39:28,739 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:28,739 INFO : Inserting sp|P51149|RAB7A_HUMAN
15 Dec 2023 01:39:28,886 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:28,887 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 01:39:28,942 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:28,942 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 01:39:29,049 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:29,049 INFO : Inserting sp|P51668|UB2D1_HUMAN
15 Dec 2023 01:39:29,090 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:29,090 INFO : Inserting sp|P51674|GPM6A_HUMAN
15 Dec 2023 01:39:29,120 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:29,121 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 01:39:29,323 INFO : 72% Done
15 Dec 2023 01:39:29,536 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:39:29,536 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 01:39:29,614 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:29,614 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:39:30,152 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:30,152 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 01:39:30,219 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:30,219 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:39:30,831 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:39:30,831 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 01:39:30,945 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:30,945 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:39:31,410 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:31,411 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:39:31,463 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:31,463 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:39:31,775 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:31,775 INFO : Inserting sp|P52823|STC1_HUMAN
15 Dec 2023 01:39:31,804 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:31,804 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 01:39:32,012 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:32,012 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 01:39:32,217 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:32,217 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:39:32,504 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:32,504 INFO : Inserting sp|P53621|COPA_HUMAN
15 Dec 2023 01:39:32,518 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:32,518 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 01:39:32,663 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:32,663 INFO : Inserting sp|P53675|CLH2_HUMAN
15 Dec 2023 01:39:32,794 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:32,794 INFO : Inserting sp|P53804|TTC3_HUMAN
15 Dec 2023 01:39:32,808 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:32,808 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 01:39:32,970 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:32,970 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 01:39:33,333 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:33,333 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 01:39:33,421 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:33,421 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 01:39:33,488 INFO : 73% Done
15 Dec 2023 01:39:33,666 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:33,666 INFO : Inserting sp|P54709|AT1B3_HUMAN
15 Dec 2023 01:39:33,687 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:33,687 INFO : Imported 900 peptide groups.
15 Dec 2023 01:39:33,687 INFO : Inserting sp|P54725|RD23A_HUMAN
15 Dec 2023 01:39:33,767 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:33,767 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 01:39:33,780 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:33,780 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 01:39:33,960 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:33,960 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 01:39:34,117 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:34,117 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 01:39:34,185 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:34,185 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 01:39:34,269 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:34,269 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 01:39:34,294 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:34,294 INFO : Inserting sp|P55056|APOC4_HUMAN
15 Dec 2023 01:39:34,579 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:34,579 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:39:35,541 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:39:35,541 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:39:36,395 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:39:36,395 INFO : Inserting sp|P55209|NP1L1_HUMAN
15 Dec 2023 01:39:36,456 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:36,456 INFO : Inserting sp|P55212|CASP6_HUMAN
15 Dec 2023 01:39:36,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:36,500 INFO : Inserting sp|P55263|ADK_HUMAN
15 Dec 2023 01:39:36,560 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:36,560 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 01:39:36,628 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:36,628 INFO : Inserting sp|P55283|CADH4_HUMAN
15 Dec 2023 01:39:36,659 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:36,659 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 01:39:36,692 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:36,692 INFO : Inserting sp|P55290|CAD13_HUMAN
15 Dec 2023 01:39:36,857 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:36,857 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 01:39:37,028 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:37,028 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 01:39:37,059 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:37,059 INFO : Inserting sp|P55854|SUMO3_HUMAN
15 Dec 2023 01:39:37,074 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:37,074 INFO : Inserting sp|P55884|EIF3B_HUMAN
15 Dec 2023 01:39:37,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:37,096 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:39:37,251 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:37,251 INFO : Inserting sp|P57081|WDR4_HUMAN
15 Dec 2023 01:39:37,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:37,274 INFO : Inserting sp|P57087|JAM2_HUMAN
15 Dec 2023 01:39:37,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:37,288 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 01:39:37,329 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:37,330 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 01:39:37,580 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:37,580 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:39:37,712 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:37,712 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:39:37,797 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:37,797 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:39:37,884 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:37,884 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 01:39:38,029 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:38,029 INFO : Inserting sp|P60033|CD81_HUMAN
15 Dec 2023 01:39:38,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:38,071 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:39:38,210 INFO : 74% Done
15 Dec 2023 01:39:38,365 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:38,365 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:39:38,564 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:38,565 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:39:39,295 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:39:39,295 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 01:39:39,403 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:39,403 INFO : Inserting sp|P60891|PRPS1_HUMAN
15 Dec 2023 01:39:39,467 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:39,467 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 01:39:39,703 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:39,703 INFO : Inserting sp|P60953|CDC42_HUMAN
15 Dec 2023 01:39:39,781 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:39,781 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 01:39:39,835 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:39,835 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 01:39:39,866 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:39,867 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 01:39:39,952 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:39,952 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:39:40,284 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:40,284 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:39:40,544 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:39:40,544 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 01:39:40,567 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:40,567 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 01:39:40,619 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:40,619 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 01:39:40,680 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:40,680 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 01:39:40,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:40,704 INFO : Inserting sp|P61326|MGN_HUMAN
15 Dec 2023 01:39:40,726 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:40,727 INFO : Inserting sp|P61513|RL37A_HUMAN
15 Dec 2023 01:39:40,741 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:40,741 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 01:39:40,823 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:40,823 INFO : Inserting sp|P61604|CH10_HUMAN
15 Dec 2023 01:39:40,874 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:40,874 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:39:41,113 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:41,113 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:39:41,151 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:41,151 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:39:41,289 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:41,289 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:39:41,394 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:41,395 INFO : Inserting sp|P61956|SUMO2_HUMAN
15 Dec 2023 01:39:41,411 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:41,411 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 01:39:41,596 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:41,596 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 01:39:41,644 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:41,644 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:39:41,908 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:41,908 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:39:42,032 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:42,033 INFO : Inserting sp|P62191|PRS4_HUMAN
15 Dec 2023 01:39:42,101 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:42,102 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 01:39:42,663 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:39:42,663 INFO : Inserting sp|P62310|LSM3_HUMAN
15 Dec 2023 01:39:42,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,696 INFO : Inserting sp|P62316|SMD2_HUMAN
15 Dec 2023 01:39:42,732 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,732 INFO : Inserting sp|P62318|SMD3_HUMAN
15 Dec 2023 01:39:42,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,758 INFO : Inserting sp|P62328|TYB4_HUMAN
15 Dec 2023 01:39:42,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,795 INFO : Inserting sp|P62333|PRS10_HUMAN
15 Dec 2023 01:39:42,809 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,809 INFO : Inserting sp|P62714|PP2AB_HUMAN
15 Dec 2023 01:39:42,824 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:42,824 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:39:43,227 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:39:43,227 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:39:43,588 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:39:43,589 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:39:43,727 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:39:43,727 INFO : Inserting sp|P62820|RAB1A_HUMAN
15 Dec 2023 01:39:43,840 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:43,840 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:39:44,025 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:44,025 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 01:39:44,060 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:44,061 INFO : Inserting sp|P62873|GBB1_HUMAN
15 Dec 2023 01:39:44,137 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:44,137 INFO : Inserting sp|P62888|RL30_HUMAN
15 Dec 2023 01:39:44,162 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:44,162 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 01:39:44,435 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:44,435 INFO : Inserting sp|P62942|FKB1A_HUMAN
15 Dec 2023 01:39:44,487 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:44,487 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 01:39:44,642 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:44,642 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 01:39:44,794 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:44,794 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 01:39:44,899 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:44,900 INFO : Inserting sp|P63000|RAC1_HUMAN
15 Dec 2023 01:39:44,943 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:44,943 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 01:39:45,017 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:45,017 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 01:39:45,076 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:45,076 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:39:45,531 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:39:45,531 INFO : Inserting sp|P63208|SKP1_HUMAN
15 Dec 2023 01:39:45,565 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:45,565 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 01:39:45,693 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:45,694 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 01:39:45,782 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:45,782 INFO : Inserting sp|P63279|UBC9_HUMAN
15 Dec 2023 01:39:45,815 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:45,815 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 01:39:45,829 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:45,829 INFO : Inserting sp|P67809|YBOX1_HUMAN
15 Dec 2023 01:39:45,842 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:45,842 INFO : Inserting sp|P67936|TPM4_HUMAN
15 Dec 2023 01:39:46,128 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:46,128 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 01:39:46,541 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:39:46,541 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 01:39:46,593 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:46,593 INFO : Inserting sp|P68104|EF1A1_HUMAN
15 Dec 2023 01:39:46,639 INFO : 75% Done
15 Dec 2023 01:39:46,706 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:46,706 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:39:47,004 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:47,004 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 01:39:47,288 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:47,288 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 01:39:47,550 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:47,550 INFO : Inserting sp|P68402|PA1B2_HUMAN
15 Dec 2023 01:39:47,650 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:47,650 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 01:39:47,700 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:47,700 INFO : Imported 1000 peptide groups.
15 Dec 2023 01:39:47,700 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:39:48,687 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:39:48,687 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:39:49,146 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:49,146 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:39:49,553 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:49,553 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:39:50,655 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:39:50,655 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 01:39:50,929 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:39:50,929 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 01:39:50,940 INFO : 76% Done
15 Dec 2023 01:39:51,111 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:51,111 INFO : Inserting sp|P78380|OLR1_HUMAN
15 Dec 2023 01:39:51,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:51,125 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 01:39:51,433 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:51,433 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 01:39:52,488 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:39:52,488 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:39:52,905 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:39:52,905 INFO : Inserting sp|P80297|MT1X_HUMAN
15 Dec 2023 01:39:52,921 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:52,921 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 01:39:52,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:52,975 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:39:53,052 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,052 INFO : Inserting sp|P80723|BASP1_HUMAN
15 Dec 2023 01:39:53,078 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,078 INFO : Inserting sp|P81605|DCD_HUMAN
15 Dec 2023 01:39:53,144 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,144 INFO : Inserting sp|P82279|CRUM1_HUMAN
15 Dec 2023 01:39:53,195 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,195 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 01:39:53,248 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,248 INFO : Inserting sp|P84090|ERH_HUMAN
15 Dec 2023 01:39:53,263 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:53,263 INFO : Inserting sp|P84095|RHOG_HUMAN
15 Dec 2023 01:39:53,305 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:53,305 INFO : Inserting sp|P84103|SRSF3_HUMAN
15 Dec 2023 01:39:53,321 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:53,321 INFO : Inserting sp|P84243|H33_HUMAN
15 Dec 2023 01:39:53,372 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:39:53,372 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 01:39:53,395 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:53,396 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:39:53,592 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:53,592 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:39:54,575 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:39:54,575 INFO : Inserting sp|P98161|PKD1_HUMAN
15 Dec 2023 01:39:54,609 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:54,609 INFO : Inserting sp|Q00013|EM55_HUMAN
15 Dec 2023 01:39:54,625 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:54,625 INFO : Inserting sp|Q00325|MPCP_HUMAN
15 Dec 2023 01:39:54,645 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:54,645 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 01:39:54,980 INFO : 77% Done
15 Dec 2023 01:39:55,278 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:39:55,278 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 01:39:55,380 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:55,381 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:39:55,679 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:55,679 INFO : Inserting sp|Q01105|SET_HUMAN
15 Dec 2023 01:39:55,695 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:55,695 INFO : Inserting sp|Q01130|SRSF2_HUMAN
15 Dec 2023 01:39:55,711 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:55,711 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 01:39:55,883 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:39:55,884 INFO : Inserting sp|Q01484|ANK2_HUMAN
15 Dec 2023 01:39:56,055 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:56,055 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:39:56,632 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:39:56,632 INFO : Inserting sp|Q01546|K22O_HUMAN
15 Dec 2023 01:39:56,821 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:39:56,821 INFO : Inserting sp|Q01628|IFM3_HUMAN
15 Dec 2023 01:39:56,847 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:56,847 INFO : Inserting sp|Q01629|IFM2_HUMAN
15 Dec 2023 01:39:56,875 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:56,875 INFO : Inserting sp|Q02094|RHAG_HUMAN
15 Dec 2023 01:39:56,906 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:56,907 INFO : Inserting sp|Q02161|RHD_HUMAN
15 Dec 2023 01:39:56,944 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:56,944 INFO : Inserting sp|Q02224|CENPE_HUMAN
15 Dec 2023 01:39:56,973 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:56,973 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 01:39:57,399 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:39:57,400 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 01:39:57,514 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:57,514 INFO : Inserting sp|Q02809|PLOD1_HUMAN
15 Dec 2023 01:39:57,556 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:57,556 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 01:39:57,974 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:57,974 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 01:39:58,125 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:39:58,126 INFO : Inserting sp|Q03001|DYST_HUMAN
15 Dec 2023 01:39:58,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:58,139 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:39:58,196 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:58,196 INFO : Inserting sp|Q03252|LMNB2_HUMAN
15 Dec 2023 01:39:58,252 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:39:58,252 INFO : Inserting sp|Q03405|UPAR_HUMAN
15 Dec 2023 01:39:58,381 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:39:58,381 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:39:58,697 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:39:58,697 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:39:58,796 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:39:58,796 INFO : Inserting sp|Q04695|K1C17_HUMAN
15 Dec 2023 01:39:59,166 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:39:59,167 INFO : Inserting sp|Q04721|NOTC2_HUMAN
15 Dec 2023 01:39:59,180 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:39:59,180 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 01:39:59,193 INFO : 78% Done
15 Dec 2023 01:39:59,678 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:39:59,678 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 01:39:59,804 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:39:59,804 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 01:40:00,129 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:40:00,129 INFO : Inserting sp|Q05315|LEG10_HUMAN
15 Dec 2023 01:40:00,190 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:00,190 INFO : Inserting sp|Q05682|CALD1_HUMAN
15 Dec 2023 01:40:00,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:00,222 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:40:01,772 DEBUG: Total peptides inserted: 42
15 Dec 2023 01:40:01,772 INFO : Inserting sp|Q06210|GFPT1_HUMAN
15 Dec 2023 01:40:01,790 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:01,790 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:40:02,250 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:02,250 INFO : Inserting sp|Q06418|TYRO3_HUMAN
15 Dec 2023 01:40:02,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:02,288 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 01:40:02,529 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:02,529 INFO : Inserting sp|Q06828|FMOD_HUMAN
15 Dec 2023 01:40:02,611 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:02,611 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 01:40:02,988 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:02,989 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 01:40:03,684 INFO : 79% Done
15 Dec 2023 01:40:03,870 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:40:03,870 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 01:40:03,884 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:03,884 INFO : Inserting sp|Q08043|ACTN3_HUMAN
15 Dec 2023 01:40:04,198 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:04,198 INFO : Inserting sp|Q08211|DHX9_HUMAN
15 Dec 2023 01:40:04,246 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:04,246 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:40:04,980 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:40:04,980 INFO : Inserting sp|Q08397|LOXL1_HUMAN
15 Dec 2023 01:40:04,997 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:04,997 INFO : Inserting sp|Q08495|DEMA_HUMAN
15 Dec 2023 01:40:05,143 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:05,143 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 01:40:05,228 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:05,228 INFO : Inserting sp|Q08830|FGL1_HUMAN
15 Dec 2023 01:40:05,272 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:05,272 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:40:05,332 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:05,332 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 01:40:05,410 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:05,410 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 01:40:05,594 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:05,594 INFO : Inserting sp|Q10570|CPSF1_HUMAN
15 Dec 2023 01:40:05,627 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:05,627 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 01:40:05,858 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:05,858 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 01:40:05,911 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:05,912 INFO : Inserting sp|Q12797|ASPH_HUMAN
15 Dec 2023 01:40:05,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:05,952 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:40:06,362 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:40:06,362 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:40:06,670 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:06,670 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 01:40:07,354 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:40:07,354 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 01:40:07,378 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:07,379 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 01:40:07,399 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:07,399 INFO : Inserting sp|Q12884|SEPR_HUMAN
15 Dec 2023 01:40:07,459 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:07,459 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 01:40:07,530 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:07,530 INFO : Inserting sp|Q12907|LMAN2_HUMAN
15 Dec 2023 01:40:07,723 INFO : 80% Done
15 Dec 2023 01:40:07,825 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:40:07,825 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 01:40:08,196 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:08,196 INFO : Inserting sp|Q12931|TRAP1_HUMAN
15 Dec 2023 01:40:08,226 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,226 INFO : Inserting sp|Q12955|ANK3_HUMAN
15 Dec 2023 01:40:08,420 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:08,421 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 01:40:08,721 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:08,721 INFO : Inserting sp|Q13151|ROA0_HUMAN
15 Dec 2023 01:40:08,745 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,745 INFO : Inserting sp|Q13164|MK07_HUMAN
15 Dec 2023 01:40:08,803 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,803 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 01:40:08,828 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,829 INFO : Inserting sp|Q13188|STK3_HUMAN
15 Dec 2023 01:40:08,858 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,858 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 01:40:08,917 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:08,918 INFO : Inserting sp|Q13201|MMRN1_HUMAN
15 Dec 2023 01:40:09,081 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:09,081 INFO : Imported 1100 peptide groups.
15 Dec 2023 01:40:09,081 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 01:40:09,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:09,119 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 01:40:09,927 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:40:09,927 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:40:10,214 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:40:10,214 INFO : Inserting sp|Q13247|SRSF6_HUMAN
15 Dec 2023 01:40:10,241 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:10,241 INFO : Inserting sp|Q13285|STF1_HUMAN
15 Dec 2023 01:40:10,257 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:10,257 INFO : Inserting sp|Q13303|KCAB2_HUMAN
15 Dec 2023 01:40:10,283 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:10,283 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 01:40:10,507 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:10,507 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 01:40:10,648 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:10,648 INFO : Inserting sp|Q13418|ILK_HUMAN
15 Dec 2023 01:40:10,690 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:10,690 INFO : Inserting sp|Q13421|MSLN_HUMAN
15 Dec 2023 01:40:10,772 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:10,772 INFO : Inserting sp|Q13443|ADAM9_HUMAN
15 Dec 2023 01:40:10,825 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:10,825 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 01:40:10,958 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:10,958 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 01:40:11,082 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:11,083 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:40:11,133 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:11,133 INFO : Inserting sp|Q13526|PIN1_HUMAN
15 Dec 2023 01:40:11,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:11,156 INFO : Inserting sp|Q13596|SNX1_HUMAN
15 Dec 2023 01:40:11,182 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:11,182 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:40:11,497 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:11,497 INFO : Inserting sp|Q13765|NACA_HUMAN
15 Dec 2023 01:40:11,525 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:11,525 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 01:40:11,648 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:11,648 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 01:40:11,790 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:11,791 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:40:12,175 INFO : 81% Done
15 Dec 2023 01:40:12,609 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:40:12,609 INFO : Inserting sp|Q13838|DX39B_HUMAN
15 Dec 2023 01:40:12,677 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:12,677 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 01:40:12,760 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:12,760 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:40:12,834 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:12,834 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:40:12,934 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:12,934 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 01:40:13,262 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:40:13,263 INFO : Inserting sp|Q14118|DAG1_HUMAN
15 Dec 2023 01:40:13,523 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:13,523 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 01:40:13,557 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:13,557 INFO : Inserting sp|Q14141|SEPT6_HUMAN
15 Dec 2023 01:40:13,687 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:13,687 INFO : Inserting sp|Q14155|ARHG7_HUMAN
15 Dec 2023 01:40:13,707 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:13,707 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 01:40:13,807 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:13,807 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 01:40:13,885 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:13,885 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:40:14,075 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:14,075 INFO : Inserting sp|Q14344|GNA13_HUMAN
15 Dec 2023 01:40:14,130 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:14,131 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 01:40:14,171 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:14,171 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:40:14,845 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:40:14,845 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:40:15,468 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:40:15,468 INFO : Inserting sp|Q14533|KRT81_HUMAN
15 Dec 2023 01:40:15,566 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:15,566 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:40:16,448 INFO : 82% Done
15 Dec 2023 01:40:17,784 DEBUG: Inserted 50 peptides
15 Dec 2023 01:40:18,306 DEBUG: Total peptides inserted: 62
15 Dec 2023 01:40:18,307 INFO : Inserting sp|Q14651|PLSI_HUMAN
15 Dec 2023 01:40:18,448 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:18,448 INFO : Inserting sp|Q14678|KANK1_HUMAN
15 Dec 2023 01:40:18,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:18,478 INFO : Inserting sp|Q14679|TTLL4_HUMAN
15 Dec 2023 01:40:18,493 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:18,493 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:40:18,552 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:18,552 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 01:40:18,863 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:18,863 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 01:40:19,005 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:19,005 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 01:40:19,165 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:19,165 INFO : Inserting sp|Q14839|CHD4_HUMAN
15 Dec 2023 01:40:19,191 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:19,191 INFO : Inserting sp|Q14847|LASP1_HUMAN
15 Dec 2023 01:40:19,222 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:19,222 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:40:19,235 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:19,235 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:40:19,366 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:19,366 INFO : Inserting sp|Q14982|OPCM_HUMAN
15 Dec 2023 01:40:19,460 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:19,460 INFO : Inserting sp|Q14CM0|FRPD4_HUMAN
15 Dec 2023 01:40:19,551 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:19,551 INFO : Inserting sp|Q15029|U5S1_HUMAN
15 Dec 2023 01:40:19,575 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:19,575 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 01:40:19,596 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:19,596 INFO : Inserting sp|Q15061|WDR43_HUMAN
15 Dec 2023 01:40:19,632 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:19,632 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 01:40:19,736 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:19,736 INFO : Inserting sp|Q15072|OZF_HUMAN
15 Dec 2023 01:40:19,765 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:19,765 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 01:40:19,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:19,868 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 01:40:19,947 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:19,947 INFO : Inserting sp|Q15102|PA1B3_HUMAN
15 Dec 2023 01:40:20,113 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:20,113 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:40:20,596 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:40:20,596 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 01:40:20,655 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:20,655 INFO : Inserting sp|Q15166|PON3_HUMAN
15 Dec 2023 01:40:20,870 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:20,871 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 01:40:20,906 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:20,906 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 01:40:20,936 INFO : 83% Done
15 Dec 2023 01:40:20,960 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:20,960 INFO : Inserting sp|Q15233|NONO_HUMAN
15 Dec 2023 01:40:20,991 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:20,991 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 01:40:21,116 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:21,116 INFO : Inserting sp|Q15286|RAB35_HUMAN
15 Dec 2023 01:40:21,159 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:21,159 INFO : Inserting sp|Q15323|K1H1_HUMAN
15 Dec 2023 01:40:21,269 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:21,269 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 01:40:21,318 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:21,318 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 01:40:21,359 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:21,359 INFO : Inserting sp|Q15393|SF3B3_HUMAN
15 Dec 2023 01:40:21,388 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:21,388 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 01:40:21,444 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:21,444 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 01:40:21,646 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:21,646 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:40:22,607 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:40:22,607 INFO : Inserting sp|Q15631|TSN_HUMAN
15 Dec 2023 01:40:22,674 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:22,674 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 01:40:22,743 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:22,743 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:40:22,996 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:22,996 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 01:40:23,012 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:23,012 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 01:40:23,148 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:23,148 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:40:23,238 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:23,238 INFO : Inserting sp|Q15843|NEDD8_HUMAN
15 Dec 2023 01:40:23,297 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:23,297 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 01:40:23,477 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:23,477 INFO : Inserting sp|Q15904|VAS1_HUMAN
15 Dec 2023 01:40:23,629 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:23,629 INFO : Inserting sp|Q15907|RB11B_HUMAN
15 Dec 2023 01:40:23,785 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:23,785 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 01:40:23,928 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:23,928 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 01:40:23,952 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:23,952 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:40:24,305 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:24,305 INFO : Inserting sp|Q16394|EXT1_HUMAN
15 Dec 2023 01:40:24,328 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:24,328 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 01:40:24,384 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:24,384 INFO : Inserting sp|Q16543|CDC37_HUMAN
15 Dec 2023 01:40:24,460 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:24,460 INFO : Inserting sp|Q16555|DPYL2_HUMAN
15 Dec 2023 01:40:24,632 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:24,632 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 01:40:25,291 INFO : 84% Done
15 Dec 2023 01:40:25,536 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:40:25,536 INFO : Inserting sp|Q16620|NTRK2_HUMAN
15 Dec 2023 01:40:25,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:25,568 INFO : Inserting sp|Q16627|CCL14_HUMAN
15 Dec 2023 01:40:25,592 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:25,593 INFO : Inserting sp|Q16629|SRSF7_HUMAN
15 Dec 2023 01:40:25,607 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:25,608 INFO : Inserting sp|Q16635|TAZ_HUMAN
15 Dec 2023 01:40:25,647 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:25,647 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 01:40:25,676 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:25,676 INFO : Inserting sp|Q16658|FSCN1_HUMAN
15 Dec 2023 01:40:25,792 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:25,792 INFO : Inserting sp|Q16695|H31T_HUMAN
15 Dec 2023 01:40:25,842 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:25,842 INFO : Imported 1200 peptide groups.
15 Dec 2023 01:40:25,842 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 01:40:26,120 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:26,120 INFO : Inserting sp|Q16769|QPCT_HUMAN
15 Dec 2023 01:40:26,183 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:26,183 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 01:40:26,351 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:26,351 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:40:26,489 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:26,489 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:40:26,614 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:26,614 INFO : Inserting sp|Q16850|CP51A_HUMAN
15 Dec 2023 01:40:26,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:26,646 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:40:26,936 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:26,937 INFO : Inserting sp|Q16853|AOC3_HUMAN
15 Dec 2023 01:40:27,084 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:27,084 INFO : Inserting sp|Q16880|CGT_HUMAN
15 Dec 2023 01:40:27,153 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:27,153 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 01:40:27,343 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:27,343 INFO : Inserting sp|Q2TBE0|C19L2_HUMAN
15 Dec 2023 01:40:27,392 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:27,392 INFO : Inserting sp|Q32MZ4|LRRF1_HUMAN
15 Dec 2023 01:40:27,464 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:27,464 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 01:40:27,485 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,485 INFO : Inserting sp|Q3V6T2|GRDN_HUMAN
15 Dec 2023 01:40:27,501 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,501 INFO : Inserting sp|Q460N5|PAR14_HUMAN
15 Dec 2023 01:40:27,519 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,519 INFO : Inserting sp|Q49A17|GLTL6_HUMAN
15 Dec 2023 01:40:27,552 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,552 INFO : Inserting sp|Q4G0S4|C27C1_HUMAN
15 Dec 2023 01:40:27,569 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,570 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:40:27,700 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:27,700 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:40:27,740 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:27,740 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 01:40:27,819 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:27,819 INFO : Inserting sp|Q5JRX3|PREP_HUMAN
15 Dec 2023 01:40:27,852 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:27,852 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 01:40:27,921 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:27,921 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 01:40:28,075 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:28,075 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:40:28,233 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:28,233 INFO : Inserting sp|Q5T3U5|MRP7_HUMAN
15 Dec 2023 01:40:28,293 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,294 INFO : Inserting sp|Q5T7B8|KIF24_HUMAN
15 Dec 2023 01:40:28,320 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,320 INFO : Inserting sp|Q5TDH0|DDI2_HUMAN
15 Dec 2023 01:40:28,385 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:28,386 INFO : Inserting sp|Q5THR3|EFCB6_HUMAN
15 Dec 2023 01:40:28,413 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,413 INFO : Inserting sp|Q5VST9|OBSCN_HUMAN
15 Dec 2023 01:40:28,480 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,480 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:40:28,520 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:28,520 INFO : Inserting sp|Q5VY43|PEAR1_HUMAN
15 Dec 2023 01:40:28,544 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,545 INFO : Inserting sp|Q5VYS8|TUT7_HUMAN
15 Dec 2023 01:40:28,595 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,595 INFO : Inserting sp|Q5VZM2|RRAGB_HUMAN
15 Dec 2023 01:40:28,636 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,636 INFO : Inserting sp|Q5XKE5|K2C79_HUMAN
15 Dec 2023 01:40:28,843 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:28,843 INFO : Inserting sp|Q5XKL5|BTBD8_HUMAN
15 Dec 2023 01:40:28,869 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,869 INFO : Inserting sp|Q6EEV6|SUMO4_HUMAN
15 Dec 2023 01:40:28,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:28,885 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:40:29,168 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:29,169 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 01:40:29,223 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:29,223 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:40:29,390 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:29,390 INFO : Inserting sp|Q6GTS8|P20D1_HUMAN
15 Dec 2023 01:40:29,445 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:29,445 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 01:40:29,721 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:29,721 INFO : Inserting sp|Q6ICL3|TNG2_HUMAN
15 Dec 2023 01:40:29,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:29,779 INFO : Inserting sp|Q6KC79|NIPBL_HUMAN
15 Dec 2023 01:40:29,818 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:29,818 INFO : Inserting sp|Q6P4A8|PLBL1_HUMAN
15 Dec 2023 01:40:29,827 INFO : 85% Done
15 Dec 2023 01:40:29,963 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:29,963 INFO : Inserting sp|Q6P988|NOTUM_HUMAN
15 Dec 2023 01:40:30,008 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:30,009 INFO : Inserting sp|Q6PL18|ATAD2_HUMAN
15 Dec 2023 01:40:30,035 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:30,035 INFO : Inserting sp|Q6UWE0|LRSM1_HUMAN
15 Dec 2023 01:40:30,101 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:30,101 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:40:30,257 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:30,257 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 01:40:30,499 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:30,499 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 01:40:30,826 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:30,826 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 01:40:30,875 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:30,875 INFO : Inserting sp|Q6UY14|ATL4_HUMAN
15 Dec 2023 01:40:30,907 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:30,907 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:40:31,072 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:31,072 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:40:31,285 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:31,285 INFO : Inserting sp|Q71DI3|H32_HUMAN
15 Dec 2023 01:40:31,334 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:31,334 INFO : Inserting sp|Q71RC2|LARP4_HUMAN
15 Dec 2023 01:40:31,365 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:31,365 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 01:40:31,981 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:40:31,981 INFO : Inserting sp|Q76N89|HECW1_HUMAN
15 Dec 2023 01:40:32,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,013 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 01:40:32,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,045 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 01:40:32,184 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:32,184 INFO : Inserting sp|Q7L9L4|MOB1B_HUMAN
15 Dec 2023 01:40:32,251 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:32,251 INFO : Inserting sp|Q7LFX5|CHSTF_HUMAN
15 Dec 2023 01:40:32,272 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,273 INFO : Inserting sp|Q7Z2Y5|NRK_HUMAN
15 Dec 2023 01:40:32,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,287 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 01:40:32,357 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:32,357 INFO : Inserting sp|Q7Z3S9|NT2NA_HUMAN
15 Dec 2023 01:40:32,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,371 INFO : Inserting sp|Q7Z3Y9|K1C26_HUMAN
15 Dec 2023 01:40:32,423 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:32,423 INFO : Inserting sp|Q7Z3Z0|K1C25_HUMAN
15 Dec 2023 01:40:32,498 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:32,498 INFO : Inserting sp|Q7Z406|MYH14_HUMAN
15 Dec 2023 01:40:32,797 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:32,797 INFO : Inserting sp|Q7Z5A7|TAFA5_HUMAN
15 Dec 2023 01:40:32,810 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:32,810 INFO : Inserting sp|Q7Z5K2|WAPL_HUMAN
15 Dec 2023 01:40:32,857 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:32,857 INFO : Inserting sp|Q7Z5R6|AB1IP_HUMAN
15 Dec 2023 01:40:32,933 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:32,933 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 01:40:33,029 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:33,029 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 01:40:33,270 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:33,270 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 01:40:33,849 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:40:33,849 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 01:40:33,898 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:33,898 INFO : Inserting sp|Q86SG5|S1A7A_HUMAN
15 Dec 2023 01:40:33,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:33,922 INFO : Inserting sp|Q86SQ4|AGRG6_HUMAN
15 Dec 2023 01:40:33,952 INFO : 86% Done
15 Dec 2023 01:40:33,969 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:33,969 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 01:40:33,993 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:33,993 INFO : Inserting sp|Q86UN3|R4RL2_HUMAN
15 Dec 2023 01:40:34,094 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:34,094 INFO : Inserting sp|Q86UX2|ITIH5_HUMAN
15 Dec 2023 01:40:34,165 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:34,165 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:40:34,861 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:40:34,861 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:40:35,777 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:40:35,777 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 01:40:36,003 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:36,004 INFO : Inserting sp|Q86VQ0|LCA5_HUMAN
15 Dec 2023 01:40:36,033 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,034 INFO : Inserting sp|Q86W74|ANR46_HUMAN
15 Dec 2023 01:40:36,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,066 INFO : Inserting sp|Q86WI1|PKHL1_HUMAN
15 Dec 2023 01:40:36,168 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:36,168 INFO : Inserting sp|Q86YT9|JAML_HUMAN
15 Dec 2023 01:40:36,220 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:36,220 INFO : Inserting sp|Q86YV9|HPS6_HUMAN
15 Dec 2023 01:40:36,282 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,282 INFO : Inserting sp|Q86YW5|TRML1_HUMAN
15 Dec 2023 01:40:36,327 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,327 INFO : Inserting sp|Q86YZ3|HORN_HUMAN
15 Dec 2023 01:40:36,371 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:36,371 INFO : Inserting sp|Q86Z02|HIPK1_HUMAN
15 Dec 2023 01:40:36,414 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,414 INFO : Inserting sp|Q8IU80|TMPS6_HUMAN
15 Dec 2023 01:40:36,467 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:36,467 INFO : Inserting sp|Q8IUE6|H2A2B_HUMAN
15 Dec 2023 01:40:36,605 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:36,605 INFO : Inserting sp|Q8IUG5|MY18B_HUMAN
15 Dec 2023 01:40:36,689 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:36,689 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:40:36,871 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:36,871 INFO : Inserting sp|Q8IV08|PLD3_HUMAN
15 Dec 2023 01:40:36,936 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:36,936 INFO : Inserting sp|Q8IWI9|MGAP_HUMAN
15 Dec 2023 01:40:36,966 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,966 INFO : Inserting sp|Q8IWL1|SFPA2_HUMAN
15 Dec 2023 01:40:36,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:36,986 INFO : Inserting sp|Q8IWL2|SFTA1_HUMAN
15 Dec 2023 01:40:37,002 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,002 INFO : Inserting sp|Q8IWT3|CUL9_HUMAN
15 Dec 2023 01:40:37,058 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:37,058 INFO : Imported 1300 peptide groups.
15 Dec 2023 01:40:37,058 INFO : Inserting sp|Q8IWV2|CNTN4_HUMAN
15 Dec 2023 01:40:37,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,103 INFO : Inserting sp|Q8IWV7|UBR1_HUMAN
15 Dec 2023 01:40:37,161 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:37,161 INFO : Inserting sp|Q8IX19|MCEM1_HUMAN
15 Dec 2023 01:40:37,178 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,178 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 01:40:37,305 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:37,305 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:40:37,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,327 INFO : Inserting sp|Q8IZD2|KMT2E_HUMAN
15 Dec 2023 01:40:37,361 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:37,361 INFO : Inserting sp|Q8IZF0|NALCN_HUMAN
15 Dec 2023 01:40:37,537 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:37,537 INFO : Inserting sp|Q8IZF2|AGRF5_HUMAN
15 Dec 2023 01:40:37,575 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:37,575 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 01:40:37,756 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:37,756 INFO : Inserting sp|Q8N1A0|KT222_HUMAN
15 Dec 2023 01:40:37,789 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:37,789 INFO : Inserting sp|Q8N1K5|THMS1_HUMAN
15 Dec 2023 01:40:37,812 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,812 INFO : Inserting sp|Q8N257|H2B3B_HUMAN
15 Dec 2023 01:40:37,943 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:37,943 INFO : Inserting sp|Q8N2S1|LTBP4_HUMAN
15 Dec 2023 01:40:37,978 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:37,978 INFO : Inserting sp|Q8N339|MT1M_HUMAN
15 Dec 2023 01:40:37,993 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:37,993 INFO : Inserting sp|Q8N3K9|CMYA5_HUMAN
15 Dec 2023 01:40:38,026 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,026 INFO : Inserting sp|Q8N3Y3|LARG2_HUMAN
15 Dec 2023 01:40:38,049 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,049 INFO : Inserting sp|Q8N474|SFRP1_HUMAN
15 Dec 2023 01:40:38,117 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:38,117 INFO : Inserting sp|Q8N4C8|MINK1_HUMAN
15 Dec 2023 01:40:38,132 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,132 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:40:38,235 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:38,235 INFO : Inserting sp|Q8N6Q3|CD177_HUMAN
15 Dec 2023 01:40:38,286 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:38,286 INFO : Inserting sp|Q8N752|KC1AL_HUMAN
15 Dec 2023 01:40:38,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,322 INFO : Inserting sp|Q8NA42|ZN383_HUMAN
15 Dec 2023 01:40:38,346 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,346 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 01:40:38,439 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:38,439 INFO : Inserting sp|Q8NBP7|PCSK9_HUMAN
15 Dec 2023 01:40:38,547 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:38,547 INFO : Inserting sp|Q8NC01|CLC1A_HUMAN
15 Dec 2023 01:40:38,577 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:38,577 INFO : Inserting sp|Q8NDG6|TDRD9_HUMAN
15 Dec 2023 01:40:38,594 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:38,594 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 01:40:38,708 INFO : 87% Done
15 Dec 2023 01:40:38,804 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:38,805 INFO : Inserting sp|Q8NFT8|DNER_HUMAN
15 Dec 2023 01:40:38,848 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:38,848 INFO : Inserting sp|Q8NFZ8|CADM4_HUMAN
15 Dec 2023 01:40:39,040 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:39,040 INFO : Inserting sp|Q8NG11|TSN14_HUMAN
15 Dec 2023 01:40:39,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,080 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 01:40:39,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,104 INFO : Inserting sp|Q8TAG5|VTM2A_HUMAN
15 Dec 2023 01:40:39,144 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,144 INFO : Inserting sp|Q8TBP5|F174A_HUMAN
15 Dec 2023 01:40:39,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,168 INFO : Inserting sp|Q8TCF1|ZFAN1_HUMAN
15 Dec 2023 01:40:39,201 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,201 INFO : Inserting sp|Q8TCG2|P4K2B_HUMAN
15 Dec 2023 01:40:39,218 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,218 INFO : Inserting sp|Q8TDB8|GTR14_HUMAN
15 Dec 2023 01:40:39,239 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,239 INFO : Inserting sp|Q8TDD5|MCLN3_HUMAN
15 Dec 2023 01:40:39,262 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,262 INFO : Inserting sp|Q8TDP1|RNH2C_HUMAN
15 Dec 2023 01:40:39,280 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,280 INFO : Inserting sp|Q8TDQ0|HAVR2_HUMAN
15 Dec 2023 01:40:39,306 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,306 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 01:40:39,372 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:39,372 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 01:40:39,471 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:39,471 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 01:40:39,488 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,488 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 01:40:39,863 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:40:39,863 INFO : Inserting sp|Q8WVN6|SCTM1_HUMAN
15 Dec 2023 01:40:39,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,885 INFO : Inserting sp|Q8WVQ1|CANT1_HUMAN
15 Dec 2023 01:40:39,949 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:39,949 INFO : Inserting sp|Q8WWI1|LMO7_HUMAN
15 Dec 2023 01:40:39,966 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:39,966 INFO : Inserting sp|Q8WXA3|RUFY2_HUMAN
15 Dec 2023 01:40:40,017 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:40,017 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 01:40:40,158 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:40,158 INFO : Inserting sp|Q8WXH0|SYNE2_HUMAN
15 Dec 2023 01:40:40,485 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:40:40,485 INFO : Inserting sp|Q8WXR4|MYO3B_HUMAN
15 Dec 2023 01:40:40,510 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:40,511 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 01:40:41,193 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:40:41,193 INFO : Inserting sp|Q8WZ75|ROBO4_HUMAN
15 Dec 2023 01:40:41,208 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:41,208 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 01:40:41,264 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:41,264 INFO : Inserting sp|Q92496|FHR4_HUMAN
15 Dec 2023 01:40:41,458 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:40:41,458 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:40:41,670 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:41,670 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 01:40:41,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:41,716 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 01:40:41,767 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:41,767 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:40:41,882 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:41,882 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 01:40:41,932 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:41,932 INFO : Inserting sp|Q92765|SFRP3_HUMAN
15 Dec 2023 01:40:42,036 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:42,036 INFO : Inserting sp|Q92804|RBP56_HUMAN
15 Dec 2023 01:40:42,064 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:42,064 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:40:42,497 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:40:42,497 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:40:43,060 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:40:43,061 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 01:40:43,139 INFO : 88% Done
15 Dec 2023 01:40:43,191 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:43,191 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 01:40:43,260 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:43,260 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 01:40:43,531 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:43,531 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:40:44,003 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:44,003 INFO : Inserting sp|Q92882|OSTF1_HUMAN
15 Dec 2023 01:40:44,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:44,132 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 01:40:44,184 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:44,184 INFO : Inserting sp|Q92911|SC5A5_HUMAN
15 Dec 2023 01:40:44,256 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:44,256 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:40:44,754 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:40:44,754 INFO : Inserting sp|Q93063|EXT2_HUMAN
15 Dec 2023 01:40:44,848 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:44,848 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 01:40:44,992 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:44,992 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:40:45,118 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:45,118 INFO : Inserting sp|Q93084|AT2A3_HUMAN
15 Dec 2023 01:40:45,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,149 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:40:45,226 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:45,226 INFO : Inserting sp|Q93097|WNT2B_HUMAN
15 Dec 2023 01:40:45,253 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:45,253 INFO : Inserting sp|Q969P0|IGSF8_HUMAN
15 Dec 2023 01:40:45,405 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:45,405 INFO : Inserting sp|Q96A72|MGN2_HUMAN
15 Dec 2023 01:40:45,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,426 INFO : Inserting sp|Q96AP7|ESAM_HUMAN
15 Dec 2023 01:40:45,440 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,440 INFO : Inserting sp|Q96BZ4|PLD4_HUMAN
15 Dec 2023 01:40:45,469 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,469 INFO : Inserting sp|Q96C23|GALM_HUMAN
15 Dec 2023 01:40:45,506 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,506 INFO : Inserting sp|Q96C24|SYTL4_HUMAN
15 Dec 2023 01:40:45,574 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:45,574 INFO : Inserting sp|Q96CG8|CTHR1_HUMAN
15 Dec 2023 01:40:45,587 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,587 INFO : Inserting sp|Q96DR5|BPIA2_HUMAN
15 Dec 2023 01:40:45,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,608 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 01:40:45,665 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:45,665 INFO : Inserting sp|Q96F85|CNRP1_HUMAN
15 Dec 2023 01:40:45,679 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:45,679 INFO : Inserting sp|Q96FE7|P3IP1_HUMAN
15 Dec 2023 01:40:45,703 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:45,703 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 01:40:45,784 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:45,784 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 01:40:45,992 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:40:45,992 INFO : Inserting sp|Q96GG9|DCNL1_HUMAN
15 Dec 2023 01:40:46,026 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:46,026 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:40:46,127 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:46,127 INFO : Inserting sp|Q96HD1|CREL1_HUMAN
15 Dec 2023 01:40:46,149 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:46,149 INFO : Inserting sp|Q96HR3|MED30_HUMAN
15 Dec 2023 01:40:46,180 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:46,180 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 01:40:46,237 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:46,238 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 01:40:46,823 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:40:46,823 INFO : Inserting sp|Q96KG7|MEG10_HUMAN
15 Dec 2023 01:40:46,860 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:46,860 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 01:40:46,999 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:46,999 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:40:47,291 INFO : 89% Done
15 Dec 2023 01:40:47,878 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:40:47,878 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 01:40:48,072 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:48,072 INFO : Imported 1400 peptide groups.
15 Dec 2023 01:40:48,072 INFO : Inserting sp|Q96LC7|SIG10_HUMAN
15 Dec 2023 01:40:48,088 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:48,088 INFO : Inserting sp|Q96MM3|ZFP42_HUMAN
15 Dec 2023 01:40:48,119 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:48,119 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:40:49,253 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:40:49,253 INFO : Inserting sp|Q96Q15|SMG1_HUMAN
15 Dec 2023 01:40:49,318 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:49,318 INFO : Inserting sp|Q96Q89|KI20B_HUMAN
15 Dec 2023 01:40:49,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:49,354 INFO : Inserting sp|Q96QC0|PP1RA_HUMAN
15 Dec 2023 01:40:49,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:49,375 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:40:49,597 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:49,597 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:40:50,182 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:40:50,182 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 01:40:50,327 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:50,327 INFO : Inserting sp|Q99439|CNN2_HUMAN
15 Dec 2023 01:40:50,394 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:50,394 INFO : Inserting sp|Q99453|PHX2B_HUMAN
15 Dec 2023 01:40:50,408 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:50,408 INFO : Inserting sp|Q99471|PFD5_HUMAN
15 Dec 2023 01:40:50,452 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:50,452 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 01:40:50,718 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:50,718 INFO : Inserting sp|Q99519|NEUR1_HUMAN
15 Dec 2023 01:40:50,810 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:50,810 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 01:40:51,050 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:51,050 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:40:51,211 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:51,211 INFO : Inserting sp|Q99590|SCAFB_HUMAN
15 Dec 2023 01:40:51,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:51,216 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 01:40:51,241 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:51,242 INFO : Inserting sp|Q99623|PHB2_HUMAN
15 Dec 2023 01:40:51,274 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:51,275 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 01:40:51,291 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:51,291 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 01:40:51,372 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:51,372 INFO : Inserting sp|Q99829|CPNE1_HUMAN
15 Dec 2023 01:40:51,391 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:51,391 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 01:40:51,523 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:51,523 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:40:51,666 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:51,666 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 01:40:51,827 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:51,827 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:40:51,927 INFO : 90% Done
15 Dec 2023 01:40:51,960 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:51,960 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 01:40:52,093 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:40:52,093 INFO : Inserting sp|Q99932|SPAG8_HUMAN
15 Dec 2023 01:40:52,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:52,108 INFO : Inserting sp|Q99963|SH3G3_HUMAN
15 Dec 2023 01:40:52,133 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:52,133 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 01:40:52,236 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:52,236 INFO : Inserting sp|Q99983|OMD_HUMAN
15 Dec 2023 01:40:52,332 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:52,332 INFO : Inserting sp|Q99996|AKAP9_HUMAN
15 Dec 2023 01:40:52,370 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:52,370 INFO : Inserting sp|Q9BQ16|TICN3_HUMAN
15 Dec 2023 01:40:52,430 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:52,430 INFO : Inserting sp|Q9BQ51|PD1L2_HUMAN
15 Dec 2023 01:40:52,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:52,478 INFO : Inserting sp|Q9BQT9|CSTN3_HUMAN
15 Dec 2023 01:40:52,502 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:52,502 INFO : Inserting sp|Q9BRA2|TXD17_HUMAN
15 Dec 2023 01:40:52,564 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:52,564 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:40:52,668 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:52,668 INFO : Inserting sp|Q9BRK3|MXRA8_HUMAN
15 Dec 2023 01:40:52,733 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:52,733 INFO : Inserting sp|Q9BRK5|CAB45_HUMAN
15 Dec 2023 01:40:52,792 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:52,792 INFO : Inserting sp|Q9BRL6|SRSF8_HUMAN
15 Dec 2023 01:40:52,806 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:52,806 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 01:40:52,862 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:52,862 INFO : Inserting sp|Q9BTT0|AN32E_HUMAN
15 Dec 2023 01:40:53,100 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:53,100 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 01:40:53,204 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:53,204 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:40:53,367 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:40:53,367 INFO : Inserting sp|Q9BWD1|THIC_HUMAN
15 Dec 2023 01:40:53,440 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:53,440 INFO : Inserting sp|Q9BWP8|COL11_HUMAN
15 Dec 2023 01:40:53,521 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:53,521 INFO : Inserting sp|Q9BX79|STRA6_HUMAN
15 Dec 2023 01:40:53,548 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:53,548 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 01:40:53,888 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:40:53,888 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:40:54,043 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:54,043 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 01:40:54,189 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:54,189 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:40:54,322 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:54,322 INFO : Inserting sp|Q9BYH1|SE6L1_HUMAN
15 Dec 2023 01:40:54,352 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:54,352 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 01:40:54,437 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:54,437 INFO : Inserting sp|Q9C0C9|UBE2O_HUMAN
15 Dec 2023 01:40:54,591 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:54,591 INFO : Inserting sp|Q9GZS3|SKI8_HUMAN
15 Dec 2023 01:40:54,632 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,632 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 01:40:54,682 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:54,682 INFO : Inserting sp|Q9GZX9|TWSG1_HUMAN
15 Dec 2023 01:40:54,715 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,715 INFO : Inserting sp|Q9GZZ8|LACRT_HUMAN
15 Dec 2023 01:40:54,729 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,729 INFO : Inserting sp|Q9H008|LHPP_HUMAN
15 Dec 2023 01:40:54,752 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,752 INFO : Inserting sp|Q9H0E2|TOLIP_HUMAN
15 Dec 2023 01:40:54,781 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,781 INFO : Inserting sp|Q9H0J4|QRIC2_HUMAN
15 Dec 2023 01:40:54,827 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,827 INFO : Inserting sp|Q9H0Q3|FXYD6_HUMAN
15 Dec 2023 01:40:54,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:54,851 INFO : Inserting sp|Q9H0U4|RAB1B_HUMAN
15 Dec 2023 01:40:54,987 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:54,987 INFO : Inserting sp|Q9H254|SPTN4_HUMAN
15 Dec 2023 01:40:55,052 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:55,052 INFO : Inserting sp|Q9H269|VPS16_HUMAN
15 Dec 2023 01:40:55,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:55,096 INFO : Inserting sp|Q9H299|SH3L3_HUMAN
15 Dec 2023 01:40:55,317 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:55,317 INFO : Inserting sp|Q9H2A7|CXL16_HUMAN
15 Dec 2023 01:40:55,355 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:55,355 INFO : Inserting sp|Q9H2U2|IPYR2_HUMAN
15 Dec 2023 01:40:55,379 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:55,379 INFO : Inserting sp|Q9H3K6|BOLA2_HUMAN
15 Dec 2023 01:40:55,493 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:55,493 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:40:55,566 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:55,566 INFO : Inserting sp|Q9H479|FN3K_HUMAN
15 Dec 2023 01:40:55,615 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:55,615 INFO : Inserting sp|Q9H4A9|DPEP2_HUMAN
15 Dec 2023 01:40:55,755 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:55,755 INFO : Inserting sp|Q9H4B7|TBB1_HUMAN
15 Dec 2023 01:40:56,109 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:40:56,109 INFO : Inserting sp|Q9H4G4|GAPR1_HUMAN
15 Dec 2023 01:40:56,166 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:56,166 INFO : Inserting sp|Q9H4M9|EHD1_HUMAN
15 Dec 2023 01:40:56,225 INFO : 91% Done
15 Dec 2023 01:40:56,374 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:56,374 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 01:40:56,497 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:56,497 INFO : Inserting sp|Q9H8S9|MOB1A_HUMAN
15 Dec 2023 01:40:56,566 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:56,567 INFO : Inserting sp|Q9HA38|ZMAT3_HUMAN
15 Dec 2023 01:40:56,603 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:56,603 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:40:56,690 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:40:56,690 INFO : Inserting sp|Q9HBI1|PARVB_HUMAN
15 Dec 2023 01:40:56,820 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:56,820 INFO : Inserting sp|Q9HC35|EMAL4_HUMAN
15 Dec 2023 01:40:56,854 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:56,854 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 01:40:56,893 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:56,893 INFO : Inserting sp|Q9HCD6|TANC2_HUMAN
15 Dec 2023 01:40:56,940 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:56,940 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 01:40:57,045 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:40:57,045 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 01:40:57,163 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:57,163 INFO : Inserting sp|Q9NPA0|EMC7_HUMAN
15 Dec 2023 01:40:57,177 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,177 INFO : Inserting sp|Q9NPH3|IL1AP_HUMAN
15 Dec 2023 01:40:57,372 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:40:57,372 INFO : Inserting sp|Q9NPY3|C1QR1_HUMAN
15 Dec 2023 01:40:57,402 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,402 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 01:40:57,753 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:40:57,753 INFO : Inserting sp|Q9NQC3|RTN4_HUMAN
15 Dec 2023 01:40:57,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,784 INFO : Inserting sp|Q9NQH7|XPP3_HUMAN
15 Dec 2023 01:40:57,806 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,807 INFO : Inserting sp|Q9NQR4|NIT2_HUMAN
15 Dec 2023 01:40:57,820 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,820 INFO : Inserting sp|Q9NQX5|NPDC1_HUMAN
15 Dec 2023 01:40:57,863 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,863 INFO : Inserting sp|Q9NR34|MA1C1_HUMAN
15 Dec 2023 01:40:57,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,885 INFO : Inserting sp|Q9NR45|SIAS_HUMAN
15 Dec 2023 01:40:57,929 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,929 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 01:40:57,964 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,964 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 01:40:57,988 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:57,988 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 01:40:58,013 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,013 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 01:40:58,106 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:58,107 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 01:40:58,190 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:58,190 INFO : Imported 1500 peptide groups.
15 Dec 2023 01:40:58,190 INFO : Inserting sp|Q9NUJ1|ABHDA_HUMAN
15 Dec 2023 01:40:58,230 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,230 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:40:58,329 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:58,330 INFO : Inserting sp|Q9NX46|ADPRS_HUMAN
15 Dec 2023 01:40:58,361 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,361 INFO : Inserting sp|Q9NXC2|GFOD1_HUMAN
15 Dec 2023 01:40:58,375 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,375 INFO : Inserting sp|Q9NY15|STAB1_HUMAN
15 Dec 2023 01:40:58,416 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,416 INFO : Inserting sp|Q9NY33|DPP3_HUMAN
15 Dec 2023 01:40:58,552 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:58,552 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 01:40:58,648 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:58,648 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 01:40:58,708 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:58,708 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 01:40:58,742 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:58,742 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:40:59,130 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:40:59,131 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 01:40:59,172 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:40:59,172 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:40:59,541 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:40:59,541 INFO : Inserting sp|Q9NZR2|LRP1B_HUMAN
15 Dec 2023 01:40:59,625 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:40:59,626 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 01:40:59,785 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:40:59,785 INFO : Inserting sp|Q9P232|CNTN3_HUMAN
15 Dec 2023 01:40:59,805 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:59,805 INFO : Inserting sp|Q9P258|RCC2_HUMAN
15 Dec 2023 01:40:59,861 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:40:59,861 INFO : Inserting sp|Q9P2J5|SYLC_HUMAN
15 Dec 2023 01:40:59,884 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:40:59,884 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 01:41:00,024 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:00,024 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 01:41:00,211 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:00,211 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:41:00,466 INFO : 92% Done
15 Dec 2023 01:41:00,624 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:41:00,624 INFO : Inserting sp|Q9UBQ0|VPS29_HUMAN
15 Dec 2023 01:41:00,647 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:00,647 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 01:41:00,702 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:00,702 INFO : Inserting sp|Q9UBR2|CATZ_HUMAN
15 Dec 2023 01:41:00,809 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:00,810 INFO : Inserting sp|Q9UBS4|DJB11_HUMAN
15 Dec 2023 01:41:00,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:00,825 INFO : Inserting sp|Q9UBW5|BIN2_HUMAN
15 Dec 2023 01:41:00,912 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:00,912 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 01:41:00,989 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:00,989 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 01:41:01,025 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:01,025 INFO : Inserting sp|Q9UBX7|KLK11_HUMAN
15 Dec 2023 01:41:01,095 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:01,095 INFO : Inserting sp|Q9UDY4|DNJB4_HUMAN
15 Dec 2023 01:41:01,148 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:01,149 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 01:41:01,211 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:01,211 INFO : Inserting sp|Q9UGJ0|AAKG2_HUMAN
15 Dec 2023 01:41:01,236 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:01,236 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 01:41:01,604 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:41:01,605 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 01:41:01,630 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:01,630 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 01:41:01,804 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:01,805 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 01:41:02,354 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:41:02,354 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 01:41:02,533 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:02,533 INFO : Inserting sp|Q9UHV7|MED13_HUMAN
15 Dec 2023 01:41:02,558 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:02,558 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 01:41:02,607 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:02,607 INFO : Inserting sp|Q9UIA9|XPO7_HUMAN
15 Dec 2023 01:41:02,678 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:02,679 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 01:41:02,768 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:02,768 INFO : Inserting sp|Q9UJ68|MSRA_HUMAN
15 Dec 2023 01:41:02,829 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:02,829 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 01:41:03,063 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:03,063 INFO : Inserting sp|Q9UJJ9|GNPTG_HUMAN
15 Dec 2023 01:41:03,160 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:03,160 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 01:41:03,255 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:03,255 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:41:03,887 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:41:03,888 INFO : Inserting sp|Q9UKE5|TNIK_HUMAN
15 Dec 2023 01:41:03,904 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:03,904 INFO : Inserting sp|Q9UKJ1|PILRA_HUMAN
15 Dec 2023 01:41:03,917 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:03,917 INFO : Inserting sp|Q9UKU6|TRHDE_HUMAN
15 Dec 2023 01:41:04,111 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:04,111 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 01:41:04,126 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:04,126 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 01:41:04,299 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:04,299 INFO : Inserting sp|Q9ULB1|NRX1A_HUMAN
15 Dec 2023 01:41:04,411 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:04,411 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 01:41:04,443 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:04,444 INFO : Inserting sp|Q9ULT8|HECD1_HUMAN
15 Dec 2023 01:41:04,519 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:04,519 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:41:04,644 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:04,644 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:41:04,871 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:04,872 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:41:05,030 INFO : 93% Done
15 Dec 2023 01:41:05,160 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:41:05,160 INFO : Inserting sp|Q9UMX5|NENF_HUMAN
15 Dec 2023 01:41:05,219 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:05,219 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 01:41:05,443 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:05,443 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 01:41:05,773 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:41:05,773 INFO : Inserting sp|Q9UNZ2|NSF1C_HUMAN
15 Dec 2023 01:41:05,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:05,828 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:41:05,968 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:05,968 INFO : Inserting sp|Q9UQB8|BAIP2_HUMAN
15 Dec 2023 01:41:05,990 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:05,990 INFO : Inserting sp|Q9UQE7|SMC3_HUMAN
15 Dec 2023 01:41:06,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,030 INFO : Inserting sp|Q9Y243|AKT3_HUMAN
15 Dec 2023 01:41:06,044 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,044 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 01:41:06,083 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,083 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:41:06,253 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:06,253 INFO : Inserting sp|Q9Y287|ITM2B_HUMAN
15 Dec 2023 01:41:06,286 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:06,286 INFO : Inserting sp|Q9Y2B0|CNPY2_HUMAN
15 Dec 2023 01:41:06,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,322 INFO : Inserting sp|Q9Y2K3|MYH15_HUMAN
15 Dec 2023 01:41:06,352 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,352 INFO : Inserting sp|Q9Y2Q3|GSTK1_HUMAN
15 Dec 2023 01:41:06,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,380 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 01:41:06,418 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,419 INFO : Inserting sp|Q9Y2V0|CDIN1_HUMAN
15 Dec 2023 01:41:06,431 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,431 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 01:41:06,492 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:06,492 INFO : Inserting sp|Q9Y2X8|UB2D4_HUMAN
15 Dec 2023 01:41:06,523 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,523 INFO : Inserting sp|Q9Y315|DEOC_HUMAN
15 Dec 2023 01:41:06,551 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,551 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 01:41:06,640 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:06,640 INFO : Inserting sp|Q9Y473|ZN175_HUMAN
15 Dec 2023 01:41:06,670 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:06,670 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:41:08,022 DEBUG: Inserted 50 peptides
15 Dec 2023 01:41:08,722 DEBUG: Total peptides inserted: 75
15 Dec 2023 01:41:08,722 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 01:41:08,846 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:08,846 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 01:41:08,975 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:08,975 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 01:41:09,309 INFO : 94% Done
15 Dec 2023 01:41:09,337 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:41:09,338 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 01:41:09,642 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:41:09,642 INFO : Inserting sp|Q9Y5C1|ANGL3_HUMAN
15 Dec 2023 01:41:09,802 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:09,802 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:41:10,002 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:10,002 INFO : Inserting sp|Q9Y5Z4|HEBP2_HUMAN
15 Dec 2023 01:41:10,035 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:10,036 INFO : Inserting sp|Q9Y608|LRRF2_HUMAN
15 Dec 2023 01:41:10,089 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:10,089 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 01:41:10,228 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:10,228 INFO : Inserting sp|Q9Y696|CLIC4_HUMAN
15 Dec 2023 01:41:10,295 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:10,295 INFO : Inserting sp|Q9Y6K9|NEMO_HUMAN
15 Dec 2023 01:41:10,379 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:10,379 INFO : Inserting sp|Q9Y6N5|SQOR_HUMAN
15 Dec 2023 01:41:10,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:10,401 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 01:41:10,434 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:10,434 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:41:11,742 DEBUG: Inserted 50 peptides
15 Dec 2023 01:41:13,337 DEBUG: Inserted 100 peptides
15 Dec 2023 01:41:13,440 DEBUG: Total peptides inserted: 105
15 Dec 2023 01:41:13,440 INFO : Inserting sp|Q9Y6Z7|COL10_HUMAN
15 Dec 2023 01:41:13,514 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:13,514 INFO : Inserting sp|A0A075B6Q5|HV364_HUMAN
15 Dec 2023 01:41:13,521 INFO : 95% Done
15 Dec 2023 01:41:13,603 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:13,603 INFO : Inserting sp|A0A075B6R2|HV404_HUMAN
15 Dec 2023 01:41:13,660 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:13,660 INFO : Inserting sp|A0A087WSY4|HV432_HUMAN
15 Dec 2023 01:41:13,720 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:13,720 INFO : Inserting sp|A0A0A0MS14|HV145_HUMAN
15 Dec 2023 01:41:13,735 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:13,735 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 01:41:13,803 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:13,804 INFO : Inserting sp|A0A0B4J1U7|HV601_HUMAN
15 Dec 2023 01:41:13,851 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:13,851 INFO : Inserting sp|A0A0B4J1V0|HV315_HUMAN
15 Dec 2023 01:41:14,015 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:14,015 INFO : Imported 1600 peptide groups.
15 Dec 2023 01:41:14,015 INFO : Inserting sp|A0A0B4J1V2|HV226_HUMAN
15 Dec 2023 01:41:14,093 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:14,093 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 01:41:14,239 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:14,239 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 01:41:14,387 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:14,387 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 01:41:14,538 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:14,538 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 01:41:14,595 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:14,595 INFO : Inserting sp|A0A0C4DH29|HV103_HUMAN
15 Dec 2023 01:41:14,643 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:14,643 INFO : Inserting sp|A0A0C4DH30|HV316_HUMAN
15 Dec 2023 01:41:14,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:14,660 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 01:41:14,737 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:14,737 INFO : Inserting sp|A0A0C4DH32|HV320_HUMAN
15 Dec 2023 01:41:14,941 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:14,942 INFO : Inserting sp|A0A0C4DH33|HV124_HUMAN
15 Dec 2023 01:41:15,075 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:15,075 INFO : Inserting sp|A0A0C4DH34|HV428_HUMAN
15 Dec 2023 01:41:15,168 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:15,168 INFO : Inserting sp|A0A0C4DH35|HV335_HUMAN
15 Dec 2023 01:41:15,184 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:15,184 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 01:41:15,240 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:15,240 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 01:41:15,340 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:15,340 INFO : Inserting sp|A0A0J9YX35|HV64D_HUMAN
15 Dec 2023 01:41:15,397 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:15,397 INFO : Inserting sp|A0A0J9YXX1|HV5X1_HUMAN
15 Dec 2023 01:41:15,482 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:15,482 INFO : Inserting sp|A0A8I5KQE6|RPSA2_HUMAN
15 Dec 2023 01:41:15,529 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:15,530 INFO : Inserting sp|A5A3E0|POTEF_HUMAN
15 Dec 2023 01:41:15,998 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:41:15,998 INFO : Inserting sp|A5D6W6|FITM1_HUMAN
15 Dec 2023 01:41:16,050 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:16,050 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:41:16,397 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:16,397 INFO : Inserting sp|E9PAV3|NACAM_HUMAN
15 Dec 2023 01:41:16,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:16,426 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 01:41:16,525 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:16,525 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 01:41:16,609 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:16,609 INFO : Inserting sp|O75678|RFPL2_HUMAN
15 Dec 2023 01:41:16,634 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:16,634 INFO : Inserting sp|O75711|SCRG1_HUMAN
15 Dec 2023 01:41:16,676 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:16,676 INFO : Inserting sp|O76009|KT33A_HUMAN
15 Dec 2023 01:41:16,760 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:16,760 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:41:16,784 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:16,784 INFO : Inserting sp|O94903|PLPHP_HUMAN
15 Dec 2023 01:41:16,814 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:16,814 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:41:16,934 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:16,935 INFO : Inserting sp|O95757|HS74L_HUMAN
15 Dec 2023 01:41:16,983 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:16,983 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 01:41:17,126 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:17,126 INFO : Inserting sp|P01601|KVD16_HUMAN
15 Dec 2023 01:41:17,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:17,156 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 01:41:17,209 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,209 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 01:41:17,277 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:17,277 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 01:41:17,355 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:17,355 INFO : Inserting sp|P01714|LV319_HUMAN
15 Dec 2023 01:41:17,408 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,408 INFO : Inserting sp|P01718|LV327_HUMAN
15 Dec 2023 01:41:17,484 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,484 INFO : Inserting sp|P04430|KV116_HUMAN
15 Dec 2023 01:41:17,552 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:17,552 INFO : Inserting sp|P04432|KVD39_HUMAN
15 Dec 2023 01:41:17,667 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,667 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 01:41:17,769 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,769 INFO : Inserting sp|P07311|ACYP1_HUMAN
15 Dec 2023 01:41:17,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:17,800 INFO : Inserting sp|P09105|HBAT_HUMAN
15 Dec 2023 01:41:17,845 INFO : 96% Done
15 Dec 2023 01:41:17,951 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:17,951 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:41:18,576 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:41:18,576 INFO : Inserting sp|P0DP01|HV108_HUMAN
15 Dec 2023 01:41:18,602 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:18,602 INFO : Inserting sp|P0DP02|HVC33_HUMAN
15 Dec 2023 01:41:18,754 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:18,754 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 01:41:18,954 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:18,954 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 01:41:19,114 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:19,114 INFO : Inserting sp|P47972|NPTX2_HUMAN
15 Dec 2023 01:41:19,128 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:19,128 INFO : Inserting sp|P49406|RM19_HUMAN
15 Dec 2023 01:41:19,152 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:19,152 INFO : Inserting sp|P55103|INHBC_HUMAN
15 Dec 2023 01:41:19,240 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:19,240 INFO : Inserting sp|P60983|GMFB_HUMAN
15 Dec 2023 01:41:19,324 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:19,324 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 01:41:19,599 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:41:19,599 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 01:41:19,752 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:41:19,752 INFO : Inserting sp|Q06732|ZN33B_HUMAN
15 Dec 2023 01:41:19,815 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:19,815 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 01:41:19,887 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:19,888 INFO : Inserting sp|Q15404|RSU1_HUMAN
15 Dec 2023 01:41:19,950 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:19,951 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 01:41:20,314 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:41:20,314 INFO : Inserting sp|Q562R1|ACTBL_HUMAN
15 Dec 2023 01:41:20,594 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:41:20,594 INFO : Inserting sp|Q5T013|HYI_HUMAN
15 Dec 2023 01:41:20,668 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:20,668 INFO : Inserting sp|Q5TEC6|H37_HUMAN
15 Dec 2023 01:41:20,726 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:20,726 INFO : Inserting sp|Q5VTE0|EF1A3_HUMAN
15 Dec 2023 01:41:20,850 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:20,850 INFO : Inserting sp|Q5VU97|CAHD1_HUMAN
15 Dec 2023 01:41:20,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:20,872 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 01:41:20,917 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:20,917 INFO : Inserting sp|Q641Q3|METRL_HUMAN
15 Dec 2023 01:41:20,971 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:20,971 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 01:41:21,013 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:21,013 INFO : Inserting sp|Q6B0K9|HBM_HUMAN
15 Dec 2023 01:41:21,072 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:21,072 INFO : Inserting sp|Q6S8J3|POTEE_HUMAN
15 Dec 2023 01:41:21,569 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:41:21,569 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:41:21,625 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:21,625 INFO : Inserting sp|Q6ZMR3|LDH6A_HUMAN
15 Dec 2023 01:41:21,700 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:21,700 INFO : Inserting sp|Q7Z7L7|ZER1_HUMAN
15 Dec 2023 01:41:21,756 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:21,756 INFO : Inserting sp|Q8IXS6|PALM2_HUMAN
15 Dec 2023 01:41:21,790 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:21,790 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 01:41:21,855 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:21,855 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 01:41:21,945 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:21,945 INFO : Inserting sp|Q8N8A2|ANR44_HUMAN
15 Dec 2023 01:41:21,980 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:21,980 INFO : Inserting sp|Q8WUT4|LRRN4_HUMAN
15 Dec 2023 01:41:22,006 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:22,006 INFO : Inserting sp|Q93073|SBP2L_HUMAN
15 Dec 2023 01:41:22,032 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:22,033 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 01:41:22,114 INFO : 97% Done
15 Dec 2023 01:41:22,194 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:22,195 INFO : Inserting sp|Q96CX2|KCD12_HUMAN
15 Dec 2023 01:41:22,389 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:22,389 INFO : Inserting sp|Q96DA0|ZG16B_HUMAN
15 Dec 2023 01:41:22,453 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:22,453 INFO : Inserting sp|Q96S96|PEBP4_HUMAN
15 Dec 2023 01:41:22,548 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:22,548 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 01:41:22,707 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:22,707 INFO : Inserting sp|Q9BUN1|MENT_HUMAN
15 Dec 2023 01:41:22,765 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:22,765 INFO : Inserting sp|Q9BYX7|ACTBM_HUMAN
15 Dec 2023 01:41:22,908 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:22,908 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 01:41:22,971 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:22,971 INFO : Inserting sp|Q9GZR7|DDX24_HUMAN
15 Dec 2023 01:41:22,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:22,986 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:41:23,102 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:23,102 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:41:23,246 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:23,247 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 01:41:23,426 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:41:23,426 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 01:41:23,583 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:41:23,583 INFO : Inserting sp|Q9NRV9|HEBP1_HUMAN
15 Dec 2023 01:41:23,608 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:23,608 INFO : Inserting sp|Q9NW68|BSDC1_HUMAN
15 Dec 2023 01:41:23,630 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:23,630 INFO : Inserting sp|Q9NWV4|CZIB_HUMAN
15 Dec 2023 01:41:23,661 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:23,661 INFO : Inserting sp|Q9NZT2|OGFR_HUMAN
15 Dec 2023 01:41:23,692 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:23,692 INFO : Inserting sp|Q9UJW7|ZN229_HUMAN
15 Dec 2023 01:41:23,713 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:23,713 INFO : Inserting sp|A0A075B6H7|KV37_HUMAN
15 Dec 2023 01:41:23,769 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:23,770 INFO : Inserting sp|A0A075B6H9|LV469_HUMAN
15 Dec 2023 01:41:23,836 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:23,836 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 01:41:23,873 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:23,873 INFO : Inserting sp|A0A075B6I9|LV746_HUMAN
15 Dec 2023 01:41:23,930 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:23,930 INFO : Inserting sp|A0A075B6K4|LV310_HUMAN
15 Dec 2023 01:41:23,982 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:23,982 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 01:41:24,049 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:24,049 INFO : Imported 1700 peptide groups.
15 Dec 2023 01:41:24,049 INFO : Inserting sp|A0A075B6N3|TVBX1_HUMAN
15 Dec 2023 01:41:24,086 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,086 INFO : Inserting sp|A0A075B6R9|KVD24_HUMAN
15 Dec 2023 01:41:24,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,106 INFO : Inserting sp|A0A075B6S2|KVD29_HUMAN
15 Dec 2023 01:41:24,155 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,155 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:41:24,261 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,261 INFO : Inserting sp|A0A075B6S9|KV137_HUMAN
15 Dec 2023 01:41:24,318 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,318 INFO : Inserting sp|A0A087WSX0|LV545_HUMAN
15 Dec 2023 01:41:24,346 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,346 INFO : Inserting sp|A0A087WSY6|KVD15_HUMAN
15 Dec 2023 01:41:24,412 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,412 INFO : Inserting sp|A0A087WSZ0|KVD08_HUMAN
15 Dec 2023 01:41:24,455 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,455 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 01:41:24,506 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:24,506 INFO : Inserting sp|A0A0A0MT36|KVD21_HUMAN
15 Dec 2023 01:41:24,545 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,545 INFO : Inserting sp|A0A0B4J1U3|LV136_HUMAN
15 Dec 2023 01:41:24,629 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,629 INFO : Inserting sp|A0A0B4J1Y8|LV949_HUMAN
15 Dec 2023 01:41:24,683 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:24,683 INFO : Inserting sp|A0A0C4DH24|KV621_HUMAN
15 Dec 2023 01:41:24,697 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,697 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 01:41:24,748 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,748 INFO : Inserting sp|A0A0C4DH26|KVD41_HUMAN
15 Dec 2023 01:41:24,788 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:24,788 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 01:41:24,910 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:24,910 INFO : Inserting sp|A0A0C4DH68|KV224_HUMAN
15 Dec 2023 01:41:24,931 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:24,931 INFO : Inserting sp|A0A0C4DH73|KV112_HUMAN
15 Dec 2023 01:41:25,055 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:25,055 INFO : Inserting sp|A2NJV5|KV229_HUMAN
15 Dec 2023 01:41:25,110 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:25,110 INFO : Inserting sp|A6NES4|MRO2A_HUMAN
15 Dec 2023 01:41:25,132 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:25,133 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:41:25,394 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:41:25,394 INFO : Inserting sp|O43361|ZN749_HUMAN
15 Dec 2023 01:41:25,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:25,420 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 01:41:25,609 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:25,609 INFO : Inserting sp|P0CG39|POTEJ_HUMAN
15 Dec 2023 01:41:25,972 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:41:25,973 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 01:41:26,384 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:26,384 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 01:41:26,404 INFO : 98% Done
15 Dec 2023 01:41:26,745 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:41:26,745 INFO : Inserting sp|P0DSN7|KVD37_HUMAN
15 Dec 2023 01:41:26,827 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:26,827 INFO : Inserting sp|P0DTE1|HV383_HUMAN
15 Dec 2023 01:41:26,891 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:26,891 INFO : Inserting sp|Q03938|ZNF90_HUMAN
15 Dec 2023 01:41:26,951 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:26,951 INFO : Inserting sp|Q15181|IPYR_HUMAN
15 Dec 2023 01:41:26,986 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:26,986 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 01:41:27,024 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,024 INFO : Inserting sp|Q30KQ8|DB112_HUMAN
15 Dec 2023 01:41:27,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,039 INFO : Inserting sp|Q3MIS6|ZN528_HUMAN
15 Dec 2023 01:41:27,063 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,063 INFO : Inserting sp|Q58FF6|H90B4_HUMAN
15 Dec 2023 01:41:27,154 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:41:27,155 INFO : Inserting sp|Q5T9S5|CCD18_HUMAN
15 Dec 2023 01:41:27,220 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,220 INFO : Inserting sp|Q68DN1|CB016_HUMAN
15 Dec 2023 01:41:27,264 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,264 INFO : Inserting sp|Q6P3R8|NEK5_HUMAN
15 Dec 2023 01:41:27,327 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,327 INFO : Inserting sp|Q7Z5L0|VMO1_HUMAN
15 Dec 2023 01:41:27,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,349 INFO : Inserting sp|Q8IZ13|F200C_HUMAN
15 Dec 2023 01:41:27,389 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,389 INFO : Inserting sp|Q8NFI4|F10A5_HUMAN
15 Dec 2023 01:41:27,454 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:27,454 INFO : Inserting sp|Q96E39|RMXL1_HUMAN
15 Dec 2023 01:41:27,487 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,487 INFO : Inserting sp|Q96H40|ZN486_HUMAN
15 Dec 2023 01:41:27,502 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,502 INFO : Inserting sp|Q9H0R4|HDHD2_HUMAN
15 Dec 2023 01:41:27,543 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,543 INFO : Inserting sp|Q9H4K1|RIBC2_HUMAN
15 Dec 2023 01:41:27,560 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,560 INFO : Inserting sp|Q9H6N6|MYH16_HUMAN
15 Dec 2023 01:41:27,604 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,604 INFO : Inserting sp|Q9P1Z9|CC180_HUMAN
15 Dec 2023 01:41:27,668 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,668 INFO : Inserting sp|Q9UJC5|SH3L2_HUMAN
15 Dec 2023 01:41:27,702 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,702 INFO : Inserting sp|Q9UKY7|CDV3_HUMAN
15 Dec 2023 01:41:27,725 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,725 INFO : Inserting sp|Q9UL59|ZN214_HUMAN
15 Dec 2023 01:41:27,749 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,749 INFO : Inserting sp|Q9Y2G7|ZFP30_HUMAN
15 Dec 2023 01:41:27,802 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:41:27,802 INFO : Inserting sp|Q9Y2H5|PKHA6_HUMAN
15 Dec 2023 01:41:27,816 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,816 INFO : Inserting sp|Q9Y485|DMXL1_HUMAN
15 Dec 2023 01:41:27,854 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,854 INFO : Inserting sp|A0A096LNW5|NT2NR_HUMAN
15 Dec 2023 01:41:27,868 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,869 INFO : Inserting sp|A0A3B3IRV3|MCTS2_HUMAN
15 Dec 2023 01:41:27,900 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:27,900 INFO : Inserting sp|A6NLU5|VTM2B_HUMAN
15 Dec 2023 01:41:27,986 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:41:27,986 INFO : Inserting sp|C9JTQ0|ANR63_HUMAN
15 Dec 2023 01:41:28,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,029 INFO : Inserting sp|Q3MJ40|C144B_HUMAN
15 Dec 2023 01:41:28,062 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,063 INFO : Inserting sp|Q5VSP4|LC1L1_HUMAN
15 Dec 2023 01:41:28,103 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,103 INFO : Inserting sp|Q6ZUS5|CC121_HUMAN
15 Dec 2023 01:41:28,129 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,129 INFO : Inserting sp|Q86U17|SPA11_HUMAN
15 Dec 2023 01:41:28,394 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:41:28,394 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 01:41:28,636 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:41:28,636 INFO : Inserting sp|Q8IYA2|C144C_HUMAN
15 Dec 2023 01:41:28,665 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,665 INFO : Inserting sp|Q8NEE8|TTC16_HUMAN
15 Dec 2023 01:41:28,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:41:28,696 INFO : None of the 3294343 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:45:07,091 INFO : Updated 1087554 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:45:07,093 INFO : Done parsing Skyline document.
15 Dec 2023 01:45:07,118 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:45:18,909 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 01:46:04,453 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 01:46:16,959 INFO : Cleaning up temp tables
15 Dec 2023 01:46:17,341 INFO : Completed import of Skyline document from SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 01:46:17,343 INFO : 100% Done
15 Dec 2023 01:46:17,384 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179832/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip into the system
15 Dec 2023 01:46:17,386 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179833/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd into the system
15 Dec 2023 01:46:17,387 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179833/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd into the system
15 Dec 2023 01:46:17,387 DEBUG: Trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179833/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip into the system
15 Dec 2023 01:46:17,389 INFO : Starting import from SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 01:46:17,391 INFO : Starting to import Skyline document from SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 01:46:17,487 INFO : Expanding human.protdb
15 Dec 2023 01:46:20,257 INFO : Expanding Plasma_P017_F3b.imsdb
15 Dec 2023 01:46:20,370 INFO : Expanding SILK_P017_Plasma_F3b.blib
15 Dec 2023 01:46:21,107 INFO : Expanding SILK_P017_Plasma_F3b.redundant.blib
15 Dec 2023 01:46:28,899 INFO : Expanding SILK_P017_Plasma_F3b.skyd
15 Dec 2023 01:47:18,130 INFO : Expanding SILK_P017_Plasma_F3b.sky.view
15 Dec 2023 01:47:18,137 INFO : Expanding SILK_P017_Plasma_F3b.sky
15 Dec 2023 01:47:23,867 INFO : Expanding SILK_P017_Plasma_F3b.skyl
15 Dec 2023 01:49:36,411 DEBUG: Starting to load chromatogram headers
15 Dec 2023 01:49:39,334 DEBUG: Done loading chromatogram headers
15 Dec 2023 01:49:41,293 INFO : Inserting sp|A0A0B4J2F2|SIK1B_HUMAN
15 Dec 2023 01:49:41,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:41,354 INFO : Inserting sp|A0M8Q6|IGLC7_HUMAN
15 Dec 2023 01:49:41,460 WARN : 'SILK_P017_Plasma_F2' library was not found in settings.
15 Dec 2023 01:49:41,513 WARN : 'SILK_P017_Plasma_F1b' library was not found in settings.
15 Dec 2023 01:49:41,686 WARN : 'SILK_P017_Plasma_F3' library was not found in settings.
15 Dec 2023 01:49:41,796 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:49:41,796 INFO : Inserting sp|A1L4H1|SRCRL_HUMAN
15 Dec 2023 01:49:41,891 WARN : 'SILK_P017_Plasma_F2b' library was not found in settings.
15 Dec 2023 01:49:41,939 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:41,939 INFO : Inserting sp|B0I1T2|MYO1G_HUMAN
15 Dec 2023 01:49:41,998 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:41,998 INFO : Inserting sp|B2RTY4|MYO9A_HUMAN
15 Dec 2023 01:49:42,087 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:42,087 INFO : Inserting sp|C9JLW8|MCRI1_HUMAN
15 Dec 2023 01:49:42,163 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:42,163 INFO : Inserting sp|O00115|DNS2A_HUMAN
15 Dec 2023 01:49:42,233 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.49_F3_1_S1-G4_1_4447.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1001.4565, WC[+57.0]VSPKGPWTC[+57.0]VGDM[+16.0]NR, 2
15 Dec 2023 01:49:42,234 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.66_F3_1_S4-E2_1_4519.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1001.4565, WC[+57.0]VSPKGPWTC[+57.0]VGDM[+16.0]NR, 2
15 Dec 2023 01:49:42,274 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:42,274 INFO : Inserting sp|O00148|DX39A_HUMAN
15 Dec 2023 01:49:42,474 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:42,474 INFO : Inserting sp|O00151|PDLI1_HUMAN
15 Dec 2023 01:49:42,613 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:42,613 INFO : Inserting sp|O00187|MASP2_HUMAN
15 Dec 2023 01:49:44,099 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:49:44,099 INFO : Inserting sp|O00233|PSMD9_HUMAN
15 Dec 2023 01:49:44,161 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:44,161 INFO : Inserting sp|O00270|GPR31_HUMAN
15 Dec 2023 01:49:44,214 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:44,214 INFO : Inserting sp|O00299|CLIC1_HUMAN
15 Dec 2023 01:49:44,830 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:49:44,831 INFO : Inserting sp|O00339|MATN2_HUMAN
15 Dec 2023 01:49:44,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:44,885 INFO : Inserting sp|O00391|QSOX1_HUMAN
15 Dec 2023 01:49:45,633 INFO : 1% Done
15 Dec 2023 01:49:46,238 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:49:46,238 INFO : Inserting sp|O00462|MANBA_HUMAN
15 Dec 2023 01:49:46,467 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:49:46,467 INFO : Inserting sp|O00468|AGRIN_HUMAN
15 Dec 2023 01:49:47,106 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:49:47,107 INFO : Inserting sp|O00533|NCHL1_HUMAN
15 Dec 2023 01:49:47,216 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.31_F3_1_S4-G8_1_4549.d. SKYD file may be out of sync with primary Skyline document. Transition M - 956.0273, LGIAM[+16.0]SEEIEFIVPSVPK, 2
15 Dec 2023 01:49:48,345 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:49:48,345 INFO : Inserting sp|O00560|SDCB1_HUMAN
15 Dec 2023 01:49:48,439 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:48,439 INFO : Inserting sp|O00584|RNT2_HUMAN
15 Dec 2023 01:49:48,688 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:49:48,688 INFO : Inserting sp|O00602|FCN1_HUMAN
15 Dec 2023 01:49:48,949 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:49:48,949 INFO : Inserting sp|O00754|MA2B1_HUMAN
15 Dec 2023 01:49:49,183 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:49:49,184 INFO : Inserting sp|O00764|PDXK_HUMAN
15 Dec 2023 01:49:49,526 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:49:49,526 INFO : Inserting sp|O14594|NCAN_HUMAN
15 Dec 2023 01:49:49,946 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:49:49,946 INFO : Inserting sp|O14618|CCS_HUMAN
15 Dec 2023 01:49:50,008 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:50,008 INFO : Inserting sp|O14672|ADA10_HUMAN
15 Dec 2023 01:49:50,064 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:50,064 INFO : Inserting sp|O14744|ANM5_HUMAN
15 Dec 2023 01:49:50,089 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:50,089 INFO : Inserting sp|O14745|NHRF1_HUMAN
15 Dec 2023 01:49:50,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:50,213 INFO : Inserting sp|O14773|TPP1_HUMAN
15 Dec 2023 01:49:50,496 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:49:50,496 INFO : Inserting sp|O14786|NRP1_HUMAN
15 Dec 2023 01:49:51,215 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:49:51,215 INFO : Inserting sp|O14791|APOL1_HUMAN
15 Dec 2023 01:49:52,059 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:49:52,059 INFO : Inserting sp|O14818|PSA7_HUMAN
15 Dec 2023 01:49:52,602 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:49:52,602 INFO : Inserting sp|O14829|PPE1_HUMAN
15 Dec 2023 01:49:52,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:52,626 INFO : Inserting sp|O14950|ML12B_HUMAN
15 Dec 2023 01:49:52,944 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:49:52,944 INFO : Inserting sp|O15020|SPTN2_HUMAN
15 Dec 2023 01:49:53,266 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:49:53,266 INFO : Inserting sp|O15021|MAST4_HUMAN
15 Dec 2023 01:49:53,318 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:53,319 INFO : Inserting sp|O15031|PLXB2_HUMAN
15 Dec 2023 01:49:53,375 INFO : 2% Done
15 Dec 2023 01:49:53,748 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:49:53,748 INFO : Inserting sp|O15061|SYNEM_HUMAN
15 Dec 2023 01:49:53,768 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:53,768 INFO : Inserting sp|O15067|PUR4_HUMAN
15 Dec 2023 01:49:53,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:53,825 INFO : Inserting sp|O15143|ARC1B_HUMAN
15 Dec 2023 01:49:54,274 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:49:54,274 INFO : Inserting sp|O15144|ARPC2_HUMAN
15 Dec 2023 01:49:55,004 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:49:55,004 INFO : Inserting sp|O15145|ARPC3_HUMAN
15 Dec 2023 01:49:55,062 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:55,062 INFO : Inserting sp|O15162|PLS1_HUMAN
15 Dec 2023 01:49:55,116 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:55,116 INFO : Inserting sp|O15173|PGRC2_HUMAN
15 Dec 2023 01:49:55,137 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:55,137 INFO : Inserting sp|O15204|ADEC1_HUMAN
15 Dec 2023 01:49:55,358 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:49:55,358 INFO : Inserting sp|O15394|NCAM2_HUMAN
15 Dec 2023 01:49:55,715 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:49:55,715 INFO : Inserting sp|O15467|CCL16_HUMAN
15 Dec 2023 01:49:55,775 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:55,775 INFO : Inserting sp|O15511|ARPC5_HUMAN
15 Dec 2023 01:49:56,007 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:49:56,008 INFO : Inserting sp|O43157|PLXB1_HUMAN
15 Dec 2023 01:49:56,176 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:49:56,176 INFO : Inserting sp|O43175|SERA_HUMAN
15 Dec 2023 01:49:56,365 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:49:56,365 INFO : Inserting sp|O43242|PSMD3_HUMAN
15 Dec 2023 01:49:56,427 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:56,427 INFO : Inserting sp|O43278|SPIT1_HUMAN
15 Dec 2023 01:49:56,486 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:56,486 INFO : Inserting sp|O43286|B4GT5_HUMAN
15 Dec 2023 01:49:56,532 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:56,532 INFO : Inserting sp|O43310|CTIF_HUMAN
15 Dec 2023 01:49:56,597 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:56,598 INFO : Inserting sp|O43390|HNRPR_HUMAN
15 Dec 2023 01:49:56,976 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:49:56,976 INFO : Inserting sp|O43396|TXNL1_HUMAN
15 Dec 2023 01:49:57,224 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:49:57,224 INFO : Inserting sp|O43405|COCH_HUMAN
15 Dec 2023 01:49:57,245 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:57,246 INFO : Inserting sp|O43504|LTOR5_HUMAN
15 Dec 2023 01:49:57,308 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:57,308 INFO : Inserting sp|O43505|B4GA1_HUMAN
15 Dec 2023 01:49:57,573 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:49:57,573 INFO : Inserting sp|O43556|SGCE_HUMAN
15 Dec 2023 01:49:57,645 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:57,645 INFO : Inserting sp|O43567|RNF13_HUMAN
15 Dec 2023 01:49:57,741 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:57,741 INFO : Inserting sp|O43583|DENR_HUMAN
15 Dec 2023 01:49:57,795 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:49:57,795 INFO : Inserting sp|O43598|DNPH1_HUMAN
15 Dec 2023 01:49:57,908 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:49:57,908 INFO : Inserting sp|O43707|ACTN4_HUMAN
15 Dec 2023 01:50:00,259 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:50:00,259 INFO : Inserting sp|O43776|SYNC_HUMAN
15 Dec 2023 01:50:00,315 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:00,315 INFO : Inserting sp|O43790|KRT86_HUMAN
15 Dec 2023 01:50:00,485 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:00,485 INFO : Inserting sp|O43813|LANC1_HUMAN
15 Dec 2023 01:50:00,536 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:00,536 INFO : Inserting sp|O43866|CD5L_HUMAN
15 Dec 2023 01:50:01,473 INFO : 3% Done
15 Dec 2023 01:50:01,569 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:50:01,569 INFO : Inserting sp|O60462|NRP2_HUMAN
15 Dec 2023 01:50:01,637 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:01,637 INFO : Inserting sp|O60486|PLXC1_HUMAN
15 Dec 2023 01:50:01,687 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:01,687 INFO : Inserting sp|O60506|HNRPQ_HUMAN
15 Dec 2023 01:50:01,890 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:01,890 INFO : Inserting sp|O60568|PLOD3_HUMAN
15 Dec 2023 01:50:01,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:01,951 INFO : Inserting sp|O60610|DIAP1_HUMAN
15 Dec 2023 01:50:02,006 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:02,006 INFO : Inserting sp|O60664|PLIN3_HUMAN
15 Dec 2023 01:50:02,068 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:02,068 INFO : Inserting sp|O60706|ABCC9_HUMAN
15 Dec 2023 01:50:02,130 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:02,130 INFO : Inserting sp|O60749|SNX2_HUMAN
15 Dec 2023 01:50:02,190 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:02,190 INFO : Inserting sp|O60814|H2B1K_HUMAN
15 Dec 2023 01:50:02,269 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.64_F3_2_S4-D5_1_4510.d. SKYD file may be out of sync with primary Skyline document. Transition M - 848.4116, AM[+16.0]GIMNSFVNDIFER, 2
15 Dec 2023 01:50:02,269 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.29_F3_1_S4-F10_1_4539.d. SKYD file may be out of sync with primary Skyline document. Transition M - 848.4116, AM[+16.0]GIMNSFVNDIFER, 2
15 Dec 2023 01:50:02,269 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.29_F3_2_S4-F11_1_4540.d. SKYD file may be out of sync with primary Skyline document. Transition M - 848.4116, AM[+16.0]GIMNSFVNDIFER, 2
15 Dec 2023 01:50:02,388 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:02,388 INFO : Inserting sp|O60888|CUTA_HUMAN
15 Dec 2023 01:50:02,481 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:02,481 INFO : Inserting sp|O60890|OPHN1_HUMAN
15 Dec 2023 01:50:02,520 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:02,520 INFO : Inserting sp|O75015|FCG3B_HUMAN
15 Dec 2023 01:50:02,894 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:02,894 INFO : Inserting sp|O75027|ABCB7_HUMAN
15 Dec 2023 01:50:02,956 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:02,956 INFO : Inserting sp|O75037|KI21B_HUMAN
15 Dec 2023 01:50:03,019 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:03,019 INFO : Inserting sp|O75083|WDR1_HUMAN
15 Dec 2023 01:50:04,098 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:50:04,098 INFO : Inserting sp|O75093|SLIT1_HUMAN
15 Dec 2023 01:50:04,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:04,213 INFO : Inserting sp|O75127|PTCD1_HUMAN
15 Dec 2023 01:50:04,315 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:04,316 INFO : Inserting sp|O75131|CPNE3_HUMAN
15 Dec 2023 01:50:04,676 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:50:04,676 INFO : Inserting sp|O75144|ICOSL_HUMAN
15 Dec 2023 01:50:04,908 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:04,908 INFO : Inserting sp|O75223|GGCT_HUMAN
15 Dec 2023 01:50:04,943 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:04,943 INFO : Inserting sp|O75326|SEM7A_HUMAN
15 Dec 2023 01:50:05,235 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:05,235 INFO : Inserting sp|O75347|TBCA_HUMAN
15 Dec 2023 01:50:05,283 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:05,283 INFO : Inserting sp|O75351|VPS4B_HUMAN
15 Dec 2023 01:50:05,326 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:05,326 INFO : Inserting sp|O75356|ENTP5_HUMAN
15 Dec 2023 01:50:05,380 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:05,380 INFO : Inserting sp|O75367|H2AY_HUMAN
15 Dec 2023 01:50:05,746 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:05,746 INFO : Inserting sp|O75368|SH3L1_HUMAN
15 Dec 2023 01:50:06,003 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:06,003 INFO : Inserting sp|O75369|FLNB_HUMAN
15 Dec 2023 01:50:06,469 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:50:06,469 INFO : Inserting sp|O75390|CISY_HUMAN
15 Dec 2023 01:50:06,833 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:06,833 INFO : Inserting sp|O75460|ERN1_HUMAN
15 Dec 2023 01:50:06,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:06,899 INFO : Inserting sp|O75503|CLN5_HUMAN
15 Dec 2023 01:50:07,102 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:07,102 INFO : Inserting sp|O75509|TNR21_HUMAN
15 Dec 2023 01:50:07,355 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:07,355 INFO : Inserting sp|O75563|SKAP2_HUMAN
15 Dec 2023 01:50:07,410 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:07,410 INFO : Imported 100 peptide groups.
15 Dec 2023 01:50:07,410 INFO : Inserting sp|O75594|PGRP1_HUMAN
15 Dec 2023 01:50:07,669 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:07,669 INFO : Inserting sp|O75636|FCN3_HUMAN
15 Dec 2023 01:50:08,240 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:50:08,240 INFO : Inserting sp|O75695|XRP2_HUMAN
15 Dec 2023 01:50:08,288 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:08,288 INFO : Inserting sp|O75762|TRPA1_HUMAN
15 Dec 2023 01:50:08,307 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:08,307 INFO : Inserting sp|O75874|IDHC_HUMAN
15 Dec 2023 01:50:08,327 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.66_F3_2_S4-E3_1_4520.d. SKYD file may be out of sync with primary Skyline document. Transition M - 824.3858, ISGGSVVEM[+16.0]QGDEMTR, 2
15 Dec 2023 01:50:08,729 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:50:08,729 INFO : Inserting sp|O75882|ATRN_HUMAN
15 Dec 2023 01:50:09,336 INFO : 4% Done
15 Dec 2023 01:50:09,651 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.31_F3_2_S4-G9_1_4550.d. SKYD file may be out of sync with primary Skyline document. Transition M - 905.3640, C[+57.0]FSSDFM[+16.0]AYDIAC[+57.0]DR, 2
15 Dec 2023 01:50:11,084 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:11,143 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:50:11,143 INFO : Inserting sp|O75891|AL1L1_HUMAN
15 Dec 2023 01:50:11,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:11,196 INFO : Inserting sp|O75916|RGS9_HUMAN
15 Dec 2023 01:50:11,249 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:11,249 INFO : Inserting sp|O75923|DYSF_HUMAN
15 Dec 2023 01:50:11,406 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:11,406 INFO : Inserting sp|O75935|DCTN3_HUMAN
15 Dec 2023 01:50:11,509 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:11,509 INFO : Inserting sp|O75955|FLOT1_HUMAN
15 Dec 2023 01:50:11,922 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:50:11,922 INFO : Inserting sp|O75962|TRIO_HUMAN
15 Dec 2023 01:50:12,028 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:12,028 INFO : Inserting sp|O76003|GLRX3_HUMAN
15 Dec 2023 01:50:12,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,080 INFO : Inserting sp|O76061|STC2_HUMAN
15 Dec 2023 01:50:12,134 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,134 INFO : Inserting sp|O76080|ZFAN5_HUMAN
15 Dec 2023 01:50:12,138 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.51_F3_2_S1-H3_1_4458.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1053.9715, MSPM[+16.0]GTASGSNSPTSDSASVQR, 2
15 Dec 2023 01:50:12,139 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.34_F3_1_S4-H6_1_4559.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1053.9715, MSPM[+16.0]GTASGSNSPTSDSASVQR, 2
15 Dec 2023 01:50:12,156 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,156 INFO : Inserting sp|O76094|SRP72_HUMAN
15 Dec 2023 01:50:12,205 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,205 INFO : Inserting sp|O94760|DDAH1_HUMAN
15 Dec 2023 01:50:12,303 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:12,303 INFO : Inserting sp|O94761|RECQ4_HUMAN
15 Dec 2023 01:50:12,351 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,351 INFO : Inserting sp|O94769|ECM2_HUMAN
15 Dec 2023 01:50:12,450 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:12,450 INFO : Inserting sp|O94804|STK10_HUMAN
15 Dec 2023 01:50:12,476 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,476 INFO : Inserting sp|O94851|MICA2_HUMAN
15 Dec 2023 01:50:12,526 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:12,526 INFO : Inserting sp|O94856|NFASC_HUMAN
15 Dec 2023 01:50:12,790 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:12,790 INFO : Inserting sp|O94910|AGRL1_HUMAN
15 Dec 2023 01:50:12,906 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:12,906 INFO : Inserting sp|O94919|ENDD1_HUMAN
15 Dec 2023 01:50:13,172 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:13,172 INFO : Inserting sp|O94967|WDR47_HUMAN
15 Dec 2023 01:50:13,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:13,225 INFO : Inserting sp|O94985|CSTN1_HUMAN
15 Dec 2023 01:50:13,738 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:50:13,738 INFO : Inserting sp|O95153|RIMB1_HUMAN
15 Dec 2023 01:50:13,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:13,758 INFO : Inserting sp|O95197|RTN3_HUMAN
15 Dec 2023 01:50:13,779 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:13,779 INFO : Inserting sp|O95294|RASL1_HUMAN
15 Dec 2023 01:50:13,821 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:13,821 INFO : Inserting sp|O95359|TACC2_HUMAN
15 Dec 2023 01:50:13,844 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:13,844 INFO : Inserting sp|O95445|APOM_HUMAN
15 Dec 2023 01:50:14,197 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:50:14,197 INFO : Inserting sp|O95477|ABCA1_HUMAN
15 Dec 2023 01:50:14,258 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:14,258 INFO : Inserting sp|O95479|G6PE_HUMAN
15 Dec 2023 01:50:14,645 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:50:14,645 INFO : Inserting sp|O95486|SC24A_HUMAN
15 Dec 2023 01:50:14,659 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:14,659 INFO : Inserting sp|O95497|VNN1_HUMAN
15 Dec 2023 01:50:14,930 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:50:14,930 INFO : Inserting sp|O95498|VNN2_HUMAN
15 Dec 2023 01:50:14,963 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:14,963 INFO : Inserting sp|O95544|NADK_HUMAN
15 Dec 2023 01:50:15,001 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:15,001 INFO : Inserting sp|O95633|FSTL3_HUMAN
15 Dec 2023 01:50:15,047 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:15,047 INFO : Inserting sp|O95678|K2C75_HUMAN
15 Dec 2023 01:50:15,133 INFO : 5% Done
15 Dec 2023 01:50:15,210 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:50:15,210 INFO : Inserting sp|O95716|RAB3D_HUMAN
15 Dec 2023 01:50:15,251 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:15,251 INFO : Inserting sp|O95747|OXSR1_HUMAN
15 Dec 2023 01:50:15,273 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,273 INFO : Inserting sp|O95777|LSM8_HUMAN
15 Dec 2023 01:50:15,295 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,295 INFO : Inserting sp|O95803|NDST3_HUMAN
15 Dec 2023 01:50:15,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,322 INFO : Inserting sp|O95810|CAVN2_HUMAN
15 Dec 2023 01:50:15,477 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:15,478 INFO : Inserting sp|O95932|TGM3L_HUMAN
15 Dec 2023 01:50:15,481 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,481 INFO : Inserting sp|O95967|FBLN4_HUMAN
15 Dec 2023 01:50:15,586 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:15,586 INFO : Inserting sp|O95980|RECK_HUMAN
15 Dec 2023 01:50:15,606 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,606 INFO : Inserting sp|P00167|CYB5_HUMAN
15 Dec 2023 01:50:15,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:15,620 INFO : Inserting sp|P00338|LDHA_HUMAN
15 Dec 2023 01:50:16,040 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:50:16,040 INFO : Inserting sp|P00352|AL1A1_HUMAN
15 Dec 2023 01:50:16,419 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:50:16,419 INFO : Inserting sp|P00367|DHE3_HUMAN
15 Dec 2023 01:50:16,526 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:16,526 INFO : Inserting sp|P00387|NB5R3_HUMAN
15 Dec 2023 01:50:16,591 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:16,591 INFO : Inserting sp|P00390|GSHR_HUMAN
15 Dec 2023 01:50:16,922 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:50:16,922 INFO : Inserting sp|P00441|SODC_HUMAN
15 Dec 2023 01:50:17,067 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:17,068 INFO : Inserting sp|P00450|CERU_HUMAN
15 Dec 2023 01:50:18,231 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.49_F3_2_S1-G5_1_4448.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1150.0876, M[+16.0]YYSAVDPTKDIFTGLIGPMK, 2
15 Dec 2023 01:50:18,231 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.51_F3_1_S1-H2_1_4457.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1150.0876, M[+16.0]YYSAVDPTKDIFTGLIGPMK, 2
15 Dec 2023 01:50:18,437 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:18,478 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.58_F3_1_S4-A10_1_4477.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1213.5351, M[+16.0]FTTAPDQVDKEDEDFQESNK, 2
15 Dec 2023 01:50:18,478 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.34_F3_2_S4-H7_1_4560.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1213.5351, M[+16.0]FTTAPDQVDKEDEDFQESNK, 2
15 Dec 2023 01:50:19,050 INFO : 6% Done
15 Dec 2023 01:50:19,308 DEBUG: Total peptides inserted: 90
15 Dec 2023 01:50:19,308 INFO : Inserting sp|P00488|F13A_HUMAN
15 Dec 2023 01:50:20,278 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:50:20,278 INFO : Inserting sp|P00491|PNPH_HUMAN
15 Dec 2023 01:50:20,761 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.54_F3_1_S1-H12_1_4467.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,762 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.54_F3_2_S4-A1_1_4468.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,762 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.64_F3_1_S4-D4_1_4509.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,762 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.27_F3_2_S4-F1_1_4530.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,762 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.36_F3_1_S1-A4_1_4571.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,762 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.36_F3_2_S1-A5_1_4572.d. SKYD file may be out of sync with primary Skyline document. Transition M - 589.8006, VIM[+16.0]DYESLEK, 2
15 Dec 2023 01:50:20,838 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:50:20,838 INFO : Inserting sp|P00492|HPRT_HUMAN
15 Dec 2023 01:50:21,057 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:50:21,057 INFO : Inserting sp|P00505|AATM_HUMAN
15 Dec 2023 01:50:21,149 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:50:21,149 INFO : Inserting sp|P00533|EGFR_HUMAN
15 Dec 2023 01:50:21,177 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:21,177 INFO : Inserting sp|P00558|PGK1_HUMAN
15 Dec 2023 01:50:21,861 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:50:21,861 INFO : Inserting sp|P00568|KAD1_HUMAN
15 Dec 2023 01:50:22,078 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:50:22,078 INFO : Inserting sp|P00734|THRB_HUMAN
15 Dec 2023 01:50:22,735 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.62_F3_1_S4-C6_1_4497.d. SKYD file may be out of sync with primary Skyline document. Transition M - 1117.0515, IVEGSDAEIGM[+16.0]SPWQVM[+16.0]LFR, 2
15 Dec 2023 01:50:22,816 INFO : 7% Done
15 Dec 2023 01:50:23,582 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:23,716 DEBUG: Total peptides inserted: 55
15 Dec 2023 01:50:23,716 INFO : Inserting sp|P00736|C1R_HUMAN
15 Dec 2023 01:50:24,653 DEBUG: Total peptides inserted: 42
15 Dec 2023 01:50:24,654 INFO : Inserting sp|P00738|HPT_HUMAN
15 Dec 2023 01:50:25,481 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:50:25,481 INFO : Inserting sp|P00739|HPTR_HUMAN
15 Dec 2023 01:50:26,040 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:50:26,040 INFO : Inserting sp|P00740|FA9_HUMAN
15 Dec 2023 01:50:26,400 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.60_F3_1_S4-B8_1_4487.d. SKYD file may be out of sync with primary Skyline document. Transition M - 986.9416, FTIYNNM[+16.0]FC[+57.0]AGFHEGGR, 2
15 Dec 2023 01:50:26,400 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.60_F3_2_S4-B9_1_4488.d. SKYD file may be out of sync with primary Skyline document. Transition M - 986.9416, FTIYNNM[+16.0]FC[+57.0]AGFHEGGR, 2
15 Dec 2023 01:50:26,404 INFO : 8% Done
15 Dec 2023 01:50:26,466 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:50:26,466 INFO : Inserting sp|P00742|FA10_HUMAN
15 Dec 2023 01:50:26,895 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:50:26,895 INFO : Inserting sp|P00746|CFAD_HUMAN
15 Dec 2023 01:50:27,305 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:50:27,305 INFO : Inserting sp|P00747|PLMN_HUMAN
15 Dec 2023 01:50:27,499 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6666.27_F3_1_S4-E12_1_4529.d. SKYD file may be out of sync with primary Skyline document. Transition M - 544.8086, M[+16.0]RDVVLFEK, 2
15 Dec 2023 01:50:28,284 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:29,115 DEBUG: Total peptides inserted: 79
15 Dec 2023 01:50:29,116 INFO : Inserting sp|P00748|FA12_HUMAN
15 Dec 2023 01:50:29,857 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:50:29,858 INFO : Inserting sp|P00751|CFAB_HUMAN
15 Dec 2023 01:50:29,943 INFO : 9% Done
15 Dec 2023 01:50:31,201 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:31,550 DEBUG: Total peptides inserted: 63
15 Dec 2023 01:50:31,550 INFO : Inserting sp|P00915|CAH1_HUMAN
15 Dec 2023 01:50:31,985 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:50:31,985 INFO : Inserting sp|P00918|CAH2_HUMAN
15 Dec 2023 01:50:32,413 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:50:32,413 INFO : Inserting sp|P01008|ANT3_HUMAN
15 Dec 2023 01:50:33,618 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:33,644 INFO : 10% Done
15 Dec 2023 01:50:33,730 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:50:33,730 INFO : Inserting sp|P01009|A1AT_HUMAN
15 Dec 2023 01:50:34,792 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:50:34,792 INFO : Inserting sp|P01011|AACT_HUMAN
15 Dec 2023 01:50:36,538 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:36,580 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:50:36,580 INFO : Inserting sp|P01019|ANGT_HUMAN
15 Dec 2023 01:50:37,396 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:50:37,396 INFO : Inserting sp|P01023|A2MG_HUMAN
15 Dec 2023 01:50:37,660 INFO : 11% Done
15 Dec 2023 01:50:38,572 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:40,008 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.58_F3_2_S4-A11_1_4478.d. SKYD file may be out of sync with primary Skyline document. Transition M - 590.8127, M[+16.0]LERSNHVSR, 2
15 Dec 2023 01:50:40,008 WARN : Unable to find a matching chromatogram for file path D:\SILK\P017\Plasma\DATA\F3b\6653.62_F3_2_S4-C7_1_4498.d. SKYD file may be out of sync with primary Skyline document. Transition M - 590.8127, M[+16.0]LERSNHVSR, 2
15 Dec 2023 01:50:40,121 DEBUG: Inserted 100 peptides
15 Dec 2023 01:50:40,162 DEBUG: Total peptides inserted: 101
15 Dec 2023 01:50:40,162 INFO : Inserting sp|P01024|CO3_HUMAN
15 Dec 2023 01:50:41,427 INFO : 12% Done
15 Dec 2023 01:50:41,607 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:43,003 DEBUG: Inserted 100 peptides
15 Dec 2023 01:50:44,553 DEBUG: Inserted 150 peptides
15 Dec 2023 01:50:45,200 INFO : 13% Done
15 Dec 2023 01:50:45,803 DEBUG: Inserted 200 peptides
15 Dec 2023 01:50:45,858 DEBUG: Total peptides inserted: 202
15 Dec 2023 01:50:45,858 INFO : Inserting sp|P01031|CO5_HUMAN
15 Dec 2023 01:50:47,105 DEBUG: Inserted 50 peptides
15 Dec 2023 01:50:48,154 DEBUG: Inserted 100 peptides
15 Dec 2023 01:50:48,768 INFO : 14% Done
15 Dec 2023 01:50:48,825 DEBUG: Total peptides inserted: 130
15 Dec 2023 01:50:48,825 INFO : Inserting sp|P01033|TIMP1_HUMAN
15 Dec 2023 01:50:49,056 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:50:49,056 INFO : Inserting sp|P01034|CYTC_HUMAN
15 Dec 2023 01:50:49,484 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:50:49,484 INFO : Inserting sp|P01040|CYTA_HUMAN
15 Dec 2023 01:50:49,524 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:49,524 INFO : Inserting sp|P01042|KNG1_HUMAN
15 Dec 2023 01:50:50,489 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:50:50,489 INFO : Inserting sp|P01137|TGFB1_HUMAN
15 Dec 2023 01:50:50,503 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:50,503 INFO : Inserting sp|P01210|PENK_HUMAN
15 Dec 2023 01:50:50,557 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:50,557 INFO : Inserting sp|P01344|IGF2_HUMAN
15 Dec 2023 01:50:50,652 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:50,652 INFO : Inserting sp|P01591|IGJ_HUMAN
15 Dec 2023 01:50:50,859 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:50:50,859 INFO : Inserting sp|P01593|KVD33_HUMAN
15 Dec 2023 01:50:50,903 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:50,903 INFO : Inserting sp|P01594|KV133_HUMAN
15 Dec 2023 01:50:50,948 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:50,948 INFO : Inserting sp|P01597|KV139_HUMAN
15 Dec 2023 01:50:51,029 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,029 INFO : Inserting sp|P01602|KV105_HUMAN
15 Dec 2023 01:50:51,118 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,118 INFO : Inserting sp|P01611|KVD12_HUMAN
15 Dec 2023 01:50:51,202 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,202 INFO : Inserting sp|P01619|KV320_HUMAN
15 Dec 2023 01:50:51,291 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,291 INFO : Inserting sp|P01699|LV144_HUMAN
15 Dec 2023 01:50:51,361 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:51,361 INFO : Inserting sp|P01700|LV147_HUMAN
15 Dec 2023 01:50:51,446 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,446 INFO : Inserting sp|P01701|LV151_HUMAN
15 Dec 2023 01:50:51,502 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,502 INFO : Inserting sp|P01704|LV214_HUMAN
15 Dec 2023 01:50:51,569 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:51,569 INFO : Inserting sp|P01706|LV211_HUMAN
15 Dec 2023 01:50:51,615 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:51,615 INFO : Imported 200 peptide groups.
15 Dec 2023 01:50:51,615 INFO : Inserting sp|P01709|LV208_HUMAN
15 Dec 2023 01:50:51,644 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:51,644 INFO : Inserting sp|P01721|LV657_HUMAN
15 Dec 2023 01:50:51,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:51,668 INFO : Inserting sp|P01742|HV169_HUMAN
15 Dec 2023 01:50:51,738 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:51,738 INFO : Inserting sp|P01743|HV146_HUMAN
15 Dec 2023 01:50:51,801 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:51,802 INFO : Inserting sp|P01762|HV311_HUMAN
15 Dec 2023 01:50:51,915 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:51,915 INFO : Inserting sp|P01763|HV348_HUMAN
15 Dec 2023 01:50:52,043 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:52,043 INFO : Inserting sp|P01764|HV323_HUMAN
15 Dec 2023 01:50:52,195 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:52,195 INFO : Inserting sp|P01766|HV313_HUMAN
15 Dec 2023 01:50:52,373 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:52,373 INFO : Inserting sp|P01767|HV353_HUMAN
15 Dec 2023 01:50:52,489 INFO : 15% Done
15 Dec 2023 01:50:52,521 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:52,521 INFO : Inserting sp|P01768|HV330_HUMAN
15 Dec 2023 01:50:52,731 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:50:52,731 INFO : Inserting sp|P01772|HV333_HUMAN
15 Dec 2023 01:50:52,943 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:50:52,943 INFO : Inserting sp|P01780|HV307_HUMAN
15 Dec 2023 01:50:53,089 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:53,090 INFO : Inserting sp|P01782|HV309_HUMAN
15 Dec 2023 01:50:53,272 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:53,272 INFO : Inserting sp|P01817|HV205_HUMAN
15 Dec 2023 01:50:53,346 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:53,346 INFO : Inserting sp|P01824|HV439_HUMAN
15 Dec 2023 01:50:53,419 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:50:53,419 INFO : Inserting sp|P01833|PIGR_HUMAN
15 Dec 2023 01:50:53,547 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:53,547 INFO : Inserting sp|P01834|IGKC_HUMAN
15 Dec 2023 01:50:53,799 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:53,799 INFO : Inserting sp|P01857|IGHG1_HUMAN
15 Dec 2023 01:50:54,298 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:50:54,298 INFO : Inserting sp|P01859|IGHG2_HUMAN
15 Dec 2023 01:50:54,812 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:50:54,812 INFO : Inserting sp|P01860|IGHG3_HUMAN
15 Dec 2023 01:50:55,363 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:50:55,363 INFO : Inserting sp|P01861|IGHG4_HUMAN
15 Dec 2023 01:50:55,910 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:50:55,910 INFO : Inserting sp|P01871|IGHM_HUMAN
15 Dec 2023 01:50:56,122 INFO : 16% Done
15 Dec 2023 01:50:56,497 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:50:56,497 INFO : Inserting sp|P01876|IGHA1_HUMAN
15 Dec 2023 01:50:56,949 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:50:56,949 INFO : Inserting sp|P01877|IGHA2_HUMAN
15 Dec 2023 01:50:57,160 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:50:57,160 INFO : Inserting sp|P01880|IGHD_HUMAN
15 Dec 2023 01:50:57,382 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:50:57,382 INFO : Inserting sp|P01889|HLAB_HUMAN
15 Dec 2023 01:50:57,491 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:57,491 INFO : Inserting sp|P01893|HLAH_HUMAN
15 Dec 2023 01:50:57,611 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:50:57,611 INFO : Inserting sp|P01903|DRA_HUMAN
15 Dec 2023 01:50:57,679 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:57,679 INFO : Inserting sp|P01911|DRB1_HUMAN
15 Dec 2023 01:50:57,711 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:50:57,711 INFO : Inserting sp|P02008|HBAZ_HUMAN
15 Dec 2023 01:50:57,867 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:50:57,867 INFO : Inserting sp|P02042|HBD_HUMAN
15 Dec 2023 01:50:58,318 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:50:58,318 INFO : Inserting sp|P02100|HBE_HUMAN
15 Dec 2023 01:50:58,385 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:50:58,386 INFO : Inserting sp|P02452|CO1A1_HUMAN
15 Dec 2023 01:50:58,763 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:50:58,763 INFO : Inserting sp|P02461|CO3A1_HUMAN
15 Dec 2023 01:50:59,159 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:50:59,159 INFO : Inserting sp|P02462|CO4A1_HUMAN
15 Dec 2023 01:50:59,188 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:50:59,188 INFO : Inserting sp|P02533|K1C14_HUMAN
15 Dec 2023 01:50:59,720 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:50:59,720 INFO : Inserting sp|P02538|K2C6A_HUMAN
15 Dec 2023 01:50:59,812 INFO : 17% Done
15 Dec 2023 01:51:00,161 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:51:00,162 INFO : Inserting sp|P02545|LMNA_HUMAN
15 Dec 2023 01:51:00,185 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:00,186 INFO : Inserting sp|P02549|SPTA1_HUMAN
15 Dec 2023 01:51:01,375 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:02,742 DEBUG: Inserted 100 peptides
15 Dec 2023 01:51:03,375 INFO : 18% Done
15 Dec 2023 01:51:03,903 DEBUG: Total peptides inserted: 146
15 Dec 2023 01:51:03,903 INFO : Inserting sp|P02647|APOA1_HUMAN
15 Dec 2023 01:51:05,019 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:51:05,019 INFO : Inserting sp|P02649|APOE_HUMAN
15 Dec 2023 01:51:05,712 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:51:05,712 INFO : Inserting sp|P02652|APOA2_HUMAN
15 Dec 2023 01:51:06,003 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:51:06,003 INFO : Inserting sp|P02654|APOC1_HUMAN
15 Dec 2023 01:51:06,160 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:51:06,160 INFO : Inserting sp|P02655|APOC2_HUMAN
15 Dec 2023 01:51:06,383 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:51:06,383 INFO : Inserting sp|P02656|APOC3_HUMAN
15 Dec 2023 01:51:06,520 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:51:06,520 INFO : Inserting sp|P02671|FIBA_HUMAN
15 Dec 2023 01:51:07,126 INFO : 19% Done
15 Dec 2023 01:51:07,662 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:07,787 DEBUG: Total peptides inserted: 56
15 Dec 2023 01:51:07,787 INFO : Inserting sp|P02675|FIBB_HUMAN
15 Dec 2023 01:51:09,101 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:09,243 DEBUG: Total peptides inserted: 58
15 Dec 2023 01:51:09,243 INFO : Inserting sp|P02679|FIBG_HUMAN
15 Dec 2023 01:51:10,273 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:51:10,273 INFO : Inserting sp|P02724|GLPA_HUMAN
15 Dec 2023 01:51:10,321 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:10,321 INFO : Inserting sp|P02730|B3AT_HUMAN
15 Dec 2023 01:51:10,839 INFO : 20% Done
15 Dec 2023 01:51:11,049 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:51:11,049 INFO : Inserting sp|P02741|CRP_HUMAN
15 Dec 2023 01:51:11,199 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:51:11,199 INFO : Inserting sp|P02743|SAMP_HUMAN
15 Dec 2023 01:51:11,422 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:51:11,422 INFO : Inserting sp|P02745|C1QA_HUMAN
15 Dec 2023 01:51:11,717 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:51:11,717 INFO : Inserting sp|P02746|C1QB_HUMAN
15 Dec 2023 01:51:12,064 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:51:12,064 INFO : Inserting sp|P02747|C1QC_HUMAN
15 Dec 2023 01:51:12,247 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:51:12,247 INFO : Inserting sp|P02748|CO9_HUMAN
15 Dec 2023 01:51:13,004 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:51:13,005 INFO : Inserting sp|P02749|APOH_HUMAN
15 Dec 2023 01:51:13,504 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:51:13,504 INFO : Inserting sp|P02750|A2GL_HUMAN
15 Dec 2023 01:51:13,853 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:51:13,853 INFO : Inserting sp|P02751|FINC_HUMAN
15 Dec 2023 01:51:14,418 INFO : 21% Done
15 Dec 2023 01:51:14,842 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:16,330 DEBUG: Inserted 100 peptides
15 Dec 2023 01:51:16,856 DEBUG: Total peptides inserted: 123
15 Dec 2023 01:51:16,856 INFO : Inserting sp|P02753|RET4_HUMAN
15 Dec 2023 01:51:17,233 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:51:17,233 INFO : Inserting sp|P02760|AMBP_HUMAN
15 Dec 2023 01:51:17,810 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:51:17,810 INFO : Inserting sp|P02763|A1AG1_HUMAN
15 Dec 2023 01:51:18,070 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:51:18,070 INFO : Inserting sp|P02765|FETUA_HUMAN
15 Dec 2023 01:51:18,219 INFO : 22% Done
15 Dec 2023 01:51:18,590 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:51:18,590 INFO : Inserting sp|P02766|TTHY_HUMAN
15 Dec 2023 01:51:19,144 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:51:19,144 INFO : Inserting sp|P02768|ALBU_HUMAN
15 Dec 2023 01:51:20,714 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:21,522 DEBUG: Total peptides inserted: 81
15 Dec 2023 01:51:21,522 INFO : Inserting sp|P02774|VTDB_HUMAN
15 Dec 2023 01:51:21,917 INFO : 23% Done
15 Dec 2023 01:51:22,812 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:51:22,812 INFO : Inserting sp|P02775|CXCL7_HUMAN
15 Dec 2023 01:51:22,975 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:51:22,975 INFO : Inserting sp|P02776|PLF4_HUMAN
15 Dec 2023 01:51:23,068 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:51:23,068 INFO : Inserting sp|P02778|CXL10_HUMAN
15 Dec 2023 01:51:23,116 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:51:23,116 INFO : Inserting sp|P02786|TFR1_HUMAN
15 Dec 2023 01:51:23,830 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:51:23,830 INFO : Inserting sp|P02787|TRFE_HUMAN
15 Dec 2023 01:51:25,034 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:25,346 DEBUG: Total peptides inserted: 60
15 Dec 2023 01:51:25,346 INFO : Inserting sp|P02788|TRFL_HUMAN
15 Dec 2023 01:51:25,551 INFO : 24% Done
15 Dec 2023 01:51:26,610 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:51:26,610 INFO : Inserting sp|P02790|HEMO_HUMAN
15 Dec 2023 01:51:27,651 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:51:27,651 INFO : Inserting sp|P02792|FRIL_HUMAN
15 Dec 2023 01:51:27,803 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:51:27,803 INFO : Inserting sp|P02794|FRIH_HUMAN
15 Dec 2023 01:51:27,904 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:51:27,904 INFO : Inserting sp|P02795|MT2_HUMAN
15 Dec 2023 01:51:27,920 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:27,920 INFO : Inserting sp|P03950|ANGI_HUMAN
15 Dec 2023 01:51:28,123 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:51:28,123 INFO : Inserting sp|P03951|FA11_HUMAN
15 Dec 2023 01:51:28,953 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:51:28,953 INFO : Inserting sp|P03952|KLKB1_HUMAN
15 Dec 2023 01:51:29,324 INFO : 25% Done
15 Dec 2023 01:51:29,933 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:29,944 DEBUG: Total peptides inserted: 50
15 Dec 2023 01:51:29,944 INFO : Inserting sp|P04003|C4BPA_HUMAN
15 Dec 2023 01:51:30,875 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:51:30,875 INFO : Inserting sp|P04004|VTNC_HUMAN
15 Dec 2023 01:51:31,331 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:51:31,331 INFO : Inserting sp|P04040|CATA_HUMAN
15 Dec 2023 01:51:32,184 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:51:32,184 INFO : Inserting sp|P04066|FUCO_HUMAN
15 Dec 2023 01:51:32,271 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:51:32,271 INFO : Inserting sp|P04070|PROC_HUMAN
15 Dec 2023 01:51:32,664 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:51:32,664 INFO : Inserting sp|P04075|ALDOA_HUMAN
15 Dec 2023 01:51:33,302 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:51:33,302 INFO : Inserting sp|P04080|CYTB_HUMAN
15 Dec 2023 01:51:33,350 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:33,351 INFO : Inserting sp|P04083|ANXA1_HUMAN
15 Dec 2023 01:51:33,751 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:51:33,752 INFO : Inserting sp|P04114|APOB_HUMAN
15 Dec 2023 01:51:34,987 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:36,333 INFO : 26% Done
15 Dec 2023 01:51:36,379 DEBUG: Inserted 100 peptides
15 Dec 2023 01:51:37,455 DEBUG: Inserted 150 peptides
15 Dec 2023 01:51:38,652 DEBUG: Inserted 200 peptides
15 Dec 2023 01:51:40,033 INFO : 27% Done
15 Dec 2023 01:51:40,033 DEBUG: Inserted 250 peptides
15 Dec 2023 01:51:41,346 DEBUG: Inserted 300 peptides
15 Dec 2023 01:51:42,784 DEBUG: Inserted 350 peptides
15 Dec 2023 01:51:43,768 INFO : 28% Done
15 Dec 2023 01:51:43,916 DEBUG: Inserted 400 peptides
15 Dec 2023 01:51:44,122 DEBUG: Total peptides inserted: 410
15 Dec 2023 01:51:44,122 INFO : Inserting sp|P04156|PRIO_HUMAN
15 Dec 2023 01:51:44,160 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:51:44,160 INFO : Inserting sp|P04179|SODM_HUMAN
15 Dec 2023 01:51:44,293 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:51:44,293 INFO : Inserting sp|P04180|LCAT_HUMAN
15 Dec 2023 01:51:44,551 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:51:44,551 INFO : Inserting sp|P04196|HRG_HUMAN
15 Dec 2023 01:51:45,196 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:51:45,196 INFO : Inserting sp|P04216|THY1_HUMAN
15 Dec 2023 01:51:45,221 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:45,221 INFO : Inserting sp|P04217|A1BG_HUMAN
15 Dec 2023 01:51:45,945 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:51:45,945 INFO : Inserting sp|P04264|K2C1_HUMAN
15 Dec 2023 01:51:46,849 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:51:46,849 INFO : Inserting sp|P04275|VWF_HUMAN
15 Dec 2023 01:51:47,448 INFO : 29% Done
15 Dec 2023 01:51:48,130 DEBUG: Inserted 50 peptides
15 Dec 2023 01:51:49,038 DEBUG: Total peptides inserted: 88
15 Dec 2023 01:51:49,038 INFO : Inserting sp|P04278|SHBG_HUMAN
15 Dec 2023 01:51:49,589 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:51:49,589 INFO : Inserting sp|P04350|TBB4A_HUMAN
15 Dec 2023 01:51:49,822 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:51:49,822 INFO : Inserting sp|P04406|G3P_HUMAN
15 Dec 2023 01:51:50,422 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:51:50,422 INFO : Inserting sp|P04439|HLAA_HUMAN
15 Dec 2023 01:51:50,586 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:51:50,586 INFO : Imported 300 peptide groups.
15 Dec 2023 01:51:50,586 INFO : Inserting sp|P04632|CPNS1_HUMAN
15 Dec 2023 01:51:50,612 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:50,612 INFO : Inserting sp|P04732|MT1E_HUMAN
15 Dec 2023 01:51:50,626 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:50,626 INFO : Inserting sp|P04746|AMYP_HUMAN
15 Dec 2023 01:51:50,936 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:51:50,936 INFO : Inserting sp|P04792|HSPB1_HUMAN
15 Dec 2023 01:51:50,966 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:50,966 INFO : Inserting sp|P04839|CY24B_HUMAN
15 Dec 2023 01:51:51,006 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:51,006 INFO : Inserting sp|P04844|RPN2_HUMAN
15 Dec 2023 01:51:51,054 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:51,054 INFO : Inserting sp|P04899|GNAI2_HUMAN
15 Dec 2023 01:51:51,264 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:51:51,264 INFO : Inserting sp|P04908|H2A1B_HUMAN
15 Dec 2023 01:51:51,380 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:51:51,380 INFO : Inserting sp|P04921|GLPC_HUMAN
15 Dec 2023 01:51:51,397 INFO : 30% Done
15 Dec 2023 01:51:51,439 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:51,439 INFO : Inserting sp|P05019|IGF1_HUMAN
15 Dec 2023 01:51:51,555 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:51:51,555 INFO : Inserting sp|P05023|AT1A1_HUMAN
15 Dec 2023 01:51:51,764 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:51:51,764 INFO : Inserting sp|P05026|AT1B1_HUMAN
15 Dec 2023 01:51:51,800 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:51,800 INFO : Inserting sp|P05060|SCG1_HUMAN
15 Dec 2023 01:51:52,151 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:51:52,151 INFO : Inserting sp|P05062|ALDOB_HUMAN
15 Dec 2023 01:51:52,268 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:51:52,268 INFO : Inserting sp|P05067|A4_HUMAN
15 Dec 2023 01:51:52,649 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:51:52,649 INFO : Inserting sp|P05089|ARGI1_HUMAN
15 Dec 2023 01:51:52,793 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:51:52,793 INFO : Inserting sp|P05090|APOD_HUMAN
15 Dec 2023 01:51:53,034 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:51:53,034 INFO : Inserting sp|P05106|ITB3_HUMAN
15 Dec 2023 01:51:53,374 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:51:53,374 INFO : Inserting sp|P05107|ITB2_HUMAN
15 Dec 2023 01:51:53,714 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:51:53,714 INFO : Inserting sp|P05109|S10A8_HUMAN
15 Dec 2023 01:51:54,038 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:51:54,038 INFO : Inserting sp|P05121|PAI1_HUMAN
15 Dec 2023 01:51:54,081 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:54,081 INFO : Inserting sp|P05154|IPSP_HUMAN
15 Dec 2023 01:51:54,656 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:51:54,657 INFO : Inserting sp|P05155|IC1_HUMAN
15 Dec 2023 01:51:55,254 INFO : 31% Done
15 Dec 2023 01:51:55,862 DEBUG: Total peptides inserted: 44
15 Dec 2023 01:51:55,862 INFO : Inserting sp|P05156|CFAI_HUMAN
15 Dec 2023 01:51:56,611 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:51:56,611 INFO : Inserting sp|P05160|F13B_HUMAN
15 Dec 2023 01:51:57,477 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:51:57,477 INFO : Inserting sp|P05164|PERM_HUMAN
15 Dec 2023 01:51:58,294 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:51:58,294 INFO : Inserting sp|P05186|PPBT_HUMAN
15 Dec 2023 01:51:58,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:51:58,322 INFO : Inserting sp|P05362|ICAM1_HUMAN
15 Dec 2023 01:51:58,600 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:51:58,600 INFO : Inserting sp|P05408|7B2_HUMAN
15 Dec 2023 01:51:58,632 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:58,632 INFO : Inserting sp|P05451|REG1A_HUMAN
15 Dec 2023 01:51:58,691 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:51:58,691 INFO : Inserting sp|P05452|TETN_HUMAN
15 Dec 2023 01:51:58,813 INFO : 32% Done
15 Dec 2023 01:51:59,002 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:51:59,002 INFO : Inserting sp|P05543|THBG_HUMAN
15 Dec 2023 01:51:59,563 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:51:59,563 INFO : Inserting sp|P05546|HEP2_HUMAN
15 Dec 2023 01:52:00,488 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:52:00,488 INFO : Inserting sp|P05556|ITB1_HUMAN
15 Dec 2023 01:52:00,661 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:00,661 INFO : Inserting sp|P05783|K1C18_HUMAN
15 Dec 2023 01:52:00,710 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:00,710 INFO : Inserting sp|P05787|K2C8_HUMAN
15 Dec 2023 01:52:00,854 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:00,854 INFO : Inserting sp|P05937|CALB1_HUMAN
15 Dec 2023 01:52:00,885 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:00,885 INFO : Inserting sp|P05981|HEPS_HUMAN
15 Dec 2023 01:52:00,912 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:00,912 INFO : Inserting sp|P05997|CO5A2_HUMAN
15 Dec 2023 01:52:00,939 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:00,939 INFO : Inserting sp|P06132|DCUP_HUMAN
15 Dec 2023 01:52:01,093 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:01,093 INFO : Inserting sp|P06276|CHLE_HUMAN
15 Dec 2023 01:52:01,710 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:52:01,710 INFO : Inserting sp|P06312|KV401_HUMAN
15 Dec 2023 01:52:01,794 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:01,794 INFO : Inserting sp|P06396|GELS_HUMAN
15 Dec 2023 01:52:02,572 INFO : 33% Done
15 Dec 2023 01:52:03,099 DEBUG: Total peptides inserted: 41
15 Dec 2023 01:52:03,099 INFO : Inserting sp|P06576|ATPB_HUMAN
15 Dec 2023 01:52:03,205 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:03,205 INFO : Inserting sp|P06681|CO2_HUMAN
15 Dec 2023 01:52:04,328 DEBUG: Total peptides inserted: 49
15 Dec 2023 01:52:04,328 INFO : Inserting sp|P06702|S10A9_HUMAN
15 Dec 2023 01:52:04,631 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:04,631 INFO : Inserting sp|P06727|APOA4_HUMAN
15 Dec 2023 01:52:05,532 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:52:05,532 INFO : Inserting sp|P06730|IF4E_HUMAN
15 Dec 2023 01:52:05,585 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:05,585 INFO : Inserting sp|P06731|CEAM5_HUMAN
15 Dec 2023 01:52:05,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:05,611 INFO : Inserting sp|P06733|ENOA_HUMAN
15 Dec 2023 01:52:06,036 INFO : 34% Done
15 Dec 2023 01:52:06,226 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:52:06,226 INFO : Inserting sp|P06737|PYGL_HUMAN
15 Dec 2023 01:52:06,615 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:52:06,615 INFO : Inserting sp|P06744|G6PI_HUMAN
15 Dec 2023 01:52:07,071 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:52:07,071 INFO : Inserting sp|P06748|NPM_HUMAN
15 Dec 2023 01:52:07,116 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:07,116 INFO : Inserting sp|P06753|TPM3_HUMAN
15 Dec 2023 01:52:07,316 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:07,316 INFO : Inserting sp|P06865|HEXA_HUMAN
15 Dec 2023 01:52:07,376 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:07,376 INFO : Inserting sp|P06899|H2B1J_HUMAN
15 Dec 2023 01:52:07,495 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:07,495 INFO : Inserting sp|P07108|ACBP_HUMAN
15 Dec 2023 01:52:07,621 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:07,622 INFO : Inserting sp|P07195|LDHB_HUMAN
15 Dec 2023 01:52:08,176 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:52:08,176 INFO : Inserting sp|P07196|NFL_HUMAN
15 Dec 2023 01:52:08,192 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:08,192 INFO : Inserting sp|P07203|GPX1_HUMAN
15 Dec 2023 01:52:08,473 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:08,473 INFO : Inserting sp|P07205|PGK2_HUMAN
15 Dec 2023 01:52:08,630 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:08,630 INFO : Inserting sp|P07225|PROS_HUMAN
15 Dec 2023 01:52:09,437 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:52:09,437 INFO : Inserting sp|P07237|PDIA1_HUMAN
15 Dec 2023 01:52:09,739 INFO : 35% Done
15 Dec 2023 01:52:09,842 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:52:09,842 INFO : Inserting sp|P07333|CSF1R_HUMAN
15 Dec 2023 01:52:10,127 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:52:10,127 INFO : Inserting sp|P07339|CATD_HUMAN
15 Dec 2023 01:52:10,554 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:52:10,554 INFO : Inserting sp|P07355|ANXA2_HUMAN
15 Dec 2023 01:52:10,841 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:52:10,841 INFO : Inserting sp|P07357|CO8A_HUMAN
15 Dec 2023 01:52:11,736 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:52:11,736 INFO : Inserting sp|P07358|CO8B_HUMAN
15 Dec 2023 01:52:12,756 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:52:12,756 INFO : Inserting sp|P07359|GP1BA_HUMAN
15 Dec 2023 01:52:13,059 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:52:13,059 INFO : Inserting sp|P07360|CO8G_HUMAN
15 Dec 2023 01:52:13,276 INFO : 36% Done
15 Dec 2023 01:52:13,492 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:52:13,492 INFO : Inserting sp|P07384|CAN1_HUMAN
15 Dec 2023 01:52:13,615 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:13,615 INFO : Inserting sp|P07437|TBB5_HUMAN
15 Dec 2023 01:52:13,989 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:52:13,989 INFO : Inserting sp|P07451|CAH3_HUMAN
15 Dec 2023 01:52:14,214 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:14,214 INFO : Inserting sp|P07477|TRY1_HUMAN
15 Dec 2023 01:52:14,283 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:14,283 INFO : Inserting sp|P07585|PGS2_HUMAN
15 Dec 2023 01:52:14,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:14,345 INFO : Inserting sp|P07602|SAP_HUMAN
15 Dec 2023 01:52:14,903 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:52:14,903 INFO : Inserting sp|P07686|HEXB_HUMAN
15 Dec 2023 01:52:15,046 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:15,046 INFO : Inserting sp|P07711|CATL1_HUMAN
15 Dec 2023 01:52:15,179 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:15,179 INFO : Inserting sp|P07737|PROF1_HUMAN
15 Dec 2023 01:52:15,513 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:52:15,513 INFO : Inserting sp|P07738|PMGE_HUMAN
15 Dec 2023 01:52:15,857 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:52:15,857 INFO : Inserting sp|P07741|APT_HUMAN
15 Dec 2023 01:52:15,898 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:15,898 INFO : Inserting sp|P07858|CATB_HUMAN
15 Dec 2023 01:52:16,120 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:52:16,120 INFO : Inserting sp|P07900|HS90A_HUMAN
15 Dec 2023 01:52:16,581 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:52:16,581 INFO : Inserting sp|P07910|HNRPC_HUMAN
15 Dec 2023 01:52:16,628 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:16,628 INFO : Inserting sp|P07911|UROM_HUMAN
15 Dec 2023 01:52:16,684 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:16,685 INFO : Inserting sp|P07942|LAMB1_HUMAN
15 Dec 2023 01:52:16,922 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:16,922 INFO : Inserting sp|P07948|LYN_HUMAN
15 Dec 2023 01:52:16,959 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:16,959 INFO : Inserting sp|P07951|TPM2_HUMAN
15 Dec 2023 01:52:17,130 INFO : 37% Done
15 Dec 2023 01:52:17,146 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:17,146 INFO : Inserting sp|P07954|FUMH_HUMAN
15 Dec 2023 01:52:17,286 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:17,287 INFO : Inserting sp|P07996|TSP1_HUMAN
15 Dec 2023 01:52:18,190 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:52:18,190 INFO : Inserting sp|P07998|RNAS1_HUMAN
15 Dec 2023 01:52:18,325 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:18,325 INFO : Inserting sp|P08069|IGF1R_HUMAN
15 Dec 2023 01:52:18,350 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:18,351 INFO : Inserting sp|P08123|CO1A2_HUMAN
15 Dec 2023 01:52:18,700 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:52:18,700 INFO : Inserting sp|P08133|ANXA6_HUMAN
15 Dec 2023 01:52:19,218 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:52:19,218 INFO : Inserting sp|P08174|DAF_HUMAN
15 Dec 2023 01:52:19,255 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:19,255 INFO : Inserting sp|P08185|CBG_HUMAN
15 Dec 2023 01:52:19,721 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:52:19,721 INFO : Inserting sp|P08195|4F2_HUMAN
15 Dec 2023 01:52:20,060 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:52:20,060 INFO : Inserting sp|P08236|BGLR_HUMAN
15 Dec 2023 01:52:20,108 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:20,108 INFO : Inserting sp|P08237|PFKAM_HUMAN
15 Dec 2023 01:52:20,142 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:20,142 INFO : Inserting sp|P08238|HS90B_HUMAN
15 Dec 2023 01:52:20,622 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:52:20,622 INFO : Imported 400 peptide groups.
15 Dec 2023 01:52:20,622 INFO : Inserting sp|P08246|ELNE_HUMAN
15 Dec 2023 01:52:20,630 INFO : 38% Done
15 Dec 2023 01:52:20,690 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:20,690 INFO : Inserting sp|P08253|MMP2_HUMAN
15 Dec 2023 01:52:21,093 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:52:21,093 INFO : Inserting sp|P08294|SODE_HUMAN
15 Dec 2023 01:52:21,365 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:21,365 INFO : Inserting sp|P08311|CATG_HUMAN
15 Dec 2023 01:52:21,563 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:21,563 INFO : Inserting sp|P08397|HEM3_HUMAN
15 Dec 2023 01:52:21,751 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:21,751 INFO : Inserting sp|P08493|MGP_HUMAN
15 Dec 2023 01:52:21,781 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:21,781 INFO : Inserting sp|P08514|ITA2B_HUMAN
15 Dec 2023 01:52:22,369 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:52:22,369 INFO : Inserting sp|P08519|APOA_HUMAN
15 Dec 2023 01:52:22,873 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:52:22,874 INFO : Inserting sp|P08567|PLEK_HUMAN
15 Dec 2023 01:52:23,001 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:23,001 INFO : Inserting sp|P08571|CD14_HUMAN
15 Dec 2023 01:52:23,495 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:52:23,495 INFO : Inserting sp|P08572|CO4A2_HUMAN
15 Dec 2023 01:52:23,548 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:23,548 INFO : Inserting sp|P08575|PTPRC_HUMAN
15 Dec 2023 01:52:23,850 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:52:23,850 INFO : Inserting sp|P08603|CFAH_HUMAN
15 Dec 2023 01:52:24,429 INFO : 39% Done
15 Dec 2023 01:52:24,832 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:25,663 DEBUG: Total peptides inserted: 89
15 Dec 2023 01:52:25,663 INFO : Inserting sp|P08637|FCG3A_HUMAN
15 Dec 2023 01:52:25,790 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:25,790 INFO : Inserting sp|P08670|VIME_HUMAN
15 Dec 2023 01:52:26,289 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:52:26,289 INFO : Inserting sp|P08697|A2AP_HUMAN
15 Dec 2023 01:52:27,143 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:52:27,143 INFO : Inserting sp|P08709|FA7_HUMAN
15 Dec 2023 01:52:27,406 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:52:27,407 INFO : Inserting sp|P08729|K2C7_HUMAN
15 Dec 2023 01:52:27,511 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:27,512 INFO : Inserting sp|P08754|GNAI3_HUMAN
15 Dec 2023 01:52:27,621 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:27,621 INFO : Inserting sp|P08758|ANXA5_HUMAN
15 Dec 2023 01:52:27,901 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:52:27,902 INFO : Inserting sp|P08779|K1C16_HUMAN
15 Dec 2023 01:52:27,955 INFO : 40% Done
15 Dec 2023 01:52:28,603 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:52:28,603 INFO : Inserting sp|P08865|RSSA_HUMAN
15 Dec 2023 01:52:28,653 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:28,653 INFO : Inserting sp|P08962|CD63_HUMAN
15 Dec 2023 01:52:28,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:28,669 INFO : Inserting sp|P09104|ENOG_HUMAN
15 Dec 2023 01:52:28,858 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:28,858 INFO : Inserting sp|P09172|DOPO_HUMAN
15 Dec 2023 01:52:29,446 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:52:29,446 INFO : Inserting sp|P09211|GSTP1_HUMAN
15 Dec 2023 01:52:29,693 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:29,693 INFO : Inserting sp|P09326|CD48_HUMAN
15 Dec 2023 01:52:29,717 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:29,717 INFO : Inserting sp|P09382|LEG1_HUMAN
15 Dec 2023 01:52:29,825 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:29,826 INFO : Inserting sp|P09417|DHPR_HUMAN
15 Dec 2023 01:52:29,977 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:29,977 INFO : Inserting sp|P09429|HMGB1_HUMAN
15 Dec 2023 01:52:30,095 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:30,095 INFO : Inserting sp|P09467|F16P1_HUMAN
15 Dec 2023 01:52:30,149 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:30,149 INFO : Inserting sp|P09486|SPRC_HUMAN
15 Dec 2023 01:52:30,626 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:52:30,626 INFO : Inserting sp|P09493|TPM1_HUMAN
15 Dec 2023 01:52:30,743 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:30,743 INFO : Inserting sp|P09525|ANXA4_HUMAN
15 Dec 2023 01:52:30,971 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:30,971 INFO : Inserting sp|P09603|CSF1_HUMAN
15 Dec 2023 01:52:31,043 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:31,044 INFO : Inserting sp|P09619|PGFRB_HUMAN
15 Dec 2023 01:52:31,159 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:31,159 INFO : Inserting sp|P09622|DLDH_HUMAN
15 Dec 2023 01:52:31,183 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:31,183 INFO : Inserting sp|P09651|ROA1_HUMAN
15 Dec 2023 01:52:31,287 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:31,287 INFO : Inserting sp|P09668|CATH_HUMAN
15 Dec 2023 01:52:31,369 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:31,369 INFO : Inserting sp|P09769|FGR_HUMAN
15 Dec 2023 01:52:31,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:31,401 INFO : Inserting sp|P09871|C1S_HUMAN
15 Dec 2023 01:52:31,761 INFO : 41% Done
15 Dec 2023 01:52:32,183 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:52:32,183 INFO : Inserting sp|P09914|IFIT1_HUMAN
15 Dec 2023 01:52:32,207 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:32,207 INFO : Inserting sp|P09917|LOX5_HUMAN
15 Dec 2023 01:52:32,248 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:32,248 INFO : Inserting sp|P09960|LKHA4_HUMAN
15 Dec 2023 01:52:32,875 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:52:32,875 INFO : Inserting sp|P09972|ALDOC_HUMAN
15 Dec 2023 01:52:33,110 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:33,111 INFO : Inserting sp|P0C0L4|CO4A_HUMAN
15 Dec 2023 01:52:34,690 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:35,560 INFO : 42% Done
15 Dec 2023 01:52:36,182 DEBUG: Inserted 100 peptides
15 Dec 2023 01:52:37,365 DEBUG: Total peptides inserted: 141
15 Dec 2023 01:52:37,365 INFO : Inserting sp|P0C0L5|CO4B_HUMAN
15 Dec 2023 01:52:38,762 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:39,329 INFO : 43% Done
15 Dec 2023 01:52:40,099 DEBUG: Inserted 100 peptides
15 Dec 2023 01:52:41,294 DEBUG: Total peptides inserted: 140
15 Dec 2023 01:52:41,294 INFO : Inserting sp|P0C0S8|H2A1_HUMAN
15 Dec 2023 01:52:41,402 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:41,402 INFO : Inserting sp|P0CG47|UBB_HUMAN
15 Dec 2023 01:52:41,533 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:41,533 INFO : Inserting sp|P0CG48|UBC_HUMAN
15 Dec 2023 01:52:41,663 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:41,663 INFO : Inserting sp|P0DJI8|SAA1_HUMAN
15 Dec 2023 01:52:41,834 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:41,834 INFO : Inserting sp|P0DJI9|SAA2_HUMAN
15 Dec 2023 01:52:42,003 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:42,003 INFO : Inserting sp|P0DME0|SETLP_HUMAN
15 Dec 2023 01:52:42,018 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:42,018 INFO : Inserting sp|P0DMV8|HS71A_HUMAN
15 Dec 2023 01:52:42,522 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:52:42,522 INFO : Inserting sp|P0DMV9|HS71B_HUMAN
15 Dec 2023 01:52:43,033 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:52:43,033 INFO : Inserting sp|P0DOY2|IGLC2_HUMAN
15 Dec 2023 01:52:43,143 INFO : 44% Done
15 Dec 2023 01:52:43,278 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:43,279 INFO : Inserting sp|P0DOY3|IGLC3_HUMAN
15 Dec 2023 01:52:43,476 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:43,476 INFO : Inserting sp|P0DP23|CALM1_HUMAN
15 Dec 2023 01:52:43,528 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:43,528 INFO : Inserting sp|P0DP24|CALM2_HUMAN
15 Dec 2023 01:52:43,582 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:43,583 INFO : Inserting sp|P0DP25|CALM3_HUMAN
15 Dec 2023 01:52:43,643 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:43,643 INFO : Inserting sp|P0DPK3|NT2NB_HUMAN
15 Dec 2023 01:52:43,658 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:43,658 INFO : Inserting sp|P0DPK4|NT2NC_HUMAN
15 Dec 2023 01:52:43,672 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:43,673 INFO : Inserting sp|P0DTE7|AMY1B_HUMAN
15 Dec 2023 01:52:43,935 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:43,936 INFO : Inserting sp|P0DTE8|AMY1C_HUMAN
15 Dec 2023 01:52:44,200 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:44,200 INFO : Inserting sp|P0DUB6|AMY1A_HUMAN
15 Dec 2023 01:52:44,448 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:44,449 INFO : Inserting sp|P10124|SRGN_HUMAN
15 Dec 2023 01:52:44,489 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:44,489 INFO : Inserting sp|P10145|IL8_HUMAN
15 Dec 2023 01:52:44,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:44,511 INFO : Inserting sp|P10153|RNAS2_HUMAN
15 Dec 2023 01:52:44,592 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:44,592 INFO : Inserting sp|P10253|LYAG_HUMAN
15 Dec 2023 01:52:44,632 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:44,632 INFO : Inserting sp|P10321|HLAC_HUMAN
15 Dec 2023 01:52:44,760 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:44,760 INFO : Inserting sp|P10412|H14_HUMAN
15 Dec 2023 01:52:44,878 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:44,878 INFO : Inserting sp|P10451|OSTP_HUMAN
15 Dec 2023 01:52:45,038 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:45,039 INFO : Inserting sp|P10586|PTPRF_HUMAN
15 Dec 2023 01:52:45,139 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:52:45,139 INFO : Inserting sp|P10599|THIO_HUMAN
15 Dec 2023 01:52:45,239 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:45,239 INFO : Inserting sp|P10619|PPGB_HUMAN
15 Dec 2023 01:52:45,300 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:45,300 INFO : Inserting sp|P10643|CO7_HUMAN
15 Dec 2023 01:52:46,392 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:46,457 DEBUG: Total peptides inserted: 54
15 Dec 2023 01:52:46,457 INFO : Inserting sp|P10644|KAP0_HUMAN
15 Dec 2023 01:52:46,504 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:46,504 INFO : Inserting sp|P10645|CMGA_HUMAN
15 Dec 2023 01:52:46,665 INFO : 45% Done
15 Dec 2023 01:52:46,684 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:46,684 INFO : Inserting sp|P10646|TFPI1_HUMAN
15 Dec 2023 01:52:46,708 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:46,708 INFO : Inserting sp|P10721|KIT_HUMAN
15 Dec 2023 01:52:46,879 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:52:46,879 INFO : Inserting sp|P10746|HEM4_HUMAN
15 Dec 2023 01:52:46,914 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:46,914 INFO : Inserting sp|P10768|ESTD_HUMAN
15 Dec 2023 01:52:47,157 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:52:47,157 INFO : Inserting sp|P10809|CH60_HUMAN
15 Dec 2023 01:52:47,266 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:47,266 INFO : Inserting sp|P10909|CLUS_HUMAN
15 Dec 2023 01:52:48,047 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:52:48,047 INFO : Inserting sp|P11021|BIP_HUMAN
15 Dec 2023 01:52:48,698 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:52:48,698 INFO : Inserting sp|P11047|LAMC1_HUMAN
15 Dec 2023 01:52:49,080 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:52:49,080 INFO : Inserting sp|P11142|HSP7C_HUMAN
15 Dec 2023 01:52:49,834 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:52:49,834 INFO : Inserting sp|P11150|LIPC_HUMAN
15 Dec 2023 01:52:49,876 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:49,876 INFO : Inserting sp|P11166|GTR1_HUMAN
15 Dec 2023 01:52:50,152 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:52:50,152 INFO : Inserting sp|P11169|GTR3_HUMAN
15 Dec 2023 01:52:50,174 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:50,174 INFO : Inserting sp|P11171|EPB41_HUMAN
15 Dec 2023 01:52:50,422 INFO : 46% Done
15 Dec 2023 01:52:50,690 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:52:50,690 INFO : Inserting sp|P11215|ITAM_HUMAN
15 Dec 2023 01:52:51,142 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:52:51,142 INFO : Inserting sp|P11226|MBL2_HUMAN
15 Dec 2023 01:52:51,453 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:52:51,453 INFO : Inserting sp|P11277|SPTB1_HUMAN
15 Dec 2023 01:52:52,563 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:53,756 DEBUG: Inserted 100 peptides
15 Dec 2023 01:52:53,797 INFO : 47% Done
15 Dec 2023 01:52:54,623 DEBUG: Total peptides inserted: 130
15 Dec 2023 01:52:54,623 INFO : Inserting sp|P11279|LAMP1_HUMAN
15 Dec 2023 01:52:54,713 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:52:54,713 INFO : Inserting sp|P11362|FGFR1_HUMAN
15 Dec 2023 01:52:54,806 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:54,806 INFO : Inserting sp|P11413|G6PD_HUMAN
15 Dec 2023 01:52:55,108 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:52:55,108 INFO : Inserting sp|P11488|GNAT1_HUMAN
15 Dec 2023 01:52:55,139 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:55,139 INFO : Inserting sp|P11586|C1TC_HUMAN
15 Dec 2023 01:52:55,188 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:55,188 INFO : Inserting sp|P11597|CETP_HUMAN
15 Dec 2023 01:52:55,384 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:52:55,384 INFO : Imported 500 peptide groups.
15 Dec 2023 01:52:55,384 INFO : Inserting sp|P11678|PERE_HUMAN
15 Dec 2023 01:52:55,499 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:52:55,500 INFO : Inserting sp|P11717|MPRI_HUMAN
15 Dec 2023 01:52:55,847 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:52:55,847 INFO : Inserting sp|P11766|ADHX_HUMAN
15 Dec 2023 01:52:55,925 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:55,925 INFO : Inserting sp|P12107|COBA1_HUMAN
15 Dec 2023 01:52:55,990 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:52:55,990 INFO : Inserting sp|P12109|CO6A1_HUMAN
15 Dec 2023 01:52:56,417 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:52:56,417 INFO : Inserting sp|P12110|CO6A2_HUMAN
15 Dec 2023 01:52:56,465 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:56,466 INFO : Inserting sp|P12111|CO6A3_HUMAN
15 Dec 2023 01:52:57,365 DEBUG: Total peptides inserted: 40
15 Dec 2023 01:52:57,365 INFO : Inserting sp|P12259|FA5_HUMAN
15 Dec 2023 01:52:57,672 INFO : 48% Done
15 Dec 2023 01:52:58,329 DEBUG: Inserted 50 peptides
15 Dec 2023 01:52:58,960 DEBUG: Total peptides inserted: 86
15 Dec 2023 01:52:58,960 INFO : Inserting sp|P12273|PIP_HUMAN
15 Dec 2023 01:52:59,003 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:52:59,003 INFO : Inserting sp|P12318|FCG2A_HUMAN
15 Dec 2023 01:52:59,016 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:52:59,016 INFO : Inserting sp|P12429|ANXA3_HUMAN
15 Dec 2023 01:52:59,369 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:52:59,369 INFO : Inserting sp|P12724|ECP_HUMAN
15 Dec 2023 01:52:59,473 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:52:59,473 INFO : Inserting sp|P12814|ACTN1_HUMAN
15 Dec 2023 01:53:00,730 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:00,789 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:53:00,789 INFO : Inserting sp|P12821|ACE_HUMAN
15 Dec 2023 01:53:00,847 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:00,847 INFO : Inserting sp|P12830|CADH1_HUMAN
15 Dec 2023 01:53:00,965 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:00,965 INFO : Inserting sp|P12955|PEPD_HUMAN
15 Dec 2023 01:53:01,281 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:01,281 INFO : Inserting sp|P12956|XRCC6_HUMAN
15 Dec 2023 01:53:01,335 INFO : 49% Done
15 Dec 2023 01:53:01,533 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:01,533 INFO : Inserting sp|P13010|XRCC5_HUMAN
15 Dec 2023 01:53:01,646 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:01,646 INFO : Inserting sp|P13164|IFM1_HUMAN
15 Dec 2023 01:53:01,672 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:01,672 INFO : Inserting sp|P13224|GP1BB_HUMAN
15 Dec 2023 01:53:01,748 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:01,748 INFO : Inserting sp|P13284|GILT_HUMAN
15 Dec 2023 01:53:01,791 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:01,791 INFO : Inserting sp|P13473|LAMP2_HUMAN
15 Dec 2023 01:53:01,875 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:01,875 INFO : Inserting sp|P13489|RINI_HUMAN
15 Dec 2023 01:53:02,370 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:53:02,370 INFO : Inserting sp|P13498|CY24A_HUMAN
15 Dec 2023 01:53:02,400 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:02,400 INFO : Inserting sp|P13500|CCL2_HUMAN
15 Dec 2023 01:53:02,450 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:02,451 INFO : Inserting sp|P13591|NCAM1_HUMAN
15 Dec 2023 01:53:02,943 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:53:02,944 INFO : Inserting sp|P13598|ICAM2_HUMAN
15 Dec 2023 01:53:03,087 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:03,087 INFO : Inserting sp|P13611|CSPG2_HUMAN
15 Dec 2023 01:53:03,425 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:03,425 INFO : Inserting sp|P13612|ITA4_HUMAN
15 Dec 2023 01:53:03,441 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:03,441 INFO : Inserting sp|P13639|EF2_HUMAN
15 Dec 2023 01:53:03,695 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:03,695 INFO : Inserting sp|P13640|MT1G_HUMAN
15 Dec 2023 01:53:03,712 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:03,712 INFO : Inserting sp|P13645|K1C10_HUMAN
15 Dec 2023 01:53:04,560 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:53:04,560 INFO : Inserting sp|P13646|K1C13_HUMAN
15 Dec 2023 01:53:04,718 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:04,718 INFO : Inserting sp|P13647|K2C5_HUMAN
15 Dec 2023 01:53:05,048 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:53:05,048 INFO : Inserting sp|P13667|PDIA4_HUMAN
15 Dec 2023 01:53:05,111 INFO : 50% Done
15 Dec 2023 01:53:05,158 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:05,158 INFO : Inserting sp|P13671|CO6_HUMAN
15 Dec 2023 01:53:06,345 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:06,398 DEBUG: Total peptides inserted: 52
15 Dec 2023 01:53:06,398 INFO : Inserting sp|P13688|CEAM1_HUMAN
15 Dec 2023 01:53:06,426 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:06,426 INFO : Inserting sp|P13693|TCTP_HUMAN
15 Dec 2023 01:53:06,519 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:06,519 INFO : Inserting sp|P13716|HEM2_HUMAN
15 Dec 2023 01:53:06,883 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:06,883 INFO : Inserting sp|P13727|PRG2_HUMAN
15 Dec 2023 01:53:07,058 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:07,058 INFO : Inserting sp|P13747|HLAE_HUMAN
15 Dec 2023 01:53:07,136 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:07,136 INFO : Inserting sp|P13796|PLSL_HUMAN
15 Dec 2023 01:53:08,200 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:53:08,201 INFO : Inserting sp|P13797|PLST_HUMAN
15 Dec 2023 01:53:08,416 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:08,416 INFO : Inserting sp|P13798|ACPH_HUMAN
15 Dec 2023 01:53:08,527 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:08,527 INFO : Inserting sp|P13929|ENOB_HUMAN
15 Dec 2023 01:53:08,702 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:08,702 INFO : Inserting sp|P13987|CD59_HUMAN
15 Dec 2023 01:53:08,810 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:08,810 INFO : Inserting sp|P14136|GFAP_HUMAN
15 Dec 2023 01:53:08,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:08,868 INFO : Inserting sp|P14151|LYAM1_HUMAN
15 Dec 2023 01:53:08,895 INFO : 51% Done
15 Dec 2023 01:53:09,012 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:09,012 INFO : Inserting sp|P14174|MIF_HUMAN
15 Dec 2023 01:53:09,075 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:09,075 INFO : Inserting sp|P14207|FOLR2_HUMAN
15 Dec 2023 01:53:09,199 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:09,199 INFO : Inserting sp|P14314|GLU2B_HUMAN
15 Dec 2023 01:53:09,309 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:09,309 INFO : Inserting sp|P14317|HCLS1_HUMAN
15 Dec 2023 01:53:09,373 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:09,374 INFO : Inserting sp|P14543|NID1_HUMAN
15 Dec 2023 01:53:09,712 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:09,712 INFO : Inserting sp|P14550|AK1A1_HUMAN
15 Dec 2023 01:53:09,786 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:09,786 INFO : Inserting sp|P14598|NCF1_HUMAN
15 Dec 2023 01:53:10,019 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:10,019 INFO : Inserting sp|P14618|KPYM_HUMAN
15 Dec 2023 01:53:10,673 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:53:10,673 INFO : Inserting sp|P14625|ENPL_HUMAN
15 Dec 2023 01:53:11,127 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:53:11,127 INFO : Inserting sp|P14649|MYL6B_HUMAN
15 Dec 2023 01:53:11,191 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:11,191 INFO : Inserting sp|P14780|MMP9_HUMAN
15 Dec 2023 01:53:11,692 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:53:11,692 INFO : Inserting sp|P14868|SYDC_HUMAN
15 Dec 2023 01:53:11,757 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:11,757 INFO : Inserting sp|P15090|FABP4_HUMAN
15 Dec 2023 01:53:11,801 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:11,801 INFO : Inserting sp|P15104|GLNA_HUMAN
15 Dec 2023 01:53:11,845 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:11,845 INFO : Inserting sp|P15121|ALDR_HUMAN
15 Dec 2023 01:53:11,897 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:11,897 INFO : Inserting sp|P15144|AMPN_HUMAN
15 Dec 2023 01:53:12,448 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:53:12,448 INFO : Inserting sp|P15151|PVR_HUMAN
15 Dec 2023 01:53:12,600 INFO : 52% Done
15 Dec 2023 01:53:12,618 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:12,618 INFO : Inserting sp|P15153|RAC2_HUMAN
15 Dec 2023 01:53:12,679 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:12,679 INFO : Inserting sp|P15169|CBPN_HUMAN
15 Dec 2023 01:53:13,277 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:53:13,277 INFO : Inserting sp|P15289|ARSA_HUMAN
15 Dec 2023 01:53:13,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:13,302 INFO : Inserting sp|P15291|B4GT1_HUMAN
15 Dec 2023 01:53:13,391 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:13,391 INFO : Inserting sp|P15311|EZRI_HUMAN
15 Dec 2023 01:53:13,756 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:13,756 INFO : Inserting sp|P15328|FOLR1_HUMAN
15 Dec 2023 01:53:13,869 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:13,869 INFO : Inserting sp|P15374|UCHL3_HUMAN
15 Dec 2023 01:53:13,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:13,898 INFO : Inserting sp|P15509|CSF2R_HUMAN
15 Dec 2023 01:53:13,924 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:13,924 INFO : Inserting sp|P15531|NDKA_HUMAN
15 Dec 2023 01:53:14,146 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:14,146 INFO : Inserting sp|P15559|NQO1_HUMAN
15 Dec 2023 01:53:14,173 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:14,173 INFO : Inserting sp|P15586|GNS_HUMAN
15 Dec 2023 01:53:14,221 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:14,221 INFO : Inserting sp|P15814|IGLL1_HUMAN
15 Dec 2023 01:53:14,247 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:14,247 INFO : Inserting sp|P15880|RS2_HUMAN
15 Dec 2023 01:53:14,271 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:14,271 INFO : Inserting sp|P16035|TIMP2_HUMAN
15 Dec 2023 01:53:14,432 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:14,432 INFO : Inserting sp|P16070|CD44_HUMAN
15 Dec 2023 01:53:14,495 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:14,495 INFO : Inserting sp|P16083|NQO2_HUMAN
15 Dec 2023 01:53:14,516 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:14,516 INFO : Inserting sp|P16109|LYAM3_HUMAN
15 Dec 2023 01:53:14,559 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:14,559 INFO : Inserting sp|P16152|CBR1_HUMAN
15 Dec 2023 01:53:14,714 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:14,714 INFO : Inserting sp|P16157|ANK1_HUMAN
15 Dec 2023 01:53:16,133 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:16,319 INFO : 53% Done
15 Dec 2023 01:53:16,939 DEBUG: Total peptides inserted: 81
15 Dec 2023 01:53:16,939 INFO : Inserting sp|P16284|PECA1_HUMAN
15 Dec 2023 01:53:16,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:16,960 INFO : Inserting sp|P16401|H15_HUMAN
15 Dec 2023 01:53:17,051 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:17,051 INFO : Inserting sp|P16402|H13_HUMAN
15 Dec 2023 01:53:17,178 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:17,178 INFO : Inserting sp|P16403|H12_HUMAN
15 Dec 2023 01:53:17,299 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:17,299 INFO : Inserting sp|P16452|EPB42_HUMAN
15 Dec 2023 01:53:17,927 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:53:17,927 INFO : Inserting sp|P16615|AT2A2_HUMAN
15 Dec 2023 01:53:17,953 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:17,953 INFO : Inserting sp|P16671|CD36_HUMAN
15 Dec 2023 01:53:17,989 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:17,989 INFO : Inserting sp|P16870|CBPE_HUMAN
15 Dec 2023 01:53:18,237 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:18,237 INFO : Inserting sp|P16885|PLCG2_HUMAN
15 Dec 2023 01:53:18,302 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:18,302 INFO : Inserting sp|P16930|FAAA_HUMAN
15 Dec 2023 01:53:18,452 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:18,453 INFO : Inserting sp|P17050|NAGAB_HUMAN
15 Dec 2023 01:53:18,475 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:18,475 INFO : Inserting sp|P17066|HSP76_HUMAN
15 Dec 2023 01:53:18,692 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:18,692 INFO : Inserting sp|P17174|AATC_HUMAN
15 Dec 2023 01:53:18,907 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:18,907 INFO : Inserting sp|P17213|BPI_HUMAN
15 Dec 2023 01:53:18,965 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:18,965 INFO : Inserting sp|P17813|EGLN_HUMAN
15 Dec 2023 01:53:19,021 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:19,021 INFO : Inserting sp|P17844|DDX5_HUMAN
15 Dec 2023 01:53:19,060 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:19,060 INFO : Imported 600 peptide groups.
15 Dec 2023 01:53:19,060 INFO : Inserting sp|P17858|PFKAL_HUMAN
15 Dec 2023 01:53:19,103 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:19,103 INFO : Inserting sp|P17900|SAP3_HUMAN
15 Dec 2023 01:53:19,195 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:19,195 INFO : Inserting sp|P17931|LEG3_HUMAN
15 Dec 2023 01:53:19,296 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:19,296 INFO : Inserting sp|P17936|IBP3_HUMAN
15 Dec 2023 01:53:19,594 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:53:19,594 INFO : Inserting sp|P17980|PRS6A_HUMAN
15 Dec 2023 01:53:19,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:19,620 INFO : Inserting sp|P17987|TCPA_HUMAN
15 Dec 2023 01:53:19,747 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:19,748 INFO : Inserting sp|P18065|IBP2_HUMAN
15 Dec 2023 01:53:19,794 INFO : 54% Done
15 Dec 2023 01:53:19,987 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:19,987 INFO : Inserting sp|P18206|VINC_HUMAN
15 Dec 2023 01:53:20,891 DEBUG: Total peptides inserted: 45
15 Dec 2023 01:53:20,891 INFO : Inserting sp|P18428|LBP_HUMAN
15 Dec 2023 01:53:21,279 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:21,279 INFO : Inserting sp|P18510|IL1RA_HUMAN
15 Dec 2023 01:53:21,359 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:21,359 INFO : Inserting sp|P18577|RHCE_HUMAN
15 Dec 2023 01:53:21,393 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:21,393 INFO : Inserting sp|P18669|PGAM1_HUMAN
15 Dec 2023 01:53:21,715 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:53:21,715 INFO : Inserting sp|P18850|ATF6A_HUMAN
15 Dec 2023 01:53:21,728 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:21,729 INFO : Inserting sp|P19012|K1C15_HUMAN
15 Dec 2023 01:53:21,901 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:21,902 INFO : Inserting sp|P19013|K2C4_HUMAN
15 Dec 2023 01:53:22,107 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:22,107 INFO : Inserting sp|P19021|AMD_HUMAN
15 Dec 2023 01:53:22,243 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:22,243 INFO : Inserting sp|P19022|CADH2_HUMAN
15 Dec 2023 01:53:22,471 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:22,471 INFO : Inserting sp|P19087|GNAT2_HUMAN
15 Dec 2023 01:53:22,495 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:22,496 INFO : Inserting sp|P19105|ML12A_HUMAN
15 Dec 2023 01:53:22,642 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:22,642 INFO : Inserting sp|P19320|VCAM1_HUMAN
15 Dec 2023 01:53:23,294 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:53:23,295 INFO : Inserting sp|P19338|NUCL_HUMAN
15 Dec 2023 01:53:23,317 INFO : 55% Done
15 Dec 2023 01:53:23,421 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:23,421 INFO : Inserting sp|P19367|HXK1_HUMAN
15 Dec 2023 01:53:23,546 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:23,546 INFO : Inserting sp|P19438|TNR1A_HUMAN
15 Dec 2023 01:53:23,596 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:23,596 INFO : Inserting sp|P19652|A1AG2_HUMAN
15 Dec 2023 01:53:23,964 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:53:23,965 INFO : Inserting sp|P19823|ITIH2_HUMAN
15 Dec 2023 01:53:25,351 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:25,588 DEBUG: Total peptides inserted: 57
15 Dec 2023 01:53:25,588 INFO : Inserting sp|P19827|ITIH1_HUMAN
15 Dec 2023 01:53:27,116 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:27,505 INFO : 56% Done
15 Dec 2023 01:53:27,589 DEBUG: Total peptides inserted: 62
15 Dec 2023 01:53:27,589 INFO : Inserting sp|P19835|CEL_HUMAN
15 Dec 2023 01:53:27,637 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:27,637 INFO : Inserting sp|P19878|NCF2_HUMAN
15 Dec 2023 01:53:27,726 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:27,726 INFO : Inserting sp|P19971|TYPH_HUMAN
15 Dec 2023 01:53:27,991 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:27,991 INFO : Inserting sp|P20020|AT2B1_HUMAN
15 Dec 2023 01:53:28,031 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:28,031 INFO : Inserting sp|P20036|DPA1_HUMAN
15 Dec 2023 01:53:28,056 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:28,056 INFO : Inserting sp|P20061|TCO1_HUMAN
15 Dec 2023 01:53:28,126 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:28,127 INFO : Inserting sp|P20062|TCO2_HUMAN
15 Dec 2023 01:53:28,246 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:28,246 INFO : Inserting sp|P20073|ANXA7_HUMAN
15 Dec 2023 01:53:28,309 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:28,310 INFO : Inserting sp|P20160|CAP7_HUMAN
15 Dec 2023 01:53:28,439 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:28,439 INFO : Inserting sp|P20333|TNR1B_HUMAN
15 Dec 2023 01:53:28,454 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:28,454 INFO : Inserting sp|P20339|RAB5A_HUMAN
15 Dec 2023 01:53:28,482 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:28,482 INFO : Inserting sp|P20591|MX1_HUMAN
15 Dec 2023 01:53:28,523 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:28,523 INFO : Inserting sp|P20618|PSB1_HUMAN
15 Dec 2023 01:53:28,671 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:28,671 INFO : Inserting sp|P20671|H2A1D_HUMAN
15 Dec 2023 01:53:28,768 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:28,768 INFO : Inserting sp|P20700|LMNB1_HUMAN
15 Dec 2023 01:53:29,197 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:53:29,197 INFO : Inserting sp|P20701|ITAL_HUMAN
15 Dec 2023 01:53:29,252 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:29,252 INFO : Inserting sp|P20718|GRAH_HUMAN
15 Dec 2023 01:53:29,294 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:29,294 INFO : Inserting sp|P20742|PZP_HUMAN
15 Dec 2023 01:53:30,575 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:31,144 DEBUG: Total peptides inserted: 73
15 Dec 2023 01:53:31,145 INFO : Inserting sp|P20774|MIME_HUMAN
15 Dec 2023 01:53:31,191 INFO : 57% Done
15 Dec 2023 01:53:31,373 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:31,373 INFO : Inserting sp|P20810|ICAL_HUMAN
15 Dec 2023 01:53:31,437 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:31,437 INFO : Inserting sp|P20851|C4BPB_HUMAN
15 Dec 2023 01:53:31,709 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:31,709 INFO : Inserting sp|P20908|CO5A1_HUMAN
15 Dec 2023 01:53:31,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:31,736 INFO : Inserting sp|P20929|NEBU_HUMAN
15 Dec 2023 01:53:31,782 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:31,782 INFO : Inserting sp|P20933|ASPG_HUMAN
15 Dec 2023 01:53:31,871 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:31,871 INFO : Inserting sp|P21246|PTN_HUMAN
15 Dec 2023 01:53:31,923 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:31,923 INFO : Inserting sp|P21281|VATB2_HUMAN
15 Dec 2023 01:53:31,954 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:31,954 INFO : Inserting sp|P21291|CSRP1_HUMAN
15 Dec 2023 01:53:31,975 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:31,975 INFO : Inserting sp|P21333|FLNA_HUMAN
15 Dec 2023 01:53:32,848 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:33,876 DEBUG: Total peptides inserted: 99
15 Dec 2023 01:53:33,876 INFO : Inserting sp|P21741|MK_HUMAN
15 Dec 2023 01:53:33,892 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:33,892 INFO : Inserting sp|P21796|VDAC1_HUMAN
15 Dec 2023 01:53:33,946 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:33,946 INFO : Inserting sp|P21802|FGFR2_HUMAN
15 Dec 2023 01:53:34,016 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:34,017 INFO : Inserting sp|P21810|PGS1_HUMAN
15 Dec 2023 01:53:34,047 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:34,048 INFO : Inserting sp|P21817|RYR1_HUMAN
15 Dec 2023 01:53:34,077 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:34,078 INFO : Inserting sp|P21926|CD9_HUMAN
15 Dec 2023 01:53:34,125 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:34,125 INFO : Inserting sp|P21980|TGM2_HUMAN
15 Dec 2023 01:53:34,141 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:34,141 INFO : Inserting sp|P22061|PIMT_HUMAN
15 Dec 2023 01:53:34,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:34,292 INFO : Inserting sp|P22079|PERL_HUMAN
15 Dec 2023 01:53:34,325 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:34,326 INFO : Inserting sp|P22083|FUT4_HUMAN
15 Dec 2023 01:53:34,354 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:34,354 INFO : Inserting sp|P22105|TENX_HUMAN
15 Dec 2023 01:53:34,860 INFO : 58% Done
15 Dec 2023 01:53:35,644 DEBUG: Inserted 50 peptides
15 Dec 2023 01:53:35,966 DEBUG: Total peptides inserted: 63
15 Dec 2023 01:53:35,966 INFO : Inserting sp|P22234|PUR6_HUMAN
15 Dec 2023 01:53:36,034 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:36,034 INFO : Inserting sp|P22314|UBA1_HUMAN
15 Dec 2023 01:53:36,446 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:53:36,446 INFO : Inserting sp|P22352|GPX3_HUMAN
15 Dec 2023 01:53:36,754 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:36,754 INFO : Inserting sp|P22392|NDKB_HUMAN
15 Dec 2023 01:53:36,971 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:36,971 INFO : Inserting sp|P22626|ROA2_HUMAN
15 Dec 2023 01:53:37,153 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:37,153 INFO : Inserting sp|P22692|IBP4_HUMAN
15 Dec 2023 01:53:37,322 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:37,322 INFO : Inserting sp|P22792|CPN2_HUMAN
15 Dec 2023 01:53:37,897 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:37,897 INFO : Inserting sp|P22891|PROZ_HUMAN
15 Dec 2023 01:53:38,282 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:53:38,282 INFO : Inserting sp|P22894|MMP8_HUMAN
15 Dec 2023 01:53:38,376 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:38,376 INFO : Inserting sp|P22897|MRC1_HUMAN
15 Dec 2023 01:53:38,702 INFO : 59% Done
15 Dec 2023 01:53:38,888 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:53:38,888 INFO : Inserting sp|P23083|HV102_HUMAN
15 Dec 2023 01:53:38,988 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:38,988 INFO : Inserting sp|P23141|EST1_HUMAN
15 Dec 2023 01:53:39,127 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:39,127 INFO : Inserting sp|P23142|FBLN1_HUMAN
15 Dec 2023 01:53:39,941 DEBUG: Total peptides inserted: 34
15 Dec 2023 01:53:39,941 INFO : Inserting sp|P23246|SFPQ_HUMAN
15 Dec 2023 01:53:40,016 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:40,016 INFO : Inserting sp|P23276|KELL_HUMAN
15 Dec 2023 01:53:40,116 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:40,116 INFO : Inserting sp|P23284|PPIB_HUMAN
15 Dec 2023 01:53:40,302 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:40,302 INFO : Inserting sp|P23368|MAOM_HUMAN
15 Dec 2023 01:53:40,331 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:40,331 INFO : Inserting sp|P23381|SYWC_HUMAN
15 Dec 2023 01:53:40,580 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:40,580 INFO : Inserting sp|P23468|PTPRD_HUMAN
15 Dec 2023 01:53:40,727 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:40,727 INFO : Inserting sp|P23469|PTPRE_HUMAN
15 Dec 2023 01:53:40,748 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:40,748 INFO : Inserting sp|P23470|PTPRG_HUMAN
15 Dec 2023 01:53:40,966 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:53:40,966 INFO : Inserting sp|P23471|PTPRZ_HUMAN
15 Dec 2023 01:53:41,199 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:41,199 INFO : Inserting sp|P23515|OMGP_HUMAN
15 Dec 2023 01:53:41,327 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:41,327 INFO : Inserting sp|P23526|SAHH_HUMAN
15 Dec 2023 01:53:41,620 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:53:41,621 INFO : Inserting sp|P23527|H2B1O_HUMAN
15 Dec 2023 01:53:41,732 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:41,732 INFO : Inserting sp|P23528|COF1_HUMAN
15 Dec 2023 01:53:42,103 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:53:42,103 INFO : Inserting sp|P24043|LAMA2_HUMAN
15 Dec 2023 01:53:42,284 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:42,284 INFO : Inserting sp|P24158|PRTN3_HUMAN
15 Dec 2023 01:53:42,357 INFO : 60% Done
15 Dec 2023 01:53:42,410 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:42,410 INFO : Inserting sp|P24534|EF1B_HUMAN
15 Dec 2023 01:53:42,457 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:42,457 INFO : Inserting sp|P24592|IBP6_HUMAN
15 Dec 2023 01:53:42,619 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:42,619 INFO : Inserting sp|P24593|IBP5_HUMAN
15 Dec 2023 01:53:42,765 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:42,766 INFO : Inserting sp|P24666|PPAC_HUMAN
15 Dec 2023 01:53:42,892 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:42,892 INFO : Inserting sp|P24821|TENA_HUMAN
15 Dec 2023 01:53:43,340 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:53:43,340 INFO : Inserting sp|P24844|MYL9_HUMAN
15 Dec 2023 01:53:43,446 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:43,446 INFO : Inserting sp|P25054|APC_HUMAN
15 Dec 2023 01:53:43,475 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:43,475 INFO : Imported 700 peptide groups.
15 Dec 2023 01:53:43,475 INFO : Inserting sp|P25098|ARBK1_HUMAN
15 Dec 2023 01:53:43,502 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:43,502 INFO : Inserting sp|P25311|ZA2G_HUMAN
15 Dec 2023 01:53:44,154 DEBUG: Total peptides inserted: 31
15 Dec 2023 01:53:44,154 INFO : Inserting sp|P25325|THTM_HUMAN
15 Dec 2023 01:53:44,235 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:44,235 INFO : Inserting sp|P25705|ATPA_HUMAN
15 Dec 2023 01:53:44,294 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:44,294 INFO : Inserting sp|P25774|CATS_HUMAN
15 Dec 2023 01:53:44,422 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:44,422 INFO : Inserting sp|P25786|PSA1_HUMAN
15 Dec 2023 01:53:44,652 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:44,652 INFO : Inserting sp|P25787|PSA2_HUMAN
15 Dec 2023 01:53:44,795 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:44,795 INFO : Inserting sp|P25788|PSA3_HUMAN
15 Dec 2023 01:53:44,926 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:44,926 INFO : Inserting sp|P25789|PSA4_HUMAN
15 Dec 2023 01:53:45,058 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:45,059 INFO : Inserting sp|P25815|S100P_HUMAN
15 Dec 2023 01:53:45,103 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:45,103 INFO : Inserting sp|P26022|PTX3_HUMAN
15 Dec 2023 01:53:45,169 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:45,170 INFO : Inserting sp|P26038|MOES_HUMAN
15 Dec 2023 01:53:45,946 INFO : 61% Done
15 Dec 2023 01:53:46,025 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:53:46,025 INFO : Inserting sp|P26447|S10A4_HUMAN
15 Dec 2023 01:53:46,128 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:46,128 INFO : Inserting sp|P26572|MGAT1_HUMAN
15 Dec 2023 01:53:46,184 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:46,184 INFO : Inserting sp|P26583|HMGB2_HUMAN
15 Dec 2023 01:53:46,358 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:46,358 INFO : Inserting sp|P26599|PTBP1_HUMAN
15 Dec 2023 01:53:46,415 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:46,415 INFO : Inserting sp|P26641|EF1G_HUMAN
15 Dec 2023 01:53:46,482 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:46,482 INFO : Inserting sp|P26885|FKBP2_HUMAN
15 Dec 2023 01:53:46,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:46,510 INFO : Inserting sp|P26927|HGFL_HUMAN
15 Dec 2023 01:53:47,352 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:53:47,353 INFO : Inserting sp|P26951|IL3RA_HUMAN
15 Dec 2023 01:53:47,370 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:47,370 INFO : Inserting sp|P26992|CNTFR_HUMAN
15 Dec 2023 01:53:47,387 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:47,387 INFO : Inserting sp|P27105|STOM_HUMAN
15 Dec 2023 01:53:47,660 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:47,660 INFO : Inserting sp|P27169|PON1_HUMAN
15 Dec 2023 01:53:48,214 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:48,214 INFO : Inserting sp|P27348|1433T_HUMAN
15 Dec 2023 01:53:48,472 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:53:48,472 INFO : Inserting sp|P27487|DPP4_HUMAN
15 Dec 2023 01:53:48,730 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:53:48,730 INFO : Inserting sp|P27695|APEX1_HUMAN
15 Dec 2023 01:53:48,813 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:48,813 INFO : Inserting sp|P27797|CALR_HUMAN
15 Dec 2023 01:53:48,993 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:53:48,993 INFO : Inserting sp|P27824|CALX_HUMAN
15 Dec 2023 01:53:49,062 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:49,063 INFO : Inserting sp|P27918|PROP_HUMAN
15 Dec 2023 01:53:49,449 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:53:49,449 INFO : Inserting sp|P28062|PSB8_HUMAN
15 Dec 2023 01:53:49,568 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:49,568 INFO : Inserting sp|P28065|PSB9_HUMAN
15 Dec 2023 01:53:49,582 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:49,582 INFO : Inserting sp|P28066|PSA5_HUMAN
15 Dec 2023 01:53:49,710 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:49,710 INFO : Inserting sp|P28070|PSB4_HUMAN
15 Dec 2023 01:53:49,822 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:49,822 INFO : Inserting sp|P28072|PSB6_HUMAN
15 Dec 2023 01:53:49,840 INFO : 62% Done
15 Dec 2023 01:53:49,854 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:49,854 INFO : Inserting sp|P28074|PSB5_HUMAN
15 Dec 2023 01:53:49,949 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:49,950 INFO : Inserting sp|P28289|TMOD1_HUMAN
15 Dec 2023 01:53:50,093 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:50,093 INFO : Inserting sp|P28300|LYOX_HUMAN
15 Dec 2023 01:53:50,115 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:50,115 INFO : Inserting sp|P28676|GRAN_HUMAN
15 Dec 2023 01:53:50,243 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:50,243 INFO : Inserting sp|P28799|GRN_HUMAN
15 Dec 2023 01:53:50,297 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:50,297 INFO : Inserting sp|P28827|PTPRM_HUMAN
15 Dec 2023 01:53:50,349 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:50,349 INFO : Inserting sp|P28838|AMPL_HUMAN
15 Dec 2023 01:53:50,571 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:50,571 INFO : Inserting sp|P29144|TPP2_HUMAN
15 Dec 2023 01:53:50,712 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:50,712 INFO : Inserting sp|P29279|CCN2_HUMAN
15 Dec 2023 01:53:50,726 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:50,726 INFO : Inserting sp|P29350|PTN6_HUMAN
15 Dec 2023 01:53:50,952 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:50,952 INFO : Inserting sp|P29400|CO4A5_HUMAN
15 Dec 2023 01:53:50,977 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:50,977 INFO : Inserting sp|P29401|TKT_HUMAN
15 Dec 2023 01:53:51,576 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:53:51,576 INFO : Inserting sp|P29466|CASP1_HUMAN
15 Dec 2023 01:53:51,634 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:51,634 INFO : Inserting sp|P29622|KAIN_HUMAN
15 Dec 2023 01:53:52,586 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:53:52,586 INFO : Inserting sp|P29692|EF1D_HUMAN
15 Dec 2023 01:53:52,629 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:52,629 INFO : Inserting sp|P29972|AQP1_HUMAN
15 Dec 2023 01:53:52,652 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:52,652 INFO : Inserting sp|P30040|ERP29_HUMAN
15 Dec 2023 01:53:52,665 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:52,665 INFO : Inserting sp|P30041|PRDX6_HUMAN
15 Dec 2023 01:53:52,979 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:52,979 INFO : Inserting sp|P30043|BLVRB_HUMAN
15 Dec 2023 01:53:53,326 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:53,326 INFO : Inserting sp|P30044|PRDX5_HUMAN
15 Dec 2023 01:53:53,414 INFO : 63% Done
15 Dec 2023 01:53:53,542 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:53,542 INFO : Inserting sp|P30046|DOPD_HUMAN
15 Dec 2023 01:53:53,678 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:53,678 INFO : Inserting sp|P30048|PRDX3_HUMAN
15 Dec 2023 01:53:53,754 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:53,754 INFO : Inserting sp|P30050|RL12_HUMAN
15 Dec 2023 01:53:53,797 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:53,797 INFO : Inserting sp|P30085|KCY_HUMAN
15 Dec 2023 01:53:53,832 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:53,832 INFO : Inserting sp|P30086|PEBP1_HUMAN
15 Dec 2023 01:53:54,168 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:53:54,168 INFO : Inserting sp|P30101|PDIA3_HUMAN
15 Dec 2023 01:53:54,514 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:54,514 INFO : Inserting sp|P30153|2AAA_HUMAN
15 Dec 2023 01:53:54,635 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:54,635 INFO : Inserting sp|P30520|PURA2_HUMAN
15 Dec 2023 01:53:54,805 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:54,805 INFO : Inserting sp|P30530|UFO_HUMAN
15 Dec 2023 01:53:54,971 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:53:54,971 INFO : Inserting sp|P30566|PUR8_HUMAN
15 Dec 2023 01:53:55,108 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:53:55,108 INFO : Inserting sp|P30613|KPYR_HUMAN
15 Dec 2023 01:53:55,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:55,152 INFO : Inserting sp|P30711|GSTT1_HUMAN
15 Dec 2023 01:53:55,199 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:55,200 INFO : Inserting sp|P30740|ILEU_HUMAN
15 Dec 2023 01:53:55,751 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:53:55,751 INFO : Inserting sp|P31025|LCN1_HUMAN
15 Dec 2023 01:53:55,775 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:55,775 INFO : Inserting sp|P31146|COR1A_HUMAN
15 Dec 2023 01:53:56,176 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:56,176 INFO : Inserting sp|P31150|GDIA_HUMAN
15 Dec 2023 01:53:56,542 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:53:56,542 INFO : Inserting sp|P31939|PUR9_HUMAN
15 Dec 2023 01:53:56,923 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:53:56,923 INFO : Inserting sp|P31943|HNRH1_HUMAN
15 Dec 2023 01:53:56,946 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:56,946 INFO : Inserting sp|P31946|1433B_HUMAN
15 Dec 2023 01:53:57,120 INFO : 64% Done
15 Dec 2023 01:53:57,261 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:53:57,261 INFO : Inserting sp|P31947|1433S_HUMAN
15 Dec 2023 01:53:57,368 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:57,368 INFO : Inserting sp|P31948|STIP1_HUMAN
15 Dec 2023 01:53:57,620 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:57,620 INFO : Inserting sp|P31949|S10AB_HUMAN
15 Dec 2023 01:53:57,642 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:57,642 INFO : Inserting sp|P31995|FCG2C_HUMAN
15 Dec 2023 01:53:57,656 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:57,656 INFO : Inserting sp|P31997|CEAM8_HUMAN
15 Dec 2023 01:53:57,684 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:57,684 INFO : Inserting sp|P32004|L1CAM_HUMAN
15 Dec 2023 01:53:57,729 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:57,730 INFO : Inserting sp|P32119|PRDX2_HUMAN
15 Dec 2023 01:53:58,059 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:58,060 INFO : Inserting sp|P32320|CDD_HUMAN
15 Dec 2023 01:53:58,139 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:53:58,139 INFO : Inserting sp|P32455|GBP1_HUMAN
15 Dec 2023 01:53:58,413 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:53:58,413 INFO : Inserting sp|P32456|GBP2_HUMAN
15 Dec 2023 01:53:58,485 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:53:58,485 INFO : Inserting sp|P32942|ICAM3_HUMAN
15 Dec 2023 01:53:58,540 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:58,540 INFO : Inserting sp|P33121|ACSL1_HUMAN
15 Dec 2023 01:53:58,576 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:53:58,576 INFO : Inserting sp|P33151|CADH5_HUMAN
15 Dec 2023 01:53:58,673 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:58,673 INFO : Inserting sp|P33241|LSP1_HUMAN
15 Dec 2023 01:53:58,690 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:58,691 INFO : Inserting sp|P33763|S10A5_HUMAN
15 Dec 2023 01:53:58,695 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:53:58,695 INFO : Inserting sp|P33778|H2B1B_HUMAN
15 Dec 2023 01:53:58,818 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:53:58,818 INFO : Inserting sp|P33908|MA1A1_HUMAN
15 Dec 2023 01:53:59,276 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:53:59,276 INFO : Inserting sp|P34096|RNAS4_HUMAN
15 Dec 2023 01:53:59,378 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:53:59,378 INFO : Inserting sp|P34931|HS71L_HUMAN
15 Dec 2023 01:53:59,645 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:53:59,645 INFO : Inserting sp|P34932|HSP74_HUMAN
15 Dec 2023 01:54:00,032 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:54:00,032 INFO : Inserting sp|P35030|TRY3_HUMAN
15 Dec 2023 01:54:00,083 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:00,083 INFO : Inserting sp|P35052|GPC1_HUMAN
15 Dec 2023 01:54:00,110 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:00,110 INFO : Inserting sp|P35237|SPB6_HUMAN
15 Dec 2023 01:54:00,238 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:00,238 INFO : Inserting sp|P35241|RADI_HUMAN
15 Dec 2023 01:54:00,553 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:00,553 INFO : Inserting sp|P35442|TSP2_HUMAN
15 Dec 2023 01:54:00,760 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:00,760 INFO : Inserting sp|P35443|TSP4_HUMAN
15 Dec 2023 01:54:01,130 INFO : 65% Done
15 Dec 2023 01:54:01,224 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:01,224 INFO : Inserting sp|P35527|K1C9_HUMAN
15 Dec 2023 01:54:02,025 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:54:02,025 INFO : Imported 800 peptide groups.
15 Dec 2023 01:54:02,025 INFO : Inserting sp|P35555|FBN1_HUMAN
15 Dec 2023 01:54:02,559 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:54:02,559 INFO : Inserting sp|P35579|MYH9_HUMAN
15 Dec 2023 01:54:03,545 DEBUG: Inserted 50 peptides
15 Dec 2023 01:54:04,691 INFO : 66% Done
15 Dec 2023 01:54:04,821 DEBUG: Inserted 100 peptides
15 Dec 2023 01:54:05,275 DEBUG: Total peptides inserted: 117
15 Dec 2023 01:54:05,275 INFO : Inserting sp|P35580|MYH10_HUMAN
15 Dec 2023 01:54:05,752 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:54:05,752 INFO : Inserting sp|P35590|TIE1_HUMAN
15 Dec 2023 01:54:05,776 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:05,776 INFO : Inserting sp|P35611|ADDA_HUMAN
15 Dec 2023 01:54:05,975 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:05,976 INFO : Inserting sp|P35612|ADDB_HUMAN
15 Dec 2023 01:54:06,387 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:54:06,387 INFO : Inserting sp|P35613|BASI_HUMAN
15 Dec 2023 01:54:06,426 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:06,426 INFO : Inserting sp|P35626|ARBK2_HUMAN
15 Dec 2023 01:54:06,457 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:06,457 INFO : Inserting sp|P35637|FUS_HUMAN
15 Dec 2023 01:54:06,484 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:06,485 INFO : Inserting sp|P35754|GLRX1_HUMAN
15 Dec 2023 01:54:06,599 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:06,599 INFO : Inserting sp|P35858|ALS_HUMAN
15 Dec 2023 01:54:07,629 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:54:07,629 INFO : Inserting sp|P35908|K22E_HUMAN
15 Dec 2023 01:54:08,366 DEBUG: Total peptides inserted: 41
15 Dec 2023 01:54:08,366 INFO : Inserting sp|P35916|VGFR3_HUMAN
15 Dec 2023 01:54:08,506 INFO : 67% Done
15 Dec 2023 01:54:08,548 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:08,548 INFO : Inserting sp|P36222|CH3L1_HUMAN
15 Dec 2023 01:54:08,897 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:08,897 INFO : Inserting sp|P36871|PGM1_HUMAN
15 Dec 2023 01:54:09,065 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:09,065 INFO : Inserting sp|P36955|PEDF_HUMAN
15 Dec 2023 01:54:09,572 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:54:09,572 INFO : Inserting sp|P36959|GMPR1_HUMAN
15 Dec 2023 01:54:09,588 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:09,588 INFO : Inserting sp|P36980|FHR2_HUMAN
15 Dec 2023 01:54:09,810 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:09,810 INFO : Inserting sp|P37802|TAGL2_HUMAN
15 Dec 2023 01:54:10,020 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:10,020 INFO : Inserting sp|P37837|TALDO_HUMAN
15 Dec 2023 01:54:10,457 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:54:10,457 INFO : Inserting sp|P37840|SYUA_HUMAN
15 Dec 2023 01:54:10,494 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:10,494 INFO : Inserting sp|P38159|RBMX_HUMAN
15 Dec 2023 01:54:10,518 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:10,518 INFO : Inserting sp|P38606|VATA_HUMAN
15 Dec 2023 01:54:10,625 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:10,626 INFO : Inserting sp|P38646|GRP75_HUMAN
15 Dec 2023 01:54:10,663 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:10,663 INFO : Inserting sp|P39060|COIA1_HUMAN
15 Dec 2023 01:54:10,823 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:10,823 INFO : Inserting sp|P39687|AN32A_HUMAN
15 Dec 2023 01:54:10,895 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:10,895 INFO : Inserting sp|P40121|CAPG_HUMAN
15 Dec 2023 01:54:11,042 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:11,042 INFO : Inserting sp|P40189|IL6RB_HUMAN
15 Dec 2023 01:54:11,206 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:11,206 INFO : Inserting sp|P40197|GPV_HUMAN
15 Dec 2023 01:54:11,316 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:11,317 INFO : Inserting sp|P40227|TCPZ_HUMAN
15 Dec 2023 01:54:11,388 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:11,388 INFO : Inserting sp|P40306|PSB10_HUMAN
15 Dec 2023 01:54:11,415 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:11,415 INFO : Inserting sp|P40763|STAT3_HUMAN
15 Dec 2023 01:54:11,452 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:11,453 INFO : Inserting sp|P40925|MDHC_HUMAN
15 Dec 2023 01:54:11,674 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:11,675 INFO : Inserting sp|P40926|MDHM_HUMAN
15 Dec 2023 01:54:11,811 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:11,811 INFO : Inserting sp|P41218|MNDA_HUMAN
15 Dec 2023 01:54:11,996 INFO : 68% Done
15 Dec 2023 01:54:12,194 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:54:12,194 INFO : Inserting sp|P41219|PERI_HUMAN
15 Dec 2023 01:54:12,267 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:12,267 INFO : Inserting sp|P41222|PTGDS_HUMAN
15 Dec 2023 01:54:12,520 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:12,520 INFO : Inserting sp|P41271|NBL1_HUMAN
15 Dec 2023 01:54:12,561 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:12,561 INFO : Inserting sp|P42126|ECI1_HUMAN
15 Dec 2023 01:54:12,578 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:12,579 INFO : Inserting sp|P42224|STAT1_HUMAN
15 Dec 2023 01:54:12,718 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:12,719 INFO : Inserting sp|P42330|AK1C3_HUMAN
15 Dec 2023 01:54:12,735 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:12,735 INFO : Inserting sp|P42765|THIM_HUMAN
15 Dec 2023 01:54:12,786 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:12,786 INFO : Inserting sp|P42768|WASP_HUMAN
15 Dec 2023 01:54:12,836 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:12,836 INFO : Inserting sp|P42785|PCP_HUMAN
15 Dec 2023 01:54:12,915 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:12,915 INFO : Inserting sp|P43034|LIS1_HUMAN
15 Dec 2023 01:54:13,014 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:13,015 INFO : Inserting sp|P43121|MUC18_HUMAN
15 Dec 2023 01:54:13,370 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:13,370 INFO : Inserting sp|P43251|BTD_HUMAN
15 Dec 2023 01:54:13,800 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:54:13,800 INFO : Inserting sp|P43487|RANG_HUMAN
15 Dec 2023 01:54:13,864 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:13,864 INFO : Inserting sp|P43490|NAMPT_HUMAN
15 Dec 2023 01:54:14,281 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:54:14,281 INFO : Inserting sp|P43652|AFAM_HUMAN
15 Dec 2023 01:54:15,328 DEBUG: Total peptides inserted: 48
15 Dec 2023 01:54:15,329 INFO : Inserting sp|P45877|PPIC_HUMAN
15 Dec 2023 01:54:15,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:15,349 INFO : Inserting sp|P45880|VDAC2_HUMAN
15 Dec 2023 01:54:15,371 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:15,371 INFO : Inserting sp|P45974|UBP5_HUMAN
15 Dec 2023 01:54:15,393 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:15,393 INFO : Inserting sp|P46100|ATRX_HUMAN
15 Dec 2023 01:54:15,406 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:15,406 INFO : Inserting sp|P46781|RS9_HUMAN
15 Dec 2023 01:54:15,430 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:15,430 INFO : Inserting sp|P46926|GNPI1_HUMAN
15 Dec 2023 01:54:15,516 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:15,516 INFO : Inserting sp|P46940|IQGA1_HUMAN
15 Dec 2023 01:54:15,736 INFO : 69% Done
15 Dec 2023 01:54:16,045 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:54:16,045 INFO : Inserting sp|P46976|GLYG_HUMAN
15 Dec 2023 01:54:16,079 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:16,079 INFO : Inserting sp|P47756|CAPZB_HUMAN
15 Dec 2023 01:54:16,261 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:16,261 INFO : Inserting sp|P48047|ATPO_HUMAN
15 Dec 2023 01:54:16,295 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:16,295 INFO : Inserting sp|P48147|PPCE_HUMAN
15 Dec 2023 01:54:16,369 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:16,369 INFO : Inserting sp|P48426|PI42A_HUMAN
15 Dec 2023 01:54:16,454 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:16,454 INFO : Inserting sp|P48506|GSH1_HUMAN
15 Dec 2023 01:54:16,795 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:16,795 INFO : Inserting sp|P48507|GSH0_HUMAN
15 Dec 2023 01:54:16,903 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:16,903 INFO : Inserting sp|P48595|SPB10_HUMAN
15 Dec 2023 01:54:17,021 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:17,021 INFO : Inserting sp|P48637|GSHB_HUMAN
15 Dec 2023 01:54:17,160 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:17,160 INFO : Inserting sp|P48643|TCPE_HUMAN
15 Dec 2023 01:54:17,195 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:17,195 INFO : Inserting sp|P48668|K2C6C_HUMAN
15 Dec 2023 01:54:17,624 DEBUG: Total peptides inserted: 26
15 Dec 2023 01:54:17,625 INFO : Inserting sp|P48723|HSP13_HUMAN
15 Dec 2023 01:54:17,664 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:17,664 INFO : Inserting sp|P48729|KC1A_HUMAN
15 Dec 2023 01:54:17,689 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:17,689 INFO : Inserting sp|P48735|IDHP_HUMAN
15 Dec 2023 01:54:17,853 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:17,853 INFO : Inserting sp|P48740|MASP1_HUMAN
15 Dec 2023 01:54:18,387 DEBUG: Total peptides inserted: 28
15 Dec 2023 01:54:18,387 INFO : Inserting sp|P48745|CCN3_HUMAN
15 Dec 2023 01:54:18,424 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:18,424 INFO : Inserting sp|P48960|AGRE5_HUMAN
15 Dec 2023 01:54:18,488 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:18,488 INFO : Inserting sp|P49116|NR2C2_HUMAN
15 Dec 2023 01:54:18,501 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:18,501 INFO : Inserting sp|P49189|AL9A1_HUMAN
15 Dec 2023 01:54:18,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:18,524 INFO : Inserting sp|P49247|RPIA_HUMAN
15 Dec 2023 01:54:18,636 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:18,636 INFO : Inserting sp|P49327|FAS_HUMAN
15 Dec 2023 01:54:18,692 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:18,692 INFO : Inserting sp|P49368|TCPG_HUMAN
15 Dec 2023 01:54:18,806 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:18,806 INFO : Inserting sp|P49441|INPP_HUMAN
15 Dec 2023 01:54:18,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:18,831 INFO : Inserting sp|P49641|MA2A2_HUMAN
15 Dec 2023 01:54:18,931 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:18,931 INFO : Inserting sp|P49720|PSB3_HUMAN
15 Dec 2023 01:54:19,095 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:19,095 INFO : Inserting sp|P49721|PSB2_HUMAN
15 Dec 2023 01:54:19,233 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:19,234 INFO : Inserting sp|P49746|TSP3_HUMAN
15 Dec 2023 01:54:19,241 INFO : 70% Done
15 Dec 2023 01:54:19,287 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:19,287 INFO : Inserting sp|P49747|COMP_HUMAN
15 Dec 2023 01:54:19,803 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:54:19,803 INFO : Inserting sp|P49755|TMEDA_HUMAN
15 Dec 2023 01:54:19,826 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:19,826 INFO : Inserting sp|P49908|SEPP1_HUMAN
15 Dec 2023 01:54:20,057 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:20,057 INFO : Inserting sp|P49913|CAMP_HUMAN
15 Dec 2023 01:54:20,129 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:20,129 INFO : Inserting sp|P50395|GDIB_HUMAN
15 Dec 2023 01:54:20,739 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:54:20,739 INFO : Inserting sp|P50416|CPT1A_HUMAN
15 Dec 2023 01:54:20,796 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:20,796 INFO : Inserting sp|P50452|SPB8_HUMAN
15 Dec 2023 01:54:20,893 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:20,893 INFO : Inserting sp|P50453|SPB9_HUMAN
15 Dec 2023 01:54:21,104 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:21,104 INFO : Inserting sp|P50502|F10A1_HUMAN
15 Dec 2023 01:54:21,199 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:21,199 INFO : Inserting sp|P50552|VASP_HUMAN
15 Dec 2023 01:54:21,439 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:21,439 INFO : Inserting sp|P50747|BPL1_HUMAN
15 Dec 2023 01:54:21,459 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:21,459 INFO : Inserting sp|P50750|CDK9_HUMAN
15 Dec 2023 01:54:21,486 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:21,486 INFO : Inserting sp|P50895|BCAM_HUMAN
15 Dec 2023 01:54:21,511 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:21,511 INFO : Inserting sp|P50990|TCPQ_HUMAN
15 Dec 2023 01:54:21,798 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:21,798 INFO : Inserting sp|P50991|TCPD_HUMAN
15 Dec 2023 01:54:22,116 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:22,116 INFO : Inserting sp|P50995|ANX11_HUMAN
15 Dec 2023 01:54:22,265 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:22,265 INFO : Imported 900 peptide groups.
15 Dec 2023 01:54:22,265 INFO : Inserting sp|P51148|RAB5C_HUMAN
15 Dec 2023 01:54:22,291 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:22,291 INFO : Inserting sp|P51149|RAB7A_HUMAN
15 Dec 2023 01:54:22,416 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:22,416 INFO : Inserting sp|P51159|RB27A_HUMAN
15 Dec 2023 01:54:22,460 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:22,460 INFO : Inserting sp|P51512|MMP16_HUMAN
15 Dec 2023 01:54:22,475 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:22,475 INFO : Inserting sp|P51654|GPC3_HUMAN
15 Dec 2023 01:54:22,518 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:22,518 INFO : Inserting sp|P51665|PSMD7_HUMAN
15 Dec 2023 01:54:22,582 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:22,582 INFO : Inserting sp|P51668|UB2D1_HUMAN
15 Dec 2023 01:54:22,605 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:22,605 INFO : Inserting sp|P51674|GPM6A_HUMAN
15 Dec 2023 01:54:22,628 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:22,628 INFO : Inserting sp|P51693|APLP1_HUMAN
15 Dec 2023 01:54:22,896 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:22,896 INFO : Inserting sp|P51858|HDGF_HUMAN
15 Dec 2023 01:54:22,956 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:22,956 INFO : Inserting sp|P51884|LUM_HUMAN
15 Dec 2023 01:54:23,224 INFO : 71% Done
15 Dec 2023 01:54:23,312 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:54:23,312 INFO : Inserting sp|P51991|ROA3_HUMAN
15 Dec 2023 01:54:23,374 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:23,374 INFO : Inserting sp|P52179|MYOM1_HUMAN
15 Dec 2023 01:54:23,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:23,397 INFO : Inserting sp|P52209|6PGD_HUMAN
15 Dec 2023 01:54:23,856 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:54:23,856 INFO : Inserting sp|P52565|GDIR1_HUMAN
15 Dec 2023 01:54:23,938 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:23,938 INFO : Inserting sp|P52566|GDIR2_HUMAN
15 Dec 2023 01:54:24,236 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:24,236 INFO : Inserting sp|P52597|HNRPF_HUMAN
15 Dec 2023 01:54:24,286 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:24,286 INFO : Inserting sp|P52790|HXK3_HUMAN
15 Dec 2023 01:54:24,518 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:24,518 INFO : Inserting sp|P52823|STC1_HUMAN
15 Dec 2023 01:54:24,540 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:24,540 INFO : Inserting sp|P52907|CAZA1_HUMAN
15 Dec 2023 01:54:24,719 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:24,719 INFO : Inserting sp|P53004|BIEA_HUMAN
15 Dec 2023 01:54:24,990 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:24,990 INFO : Inserting sp|P53396|ACLY_HUMAN
15 Dec 2023 01:54:25,292 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:25,292 INFO : Inserting sp|P53621|COPA_HUMAN
15 Dec 2023 01:54:25,307 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:25,307 INFO : Inserting sp|P53634|CATC_HUMAN
15 Dec 2023 01:54:25,468 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:25,468 INFO : Inserting sp|P53675|CLH2_HUMAN
15 Dec 2023 01:54:25,689 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:25,689 INFO : Inserting sp|P53804|TTC3_HUMAN
15 Dec 2023 01:54:25,704 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:25,704 INFO : Inserting sp|P54108|CRIS3_HUMAN
15 Dec 2023 01:54:25,887 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:25,887 INFO : Inserting sp|P54289|CA2D1_HUMAN
15 Dec 2023 01:54:26,230 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:26,230 INFO : Inserting sp|P54578|UBP14_HUMAN
15 Dec 2023 01:54:26,423 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:26,423 INFO : Inserting sp|P54652|HSP72_HUMAN
15 Dec 2023 01:54:26,735 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:26,735 INFO : Inserting sp|P54709|AT1B3_HUMAN
15 Dec 2023 01:54:26,758 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:26,758 INFO : Inserting sp|P54725|RD23A_HUMAN
15 Dec 2023 01:54:26,825 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:26,825 INFO : Inserting sp|P54727|RD23B_HUMAN
15 Dec 2023 01:54:26,839 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:26,839 INFO : Inserting sp|P54764|EPHA4_HUMAN
15 Dec 2023 01:54:26,943 INFO : 72% Done
15 Dec 2023 01:54:27,000 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:27,000 INFO : Inserting sp|P54802|ANAG_HUMAN
15 Dec 2023 01:54:27,115 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:27,115 INFO : Inserting sp|P54819|KAD2_HUMAN
15 Dec 2023 01:54:27,175 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:27,175 INFO : Inserting sp|P54920|SNAA_HUMAN
15 Dec 2023 01:54:27,228 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:27,229 INFO : Inserting sp|P55008|AIF1_HUMAN
15 Dec 2023 01:54:27,253 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:27,253 INFO : Inserting sp|P55056|APOC4_HUMAN
15 Dec 2023 01:54:27,457 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:27,457 INFO : Inserting sp|P55058|PLTP_HUMAN
15 Dec 2023 01:54:27,966 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:54:27,966 INFO : Inserting sp|P55072|TERA_HUMAN
15 Dec 2023 01:54:28,588 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:54:28,588 INFO : Inserting sp|P55083|MFAP4_HUMAN
15 Dec 2023 01:54:28,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:28,620 INFO : Inserting sp|P55209|NP1L1_HUMAN
15 Dec 2023 01:54:28,665 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:28,665 INFO : Inserting sp|P55212|CASP6_HUMAN
15 Dec 2023 01:54:28,699 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:28,699 INFO : Inserting sp|P55263|ADK_HUMAN
15 Dec 2023 01:54:28,754 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:28,754 INFO : Inserting sp|P55268|LAMB2_HUMAN
15 Dec 2023 01:54:28,800 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:28,800 INFO : Inserting sp|P55283|CADH4_HUMAN
15 Dec 2023 01:54:28,822 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:28,822 INFO : Inserting sp|P55287|CAD11_HUMAN
15 Dec 2023 01:54:28,852 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:28,853 INFO : Inserting sp|P55290|CAD13_HUMAN
15 Dec 2023 01:54:28,988 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:28,988 INFO : Inserting sp|P55786|PSA_HUMAN
15 Dec 2023 01:54:29,130 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:29,130 INFO : Inserting sp|P55795|HNRH2_HUMAN
15 Dec 2023 01:54:29,153 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:29,153 INFO : Inserting sp|P55854|SUMO3_HUMAN
15 Dec 2023 01:54:29,166 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,166 INFO : Inserting sp|P55884|EIF3B_HUMAN
15 Dec 2023 01:54:29,186 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,186 INFO : Inserting sp|P57053|H2BFS_HUMAN
15 Dec 2023 01:54:29,295 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:29,295 INFO : Inserting sp|P57059|SIK1_HUMAN
15 Dec 2023 01:54:29,322 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,322 INFO : Inserting sp|P57081|WDR4_HUMAN
15 Dec 2023 01:54:29,343 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,343 INFO : Inserting sp|P57087|JAM2_HUMAN
15 Dec 2023 01:54:29,356 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,356 INFO : Inserting sp|P57737|CORO7_HUMAN
15 Dec 2023 01:54:29,394 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:29,394 INFO : Inserting sp|P58546|MTPN_HUMAN
15 Dec 2023 01:54:29,587 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:29,587 INFO : Inserting sp|P58876|H2B1D_HUMAN
15 Dec 2023 01:54:29,693 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:29,693 INFO : Inserting sp|P59665|DEF1_HUMAN
15 Dec 2023 01:54:29,770 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:29,770 INFO : Inserting sp|P59666|DEF3_HUMAN
15 Dec 2023 01:54:29,845 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:29,845 INFO : Inserting sp|P59998|ARPC4_HUMAN
15 Dec 2023 01:54:29,947 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:29,947 INFO : Inserting sp|P60033|CD81_HUMAN
15 Dec 2023 01:54:29,985 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:29,985 INFO : Inserting sp|P60174|TPIS_HUMAN
15 Dec 2023 01:54:30,330 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:54:30,330 INFO : Inserting sp|P60201|MYPR_HUMAN
15 Dec 2023 01:54:30,347 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:30,347 INFO : Inserting sp|P60660|MYL6_HUMAN
15 Dec 2023 01:54:30,500 INFO : 73% Done
15 Dec 2023 01:54:30,518 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:30,518 INFO : Inserting sp|P60709|ACTB_HUMAN
15 Dec 2023 01:54:31,094 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:54:31,094 INFO : Inserting sp|P60842|IF4A1_HUMAN
15 Dec 2023 01:54:31,217 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:31,217 INFO : Inserting sp|P60891|PRPS1_HUMAN
15 Dec 2023 01:54:31,302 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:31,302 INFO : Inserting sp|P60900|PSA6_HUMAN
15 Dec 2023 01:54:31,487 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:31,487 INFO : Inserting sp|P60953|CDC42_HUMAN
15 Dec 2023 01:54:31,548 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:31,548 INFO : Inserting sp|P61019|RAB2A_HUMAN
15 Dec 2023 01:54:31,592 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:31,592 INFO : Inserting sp|P61026|RAB10_HUMAN
15 Dec 2023 01:54:31,660 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:31,660 INFO : Inserting sp|P61077|UB2D3_HUMAN
15 Dec 2023 01:54:31,684 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:31,684 INFO : Inserting sp|P61088|UBE2N_HUMAN
15 Dec 2023 01:54:31,750 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:31,750 INFO : Inserting sp|P61158|ARP3_HUMAN
15 Dec 2023 01:54:32,059 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:32,059 INFO : Inserting sp|P61160|ARP2_HUMAN
15 Dec 2023 01:54:32,273 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:32,273 INFO : Inserting sp|P61201|CSN2_HUMAN
15 Dec 2023 01:54:32,324 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:32,324 INFO : Inserting sp|P61204|ARF3_HUMAN
15 Dec 2023 01:54:32,371 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:32,372 INFO : Inserting sp|P61224|RAP1B_HUMAN
15 Dec 2023 01:54:32,432 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:32,433 INFO : Inserting sp|P61225|RAP2B_HUMAN
15 Dec 2023 01:54:32,503 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:32,504 INFO : Inserting sp|P61326|MGN_HUMAN
15 Dec 2023 01:54:32,529 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:32,529 INFO : Inserting sp|P61513|RL37A_HUMAN
15 Dec 2023 01:54:32,546 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:32,546 INFO : Inserting sp|P61586|RHOA_HUMAN
15 Dec 2023 01:54:32,636 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:32,636 INFO : Inserting sp|P61604|CH10_HUMAN
15 Dec 2023 01:54:32,690 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:32,690 INFO : Inserting sp|P61626|LYSC_HUMAN
15 Dec 2023 01:54:32,925 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:32,925 INFO : Inserting sp|P61764|STXB1_HUMAN
15 Dec 2023 01:54:32,954 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:32,954 INFO : Inserting sp|P61769|B2MG_HUMAN
15 Dec 2023 01:54:33,094 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:33,094 INFO : Inserting sp|P61916|NPC2_HUMAN
15 Dec 2023 01:54:33,189 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:33,189 INFO : Inserting sp|P61956|SUMO2_HUMAN
15 Dec 2023 01:54:33,206 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:33,206 INFO : Inserting sp|P61970|NTF2_HUMAN
15 Dec 2023 01:54:33,375 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:33,376 INFO : Inserting sp|P61978|HNRPK_HUMAN
15 Dec 2023 01:54:33,414 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:33,414 INFO : Inserting sp|P61981|1433G_HUMAN
15 Dec 2023 01:54:33,647 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:33,647 INFO : Inserting sp|P62136|PP1A_HUMAN
15 Dec 2023 01:54:33,746 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:33,746 INFO : Inserting sp|P62191|PRS4_HUMAN
15 Dec 2023 01:54:33,858 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:33,858 INFO : Inserting sp|P62258|1433E_HUMAN
15 Dec 2023 01:54:34,311 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:54:34,311 INFO : Inserting sp|P62310|LSM3_HUMAN
15 Dec 2023 01:54:34,338 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,338 INFO : Inserting sp|P62316|SMD2_HUMAN
15 Dec 2023 01:54:34,372 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,372 INFO : Inserting sp|P62318|SMD3_HUMAN
15 Dec 2023 01:54:34,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,397 INFO : Imported 1000 peptide groups.
15 Dec 2023 01:54:34,397 INFO : Inserting sp|P62328|TYB4_HUMAN
15 Dec 2023 01:54:34,446 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,446 INFO : Inserting sp|P62333|PRS10_HUMAN
15 Dec 2023 01:54:34,454 INFO : 74% Done
15 Dec 2023 01:54:34,464 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,464 INFO : Inserting sp|P62714|PP2AB_HUMAN
15 Dec 2023 01:54:34,478 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:34,478 INFO : Inserting sp|P62736|ACTA_HUMAN
15 Dec 2023 01:54:34,833 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:54:34,833 INFO : Inserting sp|P62805|H4_HUMAN
15 Dec 2023 01:54:35,094 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:35,094 INFO : Inserting sp|P62807|H2B1C_HUMAN
15 Dec 2023 01:54:35,203 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:35,203 INFO : Inserting sp|P62820|RAB1A_HUMAN
15 Dec 2023 01:54:35,292 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:35,292 INFO : Inserting sp|P62826|RAN_HUMAN
15 Dec 2023 01:54:35,444 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:35,444 INFO : Inserting sp|P62837|UB2D2_HUMAN
15 Dec 2023 01:54:35,468 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:35,468 INFO : Inserting sp|P62873|GBB1_HUMAN
15 Dec 2023 01:54:35,537 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:35,537 INFO : Inserting sp|P62888|RL30_HUMAN
15 Dec 2023 01:54:35,557 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:35,557 INFO : Inserting sp|P62937|PPIA_HUMAN
15 Dec 2023 01:54:35,815 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:35,815 INFO : Inserting sp|P62942|FKB1A_HUMAN
15 Dec 2023 01:54:35,868 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:35,868 INFO : Inserting sp|P62979|RS27A_HUMAN
15 Dec 2023 01:54:35,982 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:35,983 INFO : Inserting sp|P62987|RL40_HUMAN
15 Dec 2023 01:54:36,097 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:36,097 INFO : Inserting sp|P62993|GRB2_HUMAN
15 Dec 2023 01:54:36,196 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:36,196 INFO : Inserting sp|P63000|RAC1_HUMAN
15 Dec 2023 01:54:36,239 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:36,239 INFO : Inserting sp|P63010|AP2B1_HUMAN
15 Dec 2023 01:54:36,301 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:36,301 INFO : Inserting sp|P63092|GNAS2_HUMAN
15 Dec 2023 01:54:36,348 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:36,348 INFO : Inserting sp|P63104|1433Z_HUMAN
15 Dec 2023 01:54:36,724 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:54:36,724 INFO : Inserting sp|P63208|SKP1_HUMAN
15 Dec 2023 01:54:36,755 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:36,755 INFO : Inserting sp|P63241|IF5A1_HUMAN
15 Dec 2023 01:54:36,889 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:36,889 INFO : Inserting sp|P63244|RACK1_HUMAN
15 Dec 2023 01:54:36,965 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:36,965 INFO : Inserting sp|P63279|UBC9_HUMAN
15 Dec 2023 01:54:36,996 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:36,996 INFO : Inserting sp|P67775|PP2AA_HUMAN
15 Dec 2023 01:54:37,010 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:37,010 INFO : Inserting sp|P67809|YBOX1_HUMAN
15 Dec 2023 01:54:37,023 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:37,023 INFO : Inserting sp|P67936|TPM4_HUMAN
15 Dec 2023 01:54:37,248 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:37,248 INFO : Inserting sp|P68032|ACTC_HUMAN
15 Dec 2023 01:54:37,610 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:54:37,610 INFO : Inserting sp|P68036|UB2L3_HUMAN
15 Dec 2023 01:54:37,648 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:37,648 INFO : Inserting sp|P68104|EF1A1_HUMAN
15 Dec 2023 01:54:37,750 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:37,750 INFO : Inserting sp|P68133|ACTS_HUMAN
15 Dec 2023 01:54:38,112 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:54:38,113 INFO : Inserting sp|P68363|TBA1B_HUMAN
15 Dec 2023 01:54:38,413 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:54:38,413 INFO : Inserting sp|P68366|TBA4A_HUMAN
15 Dec 2023 01:54:38,697 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:38,697 INFO : Inserting sp|P68371|TBB4B_HUMAN
15 Dec 2023 01:54:38,973 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:38,973 INFO : Inserting sp|P68400|CSK21_HUMAN
15 Dec 2023 01:54:39,023 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:39,023 INFO : Inserting sp|P68402|PA1B2_HUMAN
15 Dec 2023 01:54:39,104 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:39,104 INFO : Inserting sp|P68431|H31_HUMAN
15 Dec 2023 01:54:39,163 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:39,164 INFO : Inserting sp|P68871|HBB_HUMAN
15 Dec 2023 01:54:40,103 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:54:40,103 INFO : Inserting sp|P69891|HBG1_HUMAN
15 Dec 2023 01:54:40,546 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:40,546 INFO : Inserting sp|P69892|HBG2_HUMAN
15 Dec 2023 01:54:40,915 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:40,916 INFO : Inserting sp|P69905|HBA_HUMAN
15 Dec 2023 01:54:41,619 DEBUG: Total peptides inserted: 20
15 Dec 2023 01:54:41,619 INFO : Inserting sp|P78324|SHPS1_HUMAN
15 Dec 2023 01:54:41,852 INFO : 75% Done
15 Dec 2023 01:54:41,868 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:41,868 INFO : Inserting sp|P78371|TCPB_HUMAN
15 Dec 2023 01:54:41,998 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:41,998 INFO : Inserting sp|P78380|OLR1_HUMAN
15 Dec 2023 01:54:42,012 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:42,012 INFO : Inserting sp|P78417|GSTO1_HUMAN
15 Dec 2023 01:54:42,344 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:42,344 INFO : Inserting sp|P78559|MAP1A_HUMAN
15 Dec 2023 01:54:42,397 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:42,397 INFO : Inserting sp|P80108|PHLD_HUMAN
15 Dec 2023 01:54:43,212 DEBUG: Total peptides inserted: 37
15 Dec 2023 01:54:43,212 INFO : Inserting sp|P80188|NGAL_HUMAN
15 Dec 2023 01:54:43,562 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:43,562 INFO : Inserting sp|P80297|MT1X_HUMAN
15 Dec 2023 01:54:43,576 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:43,576 INFO : Inserting sp|P80303|NUCB2_HUMAN
15 Dec 2023 01:54:43,605 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:43,605 INFO : Inserting sp|P80511|S10AC_HUMAN
15 Dec 2023 01:54:43,663 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,663 INFO : Inserting sp|P80723|BASP1_HUMAN
15 Dec 2023 01:54:43,691 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,691 INFO : Inserting sp|P81605|DCD_HUMAN
15 Dec 2023 01:54:43,737 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,737 INFO : Inserting sp|P82279|CRUM1_HUMAN
15 Dec 2023 01:54:43,777 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,777 INFO : Inserting sp|P84077|ARF1_HUMAN
15 Dec 2023 01:54:43,817 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,817 INFO : Inserting sp|P84090|ERH_HUMAN
15 Dec 2023 01:54:43,831 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:43,831 INFO : Inserting sp|P84095|RHOG_HUMAN
15 Dec 2023 01:54:43,864 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:43,864 INFO : Inserting sp|P84103|SRSF3_HUMAN
15 Dec 2023 01:54:43,877 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:43,877 INFO : Inserting sp|P84243|H33_HUMAN
15 Dec 2023 01:54:43,929 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:43,929 INFO : Inserting sp|P98066|TSG6_HUMAN
15 Dec 2023 01:54:43,957 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:43,957 INFO : Inserting sp|P98095|FBLN2_HUMAN
15 Dec 2023 01:54:44,118 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:44,119 INFO : Inserting sp|P98160|PGBM_HUMAN
15 Dec 2023 01:54:45,105 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:54:45,105 INFO : Inserting sp|P98161|PKD1_HUMAN
15 Dec 2023 01:54:45,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:45,138 INFO : Inserting sp|Q00013|EM55_HUMAN
15 Dec 2023 01:54:45,250 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:45,250 INFO : Inserting sp|Q00325|MPCP_HUMAN
15 Dec 2023 01:54:45,281 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:45,281 INFO : Inserting sp|Q00610|CLH1_HUMAN
15 Dec 2023 01:54:45,518 INFO : 76% Done
15 Dec 2023 01:54:45,868 DEBUG: Total peptides inserted: 25
15 Dec 2023 01:54:45,868 INFO : Inserting sp|Q00688|FKBP3_HUMAN
15 Dec 2023 01:54:45,898 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:45,898 INFO : Inserting sp|Q00839|HNRPU_HUMAN
15 Dec 2023 01:54:46,002 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:46,002 INFO : Inserting sp|Q01082|SPTB2_HUMAN
15 Dec 2023 01:54:46,383 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:46,383 INFO : Inserting sp|Q01105|SET_HUMAN
15 Dec 2023 01:54:46,401 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:46,401 INFO : Inserting sp|Q01130|SRSF2_HUMAN
15 Dec 2023 01:54:46,420 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:46,420 INFO : Inserting sp|Q01469|FABP5_HUMAN
15 Dec 2023 01:54:46,571 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:46,572 INFO : Inserting sp|Q01484|ANK2_HUMAN
15 Dec 2023 01:54:46,781 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:46,781 INFO : Inserting sp|Q01518|CAP1_HUMAN
15 Dec 2023 01:54:47,296 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:54:47,296 INFO : Inserting sp|Q01546|K22O_HUMAN
15 Dec 2023 01:54:47,488 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:47,488 INFO : Inserting sp|Q01628|IFM3_HUMAN
15 Dec 2023 01:54:47,517 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:47,517 INFO : Inserting sp|Q01629|IFM2_HUMAN
15 Dec 2023 01:54:47,544 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:47,544 INFO : Inserting sp|Q02094|RHAG_HUMAN
15 Dec 2023 01:54:47,568 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:47,568 INFO : Inserting sp|Q02161|RHD_HUMAN
15 Dec 2023 01:54:47,601 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:47,601 INFO : Inserting sp|Q02224|CENPE_HUMAN
15 Dec 2023 01:54:47,628 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:47,628 INFO : Inserting sp|Q02246|CNTN2_HUMAN
15 Dec 2023 01:54:47,977 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:54:47,977 INFO : Inserting sp|Q02487|DSC2_HUMAN
15 Dec 2023 01:54:48,069 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:48,069 INFO : Inserting sp|Q02809|PLOD1_HUMAN
15 Dec 2023 01:54:48,104 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:48,104 INFO : Inserting sp|Q02818|NUCB1_HUMAN
15 Dec 2023 01:54:48,438 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:54:48,438 INFO : Inserting sp|Q02985|FHR3_HUMAN
15 Dec 2023 01:54:48,631 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:48,631 INFO : Inserting sp|Q03001|DYST_HUMAN
15 Dec 2023 01:54:48,644 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:48,645 INFO : Inserting sp|Q03167|TGBR3_HUMAN
15 Dec 2023 01:54:48,691 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:48,691 INFO : Inserting sp|Q03252|LMNB2_HUMAN
15 Dec 2023 01:54:48,730 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:48,730 INFO : Inserting sp|Q03405|UPAR_HUMAN
15 Dec 2023 01:54:48,838 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:48,838 INFO : Inserting sp|Q03591|FHR1_HUMAN
15 Dec 2023 01:54:49,196 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:54:49,196 INFO : Inserting sp|Q04446|GLGB_HUMAN
15 Dec 2023 01:54:49,280 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:49,280 INFO : Inserting sp|Q04695|K1C17_HUMAN
15 Dec 2023 01:54:49,308 INFO : 77% Done
15 Dec 2023 01:54:49,584 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:54:49,584 INFO : Inserting sp|Q04721|NOTC2_HUMAN
15 Dec 2023 01:54:49,598 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:49,598 INFO : Inserting sp|Q04756|HGFA_HUMAN
15 Dec 2023 01:54:50,066 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:54:50,066 INFO : Inserting sp|Q04760|LGUL_HUMAN
15 Dec 2023 01:54:50,167 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:50,167 INFO : Inserting sp|Q04828|AK1C1_HUMAN
15 Dec 2023 01:54:50,182 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:50,182 INFO : Inserting sp|Q04917|1433F_HUMAN
15 Dec 2023 01:54:50,438 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:50,438 INFO : Inserting sp|Q05315|LEG10_HUMAN
15 Dec 2023 01:54:50,503 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:54:50,503 INFO : Inserting sp|Q05682|CALD1_HUMAN
15 Dec 2023 01:54:50,535 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:50,535 INFO : Inserting sp|Q06033|ITIH3_HUMAN
15 Dec 2023 01:54:51,722 DEBUG: Total peptides inserted: 46
15 Dec 2023 01:54:51,722 INFO : Imported 1100 peptide groups.
15 Dec 2023 01:54:51,723 INFO : Inserting sp|Q06210|GFPT1_HUMAN
15 Dec 2023 01:54:51,736 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:51,736 INFO : Inserting sp|Q06323|PSME1_HUMAN
15 Dec 2023 01:54:51,998 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:51,998 INFO : Inserting sp|Q06418|TYRO3_HUMAN
15 Dec 2023 01:54:52,028 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:52,028 INFO : Inserting sp|Q06481|APLP2_HUMAN
15 Dec 2023 01:54:52,222 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:52,223 INFO : Inserting sp|Q06828|FMOD_HUMAN
15 Dec 2023 01:54:52,277 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:52,277 INFO : Inserting sp|Q06830|PRDX1_HUMAN
15 Dec 2023 01:54:52,558 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:52,559 INFO : Inserting sp|Q07954|LRP1_HUMAN
15 Dec 2023 01:54:52,874 INFO : 78% Done
15 Dec 2023 01:54:53,557 DEBUG: Total peptides inserted: 43
15 Dec 2023 01:54:53,557 INFO : Inserting sp|Q07955|SRSF1_HUMAN
15 Dec 2023 01:54:53,573 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:53,573 INFO : Inserting sp|Q08043|ACTN3_HUMAN
15 Dec 2023 01:54:53,860 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:53,860 INFO : Inserting sp|Q08211|DHX9_HUMAN
15 Dec 2023 01:54:53,907 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:53,907 INFO : Inserting sp|Q08380|LG3BP_HUMAN
15 Dec 2023 01:54:54,604 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:54:54,604 INFO : Inserting sp|Q08397|LOXL1_HUMAN
15 Dec 2023 01:54:54,620 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:54,620 INFO : Inserting sp|Q08495|DEMA_HUMAN
15 Dec 2023 01:54:54,785 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:54,785 INFO : Inserting sp|Q08629|TICN1_HUMAN
15 Dec 2023 01:54:54,847 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:54,847 INFO : Inserting sp|Q08830|FGL1_HUMAN
15 Dec 2023 01:54:54,907 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:54,907 INFO : Inserting sp|Q08ET2|SIG14_HUMAN
15 Dec 2023 01:54:54,955 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:54,955 INFO : Inserting sp|Q09028|RBBP4_HUMAN
15 Dec 2023 01:54:55,023 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:55,023 INFO : Inserting sp|Q10471|GALT2_HUMAN
15 Dec 2023 01:54:55,148 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:55,148 INFO : Inserting sp|Q10570|CPSF1_HUMAN
15 Dec 2023 01:54:55,171 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:55,171 INFO : Inserting sp|Q10588|BST1_HUMAN
15 Dec 2023 01:54:55,366 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:54:55,366 INFO : Inserting sp|Q12765|SCRN1_HUMAN
15 Dec 2023 01:54:55,406 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:55,406 INFO : Inserting sp|Q12797|ASPH_HUMAN
15 Dec 2023 01:54:55,430 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:55,430 INFO : Inserting sp|Q12805|FBLN3_HUMAN
15 Dec 2023 01:54:55,853 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:54:55,853 INFO : Inserting sp|Q12841|FSTL1_HUMAN
15 Dec 2023 01:54:56,142 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:56,143 INFO : Inserting sp|Q12860|CNTN1_HUMAN
15 Dec 2023 01:54:56,678 INFO : 79% Done
15 Dec 2023 01:54:56,731 DEBUG: Total peptides inserted: 32
15 Dec 2023 01:54:56,731 INFO : Inserting sp|Q12866|MERTK_HUMAN
15 Dec 2023 01:54:56,786 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:56,786 INFO : Inserting sp|Q12882|DPYD_HUMAN
15 Dec 2023 01:54:56,809 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:56,809 INFO : Inserting sp|Q12884|SEPR_HUMAN
15 Dec 2023 01:54:56,855 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:56,855 INFO : Inserting sp|Q12906|ILF3_HUMAN
15 Dec 2023 01:54:56,918 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:56,918 INFO : Inserting sp|Q12907|LMAN2_HUMAN
15 Dec 2023 01:54:57,191 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:57,191 INFO : Inserting sp|Q12913|PTPRJ_HUMAN
15 Dec 2023 01:54:57,408 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:54:57,408 INFO : Inserting sp|Q12931|TRAP1_HUMAN
15 Dec 2023 01:54:57,429 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:57,429 INFO : Inserting sp|Q12955|ANK3_HUMAN
15 Dec 2023 01:54:57,605 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:54:57,605 INFO : Inserting sp|Q13093|PAFA_HUMAN
15 Dec 2023 01:54:57,865 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:54:57,865 INFO : Inserting sp|Q13151|ROA0_HUMAN
15 Dec 2023 01:54:57,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:57,888 INFO : Inserting sp|Q13164|MK07_HUMAN
15 Dec 2023 01:54:57,933 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:57,933 INFO : Inserting sp|Q13185|CBX3_HUMAN
15 Dec 2023 01:54:57,954 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:57,954 INFO : Inserting sp|Q13188|STK3_HUMAN
15 Dec 2023 01:54:57,976 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:57,976 INFO : Inserting sp|Q13200|PSMD2_HUMAN
15 Dec 2023 01:54:58,005 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:58,005 INFO : Inserting sp|Q13201|MMRN1_HUMAN
15 Dec 2023 01:54:58,121 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:58,121 INFO : Inserting sp|Q13217|DNJC3_HUMAN
15 Dec 2023 01:54:58,143 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:58,143 INFO : Inserting sp|Q13228|SBP1_HUMAN
15 Dec 2023 01:54:58,787 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:54:58,787 INFO : Inserting sp|Q13231|CHIT1_HUMAN
15 Dec 2023 01:54:59,005 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:54:59,005 INFO : Inserting sp|Q13232|NDK3_HUMAN
15 Dec 2023 01:54:59,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:59,030 INFO : Inserting sp|Q13247|SRSF6_HUMAN
15 Dec 2023 01:54:59,055 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:59,055 INFO : Inserting sp|Q13285|STF1_HUMAN
15 Dec 2023 01:54:59,071 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:59,071 INFO : Inserting sp|Q13303|KCAB2_HUMAN
15 Dec 2023 01:54:59,093 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:54:59,093 INFO : Inserting sp|Q13332|PTPRS_HUMAN
15 Dec 2023 01:54:59,277 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:54:59,277 INFO : Inserting sp|Q13404|UB2V1_HUMAN
15 Dec 2023 01:54:59,407 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:54:59,407 INFO : Inserting sp|Q13418|ILK_HUMAN
15 Dec 2023 01:54:59,520 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:59,520 INFO : Inserting sp|Q13421|MSLN_HUMAN
15 Dec 2023 01:54:59,588 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:59,588 INFO : Inserting sp|Q13443|ADAM9_HUMAN
15 Dec 2023 01:54:59,636 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:54:59,636 INFO : Inserting sp|Q13449|LSAMP_HUMAN
15 Dec 2023 01:54:59,765 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:54:59,766 INFO : Inserting sp|Q13508|NAR3_HUMAN
15 Dec 2023 01:54:59,904 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:54:59,904 INFO : Inserting sp|Q13510|ASAH1_HUMAN
15 Dec 2023 01:54:59,960 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:54:59,960 INFO : Inserting sp|Q13526|PIN1_HUMAN
15 Dec 2023 01:55:00,013 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:00,013 INFO : Inserting sp|Q13596|SNX1_HUMAN
15 Dec 2023 01:55:00,043 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:00,043 INFO : Inserting sp|Q13740|CD166_HUMAN
15 Dec 2023 01:55:00,327 INFO : 80% Done
15 Dec 2023 01:55:00,346 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:55:00,346 INFO : Inserting sp|Q13765|NACA_HUMAN
15 Dec 2023 01:55:00,374 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:00,374 INFO : Inserting sp|Q13790|APOF_HUMAN
15 Dec 2023 01:55:00,492 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:00,492 INFO : Inserting sp|Q13813|SPTN1_HUMAN
15 Dec 2023 01:55:00,607 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:00,607 INFO : Inserting sp|Q13822|ENPP2_HUMAN
15 Dec 2023 01:55:01,500 DEBUG: Total peptides inserted: 38
15 Dec 2023 01:55:01,500 INFO : Inserting sp|Q13838|DX39B_HUMAN
15 Dec 2023 01:55:01,566 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:01,566 INFO : Inserting sp|Q13867|BLMH_HUMAN
15 Dec 2023 01:55:01,640 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:01,641 INFO : Inserting sp|Q14019|COTL1_HUMAN
15 Dec 2023 01:55:01,719 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:01,719 INFO : Inserting sp|Q14103|HNRPD_HUMAN
15 Dec 2023 01:55:01,808 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:01,808 INFO : Inserting sp|Q14112|NID2_HUMAN
15 Dec 2023 01:55:02,071 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:55:02,071 INFO : Inserting sp|Q14118|DAG1_HUMAN
15 Dec 2023 01:55:02,277 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:02,277 INFO : Inserting sp|Q14126|DSG2_HUMAN
15 Dec 2023 01:55:02,307 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:02,307 INFO : Inserting sp|Q14141|SEPT6_HUMAN
15 Dec 2023 01:55:02,394 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:02,394 INFO : Inserting sp|Q14155|ARHG7_HUMAN
15 Dec 2023 01:55:02,417 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:02,417 INFO : Inserting sp|Q14240|IF4A2_HUMAN
15 Dec 2023 01:55:02,523 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:02,523 INFO : Inserting sp|Q14254|FLOT2_HUMAN
15 Dec 2023 01:55:02,634 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:02,634 INFO : Inserting sp|Q14314|FGL2_HUMAN
15 Dec 2023 01:55:02,702 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:02,702 INFO : Inserting sp|Q14315|FLNC_HUMAN
15 Dec 2023 01:55:02,867 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:02,867 INFO : Inserting sp|Q14344|GNA13_HUMAN
15 Dec 2023 01:55:02,910 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:02,910 INFO : Inserting sp|Q14393|GAS6_HUMAN
15 Dec 2023 01:55:02,949 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:02,949 INFO : Inserting sp|Q14515|SPRL1_HUMAN
15 Dec 2023 01:55:03,483 DEBUG: Total peptides inserted: 23
15 Dec 2023 01:55:03,483 INFO : Inserting sp|Q14520|HABP2_HUMAN
15 Dec 2023 01:55:03,847 INFO : 81% Done
15 Dec 2023 01:55:03,965 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:55:03,965 INFO : Inserting sp|Q14533|KRT81_HUMAN
15 Dec 2023 01:55:04,035 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:04,035 INFO : Inserting sp|Q14573|ITPR3_HUMAN
15 Dec 2023 01:55:04,058 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:04,058 INFO : Inserting sp|Q14624|ITIH4_HUMAN
15 Dec 2023 01:55:05,250 DEBUG: Inserted 50 peptides
15 Dec 2023 01:55:05,712 DEBUG: Total peptides inserted: 66
15 Dec 2023 01:55:05,712 INFO : Inserting sp|Q14651|PLSI_HUMAN
15 Dec 2023 01:55:05,835 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:05,835 INFO : Inserting sp|Q14678|KANK1_HUMAN
15 Dec 2023 01:55:05,861 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:05,861 INFO : Inserting sp|Q14679|TTLL4_HUMAN
15 Dec 2023 01:55:05,881 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:05,881 INFO : Inserting sp|Q14697|GANAB_HUMAN
15 Dec 2023 01:55:05,941 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:05,942 INFO : Inserting sp|Q14764|MVP_HUMAN
15 Dec 2023 01:55:06,359 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:06,359 INFO : Inserting sp|Q14766|LTBP1_HUMAN
15 Dec 2023 01:55:06,602 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:06,602 INFO : Inserting sp|Q14767|LTBP2_HUMAN
15 Dec 2023 01:55:06,774 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:06,774 INFO : Inserting sp|Q14839|CHD4_HUMAN
15 Dec 2023 01:55:06,804 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:06,804 INFO : Inserting sp|Q14847|LASP1_HUMAN
15 Dec 2023 01:55:06,841 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:06,841 INFO : Inserting sp|Q14956|GPNMB_HUMAN
15 Dec 2023 01:55:06,856 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:06,856 INFO : Inserting sp|Q14974|IMB1_HUMAN
15 Dec 2023 01:55:06,988 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:06,988 INFO : Inserting sp|Q14982|OPCM_HUMAN
15 Dec 2023 01:55:07,104 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:07,104 INFO : Inserting sp|Q14CM0|FRPD4_HUMAN
15 Dec 2023 01:55:07,170 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:07,171 INFO : Inserting sp|Q14CN4|K2C72_HUMAN
15 Dec 2023 01:55:07,220 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:07,220 INFO : Inserting sp|Q15029|U5S1_HUMAN
15 Dec 2023 01:55:07,257 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:07,257 INFO : Inserting sp|Q15052|ARHG6_HUMAN
15 Dec 2023 01:55:07,285 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:07,285 INFO : Inserting sp|Q15061|WDR43_HUMAN
15 Dec 2023 01:55:07,319 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:07,319 INFO : Inserting sp|Q15063|POSTN_HUMAN
15 Dec 2023 01:55:07,456 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:07,456 INFO : Imported 1200 peptide groups.
15 Dec 2023 01:55:07,456 INFO : Inserting sp|Q15072|OZF_HUMAN
15 Dec 2023 01:55:07,486 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:07,486 INFO : Inserting sp|Q15080|NCF4_HUMAN
15 Dec 2023 01:55:07,590 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:07,590 INFO : Inserting sp|Q15084|PDIA6_HUMAN
15 Dec 2023 01:55:07,656 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:07,656 INFO : Inserting sp|Q15102|PA1B3_HUMAN
15 Dec 2023 01:55:07,783 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:07,783 INFO : Inserting sp|Q15113|PCOC1_HUMAN
15 Dec 2023 01:55:07,960 INFO : 82% Done
15 Dec 2023 01:55:08,274 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:55:08,274 INFO : Inserting sp|Q15149|PLEC_HUMAN
15 Dec 2023 01:55:08,343 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:08,343 INFO : Inserting sp|Q15166|PON3_HUMAN
15 Dec 2023 01:55:08,570 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:08,570 INFO : Inserting sp|Q15185|TEBP_HUMAN
15 Dec 2023 01:55:08,599 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:08,599 INFO : Inserting sp|Q15223|NECT1_HUMAN
15 Dec 2023 01:55:08,643 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:08,643 INFO : Inserting sp|Q15233|NONO_HUMAN
15 Dec 2023 01:55:08,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:08,669 INFO : Inserting sp|Q15257|PTPA_HUMAN
15 Dec 2023 01:55:08,782 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:08,782 INFO : Inserting sp|Q15286|RAB35_HUMAN
15 Dec 2023 01:55:08,847 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:08,847 INFO : Inserting sp|Q15323|K1H1_HUMAN
15 Dec 2023 01:55:08,931 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:08,931 INFO : Inserting sp|Q15365|PCBP1_HUMAN
15 Dec 2023 01:55:08,969 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:08,969 INFO : Inserting sp|Q15375|EPHA7_HUMAN
15 Dec 2023 01:55:09,008 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:09,008 INFO : Inserting sp|Q15393|SF3B3_HUMAN
15 Dec 2023 01:55:09,030 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:09,030 INFO : Inserting sp|Q15435|PP1R7_HUMAN
15 Dec 2023 01:55:09,078 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:09,078 INFO : Inserting sp|Q15485|FCN2_HUMAN
15 Dec 2023 01:55:09,249 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:09,250 INFO : Inserting sp|Q15582|BGH3_HUMAN
15 Dec 2023 01:55:09,971 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:55:09,971 INFO : Inserting sp|Q15631|TSN_HUMAN
15 Dec 2023 01:55:10,026 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:10,026 INFO : Inserting sp|Q15691|MARE1_HUMAN
15 Dec 2023 01:55:10,074 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:10,074 INFO : Inserting sp|Q15782|CH3L2_HUMAN
15 Dec 2023 01:55:10,252 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:10,252 INFO : Inserting sp|Q15818|NPTX1_HUMAN
15 Dec 2023 01:55:10,265 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:10,265 INFO : Inserting sp|Q15819|UB2V2_HUMAN
15 Dec 2023 01:55:10,364 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:10,364 INFO : Inserting sp|Q15828|CYTM_HUMAN
15 Dec 2023 01:55:10,452 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:10,452 INFO : Inserting sp|Q15833|STXB2_HUMAN
15 Dec 2023 01:55:10,514 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:10,514 INFO : Inserting sp|Q15843|NEDD8_HUMAN
15 Dec 2023 01:55:10,545 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:10,545 INFO : Inserting sp|Q15848|ADIPO_HUMAN
15 Dec 2023 01:55:10,665 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:10,665 INFO : Inserting sp|Q15904|VAS1_HUMAN
15 Dec 2023 01:55:10,760 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:10,760 INFO : Inserting sp|Q15907|RB11B_HUMAN
15 Dec 2023 01:55:10,881 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:10,881 INFO : Inserting sp|Q15942|ZYX_HUMAN
15 Dec 2023 01:55:10,982 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:10,982 INFO : Inserting sp|Q16181|SEPT7_HUMAN
15 Dec 2023 01:55:11,004 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:11,004 INFO : Inserting sp|Q16270|IBP7_HUMAN
15 Dec 2023 01:55:11,292 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:11,292 INFO : Inserting sp|Q16394|EXT1_HUMAN
15 Dec 2023 01:55:11,314 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:11,314 INFO : Inserting sp|Q16401|PSMD5_HUMAN
15 Dec 2023 01:55:11,352 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:11,352 INFO : Inserting sp|Q16543|CDC37_HUMAN
15 Dec 2023 01:55:11,401 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:11,401 INFO : Inserting sp|Q16555|DPYL2_HUMAN
15 Dec 2023 01:55:11,494 INFO : 83% Done
15 Dec 2023 01:55:11,563 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:11,563 INFO : Inserting sp|Q16610|ECM1_HUMAN
15 Dec 2023 01:55:12,366 DEBUG: Total peptides inserted: 33
15 Dec 2023 01:55:12,366 INFO : Inserting sp|Q16620|NTRK2_HUMAN
15 Dec 2023 01:55:12,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:12,397 INFO : Inserting sp|Q16627|CCL14_HUMAN
15 Dec 2023 01:55:12,446 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:12,446 INFO : Inserting sp|Q16629|SRSF7_HUMAN
15 Dec 2023 01:55:12,463 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:12,463 INFO : Inserting sp|Q16635|TAZ_HUMAN
15 Dec 2023 01:55:12,500 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:12,500 INFO : Inserting sp|Q16653|MOG_HUMAN
15 Dec 2023 01:55:12,574 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:12,574 INFO : Inserting sp|Q16658|FSCN1_HUMAN
15 Dec 2023 01:55:12,703 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:12,703 INFO : Inserting sp|Q16695|H31T_HUMAN
15 Dec 2023 01:55:12,765 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:12,765 INFO : Inserting sp|Q16706|MA2A1_HUMAN
15 Dec 2023 01:55:13,107 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:55:13,107 INFO : Inserting sp|Q16769|QPCT_HUMAN
15 Dec 2023 01:55:13,152 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:13,152 INFO : Inserting sp|Q16775|GLO2_HUMAN
15 Dec 2023 01:55:13,395 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:13,395 INFO : Inserting sp|Q16777|H2A2C_HUMAN
15 Dec 2023 01:55:13,511 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:13,512 INFO : Inserting sp|Q16778|H2B2E_HUMAN
15 Dec 2023 01:55:13,652 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:13,652 INFO : Inserting sp|Q16850|CP51A_HUMAN
15 Dec 2023 01:55:13,680 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:13,680 INFO : Inserting sp|Q16851|UGPA_HUMAN
15 Dec 2023 01:55:13,973 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:13,973 INFO : Inserting sp|Q16853|AOC3_HUMAN
15 Dec 2023 01:55:14,182 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:14,182 INFO : Inserting sp|Q16880|CGT_HUMAN
15 Dec 2023 01:55:14,242 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,242 INFO : Inserting sp|Q16881|TRXR1_HUMAN
15 Dec 2023 01:55:14,408 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:14,408 INFO : Inserting sp|Q2TBE0|C19L2_HUMAN
15 Dec 2023 01:55:14,459 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:14,459 INFO : Inserting sp|Q32MZ4|LRRF1_HUMAN
15 Dec 2023 01:55:14,515 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,516 INFO : Inserting sp|Q3LXA3|TKFC_HUMAN
15 Dec 2023 01:55:14,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,532 INFO : Inserting sp|Q3V6T2|GRDN_HUMAN
15 Dec 2023 01:55:14,547 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,548 INFO : Inserting sp|Q460N5|PAR14_HUMAN
15 Dec 2023 01:55:14,564 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,564 INFO : Inserting sp|Q49A17|GLTL6_HUMAN
15 Dec 2023 01:55:14,587 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,587 INFO : Inserting sp|Q4G0P3|HYDIN_HUMAN
15 Dec 2023 01:55:14,622 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,622 INFO : Inserting sp|Q4G0S4|C27C1_HUMAN
15 Dec 2023 01:55:14,671 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,671 INFO : Inserting sp|Q4KWH8|PLCH1_HUMAN
15 Dec 2023 01:55:14,694 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,694 INFO : Inserting sp|Q504Y0|S39AC_HUMAN
15 Dec 2023 01:55:14,780 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:14,780 INFO : Inserting sp|Q52LW3|RHG29_HUMAN
15 Dec 2023 01:55:14,813 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,813 INFO : Inserting sp|Q53EL9|SEZ6_HUMAN
15 Dec 2023 01:55:14,866 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:14,867 INFO : Inserting sp|Q5JRX3|PREP_HUMAN
15 Dec 2023 01:55:14,888 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:14,888 INFO : Inserting sp|Q5JWF2|GNAS1_HUMAN
15 Dec 2023 01:55:14,934 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:14,934 INFO : Inserting sp|Q5KU26|COL12_HUMAN
15 Dec 2023 01:55:15,051 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:15,051 INFO : Inserting sp|Q5QNW6|H2B2F_HUMAN
15 Dec 2023 01:55:15,167 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:15,167 INFO : Inserting sp|Q5T3U5|MRP7_HUMAN
15 Dec 2023 01:55:15,195 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,195 INFO : Inserting sp|Q5T7B8|KIF24_HUMAN
15 Dec 2023 01:55:15,219 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,219 INFO : Inserting sp|Q5TAT6|CODA1_HUMAN
15 Dec 2023 01:55:15,233 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,233 INFO : Inserting sp|Q5TDH0|DDI2_HUMAN
15 Dec 2023 01:55:15,330 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:15,331 INFO : Inserting sp|Q5THR3|EFCB6_HUMAN
15 Dec 2023 01:55:15,348 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,348 INFO : Inserting sp|Q5VST9|OBSCN_HUMAN
15 Dec 2023 01:55:15,394 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,394 INFO : Inserting sp|Q5VT06|CE350_HUMAN
15 Dec 2023 01:55:15,462 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:15,462 INFO : Inserting sp|Q5VY43|PEAR1_HUMAN
15 Dec 2023 01:55:15,477 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,478 INFO : Inserting sp|Q5VYS8|TUT7_HUMAN
15 Dec 2023 01:55:15,502 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,502 INFO : Inserting sp|Q5XKE5|K2C79_HUMAN
15 Dec 2023 01:55:15,603 INFO : 84% Done
15 Dec 2023 01:55:15,652 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:15,652 INFO : Inserting sp|Q5XKL5|BTBD8_HUMAN
15 Dec 2023 01:55:15,672 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,672 INFO : Inserting sp|Q68DK2|ZFY26_HUMAN
15 Dec 2023 01:55:15,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,696 INFO : Inserting sp|Q68E01|INT3_HUMAN
15 Dec 2023 01:55:15,699 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,699 INFO : Inserting sp|Q6EEV6|SUMO4_HUMAN
15 Dec 2023 01:55:15,712 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:15,712 INFO : Inserting sp|Q6EMK4|VASN_HUMAN
15 Dec 2023 01:55:15,914 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:15,914 INFO : Inserting sp|Q6FHJ7|SFRP4_HUMAN
15 Dec 2023 01:55:15,961 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:15,961 INFO : Inserting sp|Q6FI13|H2A2A_HUMAN
15 Dec 2023 01:55:16,052 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:16,052 INFO : Inserting sp|Q6GTS8|P20D1_HUMAN
15 Dec 2023 01:55:16,094 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:16,094 INFO : Inserting sp|Q6IBS0|TWF2_HUMAN
15 Dec 2023 01:55:16,263 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:16,263 INFO : Inserting sp|Q6ICL3|TNG2_HUMAN
15 Dec 2023 01:55:16,313 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:16,313 INFO : Inserting sp|Q6KC79|NIPBL_HUMAN
15 Dec 2023 01:55:16,345 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:16,345 INFO : Inserting sp|Q6N022|TEN4_HUMAN
15 Dec 2023 01:55:16,369 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:16,369 INFO : Inserting sp|Q6NZY4|ZCHC8_HUMAN
15 Dec 2023 01:55:16,393 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:16,393 INFO : Inserting sp|Q6P4A8|PLBL1_HUMAN
15 Dec 2023 01:55:16,487 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:16,487 INFO : Inserting sp|Q6P988|NOTUM_HUMAN
15 Dec 2023 01:55:16,513 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:16,513 INFO : Inserting sp|Q6PL18|ATAD2_HUMAN
15 Dec 2023 01:55:16,534 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:16,535 INFO : Inserting sp|Q6Q759|SPG17_HUMAN
15 Dec 2023 01:55:16,570 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:16,570 INFO : Inserting sp|Q6UWE0|LRSM1_HUMAN
15 Dec 2023 01:55:16,607 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:16,607 INFO : Inserting sp|Q6UX06|OLFM4_HUMAN
15 Dec 2023 01:55:16,715 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:16,715 INFO : Imported 1300 peptide groups.
15 Dec 2023 01:55:16,715 INFO : Inserting sp|Q6UX71|PXDC2_HUMAN
15 Dec 2023 01:55:16,903 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:16,903 INFO : Inserting sp|Q6UXB8|PI16_HUMAN
15 Dec 2023 01:55:17,147 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:17,147 INFO : Inserting sp|Q6UXD5|SE6L2_HUMAN
15 Dec 2023 01:55:17,189 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:17,189 INFO : Inserting sp|Q6UY14|ATL4_HUMAN
15 Dec 2023 01:55:17,232 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:17,232 INFO : Inserting sp|Q6XQN6|PNCB_HUMAN
15 Dec 2023 01:55:17,389 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:17,389 INFO : Inserting sp|Q6YHK3|CD109_HUMAN
15 Dec 2023 01:55:17,642 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:17,642 INFO : Inserting sp|Q71DI3|H32_HUMAN
15 Dec 2023 01:55:17,694 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:17,694 INFO : Inserting sp|Q71RC2|LARP4_HUMAN
15 Dec 2023 01:55:17,717 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:17,717 INFO : Inserting sp|Q76LX8|ATS13_HUMAN
15 Dec 2023 01:55:18,254 DEBUG: Total peptides inserted: 27
15 Dec 2023 01:55:18,254 INFO : Inserting sp|Q76N89|HECW1_HUMAN
15 Dec 2023 01:55:18,279 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:18,279 INFO : Inserting sp|Q7L0Y3|TM10C_HUMAN
15 Dec 2023 01:55:18,300 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:18,300 INFO : Inserting sp|Q7L523|RRAGA_HUMAN
15 Dec 2023 01:55:18,351 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:18,352 INFO : Inserting sp|Q7L7L0|H2A3_HUMAN
15 Dec 2023 01:55:18,446 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:18,446 INFO : Inserting sp|Q7L9L4|MOB1B_HUMAN
15 Dec 2023 01:55:18,494 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:18,494 INFO : Inserting sp|Q7LFX5|CHSTF_HUMAN
15 Dec 2023 01:55:18,517 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:18,517 INFO : Inserting sp|Q7Z2Y5|NRK_HUMAN
15 Dec 2023 01:55:18,531 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:18,531 INFO : Inserting sp|Q7Z3B1|NEGR1_HUMAN
15 Dec 2023 01:55:18,616 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:18,616 INFO : Inserting sp|Q7Z3S9|NT2NA_HUMAN
15 Dec 2023 01:55:18,630 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:18,630 INFO : Inserting sp|Q7Z3Y9|K1C26_HUMAN
15 Dec 2023 01:55:18,678 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:18,679 INFO : Inserting sp|Q7Z3Z0|K1C25_HUMAN
15 Dec 2023 01:55:18,748 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:18,748 INFO : Inserting sp|Q7Z406|MYH14_HUMAN
15 Dec 2023 01:55:19,013 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:19,013 INFO : Inserting sp|Q7Z5A7|TAFA5_HUMAN
15 Dec 2023 01:55:19,029 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:19,029 INFO : Inserting sp|Q7Z5K2|WAPL_HUMAN
15 Dec 2023 01:55:19,076 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:19,076 INFO : Inserting sp|Q7Z5R6|AB1IP_HUMAN
15 Dec 2023 01:55:19,157 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:19,157 INFO : Inserting sp|Q7Z794|K2C1B_HUMAN
15 Dec 2023 01:55:19,210 INFO : 85% Done
15 Dec 2023 01:55:19,266 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:19,266 INFO : Inserting sp|Q7Z7G0|TARSH_HUMAN
15 Dec 2023 01:55:19,551 DEBUG: Total peptides inserted: 12
15 Dec 2023 01:55:19,552 INFO : Inserting sp|Q7Z7M0|MEGF8_HUMAN
15 Dec 2023 01:55:20,293 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:55:20,293 INFO : Inserting sp|Q86SF2|GALT7_HUMAN
15 Dec 2023 01:55:20,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:20,344 INFO : Inserting sp|Q86SG5|S1A7A_HUMAN
15 Dec 2023 01:55:20,374 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:20,374 INFO : Inserting sp|Q86SQ4|AGRG6_HUMAN
15 Dec 2023 01:55:20,447 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:20,447 INFO : Inserting sp|Q86SR1|GLT10_HUMAN
15 Dec 2023 01:55:20,472 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:20,472 INFO : Inserting sp|Q86T90|K1328_HUMAN
15 Dec 2023 01:55:20,526 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:20,527 INFO : Inserting sp|Q86TH1|ATL2_HUMAN
15 Dec 2023 01:55:20,575 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:20,575 INFO : Inserting sp|Q86UN3|R4RL2_HUMAN
15 Dec 2023 01:55:20,649 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:20,649 INFO : Inserting sp|Q86UW6|N4BP2_HUMAN
15 Dec 2023 01:55:20,673 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:20,673 INFO : Inserting sp|Q86UX2|ITIH5_HUMAN
15 Dec 2023 01:55:20,729 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:20,729 INFO : Inserting sp|Q86UX7|URP2_HUMAN
15 Dec 2023 01:55:21,141 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:55:21,142 INFO : Inserting sp|Q86VB7|C163A_HUMAN
15 Dec 2023 01:55:21,917 DEBUG: Total peptides inserted: 39
15 Dec 2023 01:55:21,917 INFO : Inserting sp|Q86VP6|CAND1_HUMAN
15 Dec 2023 01:55:22,127 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:22,127 INFO : Inserting sp|Q86VQ0|LCA5_HUMAN
15 Dec 2023 01:55:22,148 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,148 INFO : Inserting sp|Q86W74|ANR46_HUMAN
15 Dec 2023 01:55:22,169 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,169 INFO : Inserting sp|Q86WI1|PKHL1_HUMAN
15 Dec 2023 01:55:22,229 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:22,229 INFO : Inserting sp|Q86YT9|JAML_HUMAN
15 Dec 2023 01:55:22,271 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,271 INFO : Inserting sp|Q86YV9|HPS6_HUMAN
15 Dec 2023 01:55:22,320 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,320 INFO : Inserting sp|Q86YW5|TRML1_HUMAN
15 Dec 2023 01:55:22,345 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,345 INFO : Inserting sp|Q86YZ3|HORN_HUMAN
15 Dec 2023 01:55:22,379 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,379 INFO : Inserting sp|Q86Z02|HIPK1_HUMAN
15 Dec 2023 01:55:22,402 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,402 INFO : Inserting sp|Q8IU80|TMPS6_HUMAN
15 Dec 2023 01:55:22,441 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,441 INFO : Inserting sp|Q8IUE6|H2A2B_HUMAN
15 Dec 2023 01:55:22,510 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:22,510 INFO : Inserting sp|Q8IUG5|MY18B_HUMAN
15 Dec 2023 01:55:22,565 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:22,565 INFO : Inserting sp|Q8IUX7|AEBP1_HUMAN
15 Dec 2023 01:55:22,694 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:22,694 INFO : Inserting sp|Q8IV08|PLD3_HUMAN
15 Dec 2023 01:55:22,737 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,737 INFO : Inserting sp|Q8IWI9|MGAP_HUMAN
15 Dec 2023 01:55:22,757 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,757 INFO : Inserting sp|Q8IWL1|SFPA2_HUMAN
15 Dec 2023 01:55:22,770 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,770 INFO : Inserting sp|Q8IWL2|SFTA1_HUMAN
15 Dec 2023 01:55:22,784 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,784 INFO : Inserting sp|Q8IWT3|CUL9_HUMAN
15 Dec 2023 01:55:22,826 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:22,826 INFO : Inserting sp|Q8IWV2|CNTN4_HUMAN
15 Dec 2023 01:55:22,851 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,851 INFO : Inserting sp|Q8IWV7|UBR1_HUMAN
15 Dec 2023 01:55:22,937 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:22,937 INFO : Inserting sp|Q8IX19|MCEM1_HUMAN
15 Dec 2023 01:55:22,951 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:22,951 INFO : Inserting sp|Q8IXL6|FA20C_HUMAN
15 Dec 2023 01:55:23,081 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:23,081 INFO : Inserting sp|Q8IYR2|SMYD4_HUMAN
15 Dec 2023 01:55:23,089 INFO : 86% Done
15 Dec 2023 01:55:23,118 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:23,118 INFO : Inserting sp|Q8IYS5|OSCAR_HUMAN
15 Dec 2023 01:55:23,139 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,139 INFO : Inserting sp|Q8IZD2|KMT2E_HUMAN
15 Dec 2023 01:55:23,169 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:23,169 INFO : Inserting sp|Q8IZF0|NALCN_HUMAN
15 Dec 2023 01:55:23,325 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:23,325 INFO : Inserting sp|Q8IZF2|AGRF5_HUMAN
15 Dec 2023 01:55:23,406 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:23,406 INFO : Inserting sp|Q8N126|CADM3_HUMAN
15 Dec 2023 01:55:23,553 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:23,553 INFO : Inserting sp|Q8N1A0|KT222_HUMAN
15 Dec 2023 01:55:23,584 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:23,584 INFO : Inserting sp|Q8N1K5|THMS1_HUMAN
15 Dec 2023 01:55:23,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,604 INFO : Inserting sp|Q8N257|H2B3B_HUMAN
15 Dec 2023 01:55:23,711 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:23,712 INFO : Inserting sp|Q8N2S1|LTBP4_HUMAN
15 Dec 2023 01:55:23,746 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:23,746 INFO : Inserting sp|Q8N339|MT1M_HUMAN
15 Dec 2023 01:55:23,762 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,762 INFO : Inserting sp|Q8N3K9|CMYA5_HUMAN
15 Dec 2023 01:55:23,786 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,786 INFO : Inserting sp|Q8N3Y3|LARG2_HUMAN
15 Dec 2023 01:55:23,808 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,808 INFO : Inserting sp|Q8N474|SFRP1_HUMAN
15 Dec 2023 01:55:23,854 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:23,854 INFO : Inserting sp|Q8N4C8|MINK1_HUMAN
15 Dec 2023 01:55:23,868 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:23,868 INFO : Inserting sp|Q8N6C8|LIRA3_HUMAN
15 Dec 2023 01:55:23,970 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:23,970 INFO : Inserting sp|Q8N6Q3|CD177_HUMAN
15 Dec 2023 01:55:24,014 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:24,014 INFO : Inserting sp|Q8N752|KC1AL_HUMAN
15 Dec 2023 01:55:24,038 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,038 INFO : Inserting sp|Q8N766|EMC1_HUMAN
15 Dec 2023 01:55:24,065 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,065 INFO : Inserting sp|Q8NA42|ZN383_HUMAN
15 Dec 2023 01:55:24,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,088 INFO : Inserting sp|Q8NAT1|PMGT2_HUMAN
15 Dec 2023 01:55:24,115 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,115 INFO : Inserting sp|Q8NBJ4|GOLM1_HUMAN
15 Dec 2023 01:55:24,200 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:24,200 INFO : Inserting sp|Q8NBP7|PCSK9_HUMAN
15 Dec 2023 01:55:24,325 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:24,325 INFO : Inserting sp|Q8NC01|CLC1A_HUMAN
15 Dec 2023 01:55:24,348 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,348 INFO : Inserting sp|Q8NDG6|TDRD9_HUMAN
15 Dec 2023 01:55:24,362 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:24,362 INFO : Inserting sp|Q8NEV1|CSK23_HUMAN
15 Dec 2023 01:55:24,404 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,405 INFO : Inserting sp|Q8NF91|SYNE1_HUMAN
15 Dec 2023 01:55:24,590 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:24,591 INFO : Inserting sp|Q8NFT8|DNER_HUMAN
15 Dec 2023 01:55:24,630 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:24,630 INFO : Inserting sp|Q8NFW5|DMBX1_HUMAN
15 Dec 2023 01:55:24,660 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,660 INFO : Inserting sp|Q8NFZ8|CADM4_HUMAN
15 Dec 2023 01:55:24,843 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:24,843 INFO : Inserting sp|Q8NG11|TSN14_HUMAN
15 Dec 2023 01:55:24,872 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,872 INFO : Inserting sp|Q8NHL6|LIRB1_HUMAN
15 Dec 2023 01:55:24,899 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:24,899 INFO : Inserting sp|Q8NHP8|PLBL2_HUMAN
15 Dec 2023 01:55:24,916 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,916 INFO : Inserting sp|Q8TAG5|VTM2A_HUMAN
15 Dec 2023 01:55:24,960 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,960 INFO : Inserting sp|Q8TBP5|F174A_HUMAN
15 Dec 2023 01:55:24,982 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:24,982 INFO : Inserting sp|Q8TCF1|ZFAN1_HUMAN
15 Dec 2023 01:55:25,008 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,008 INFO : Inserting sp|Q8TCG2|P4K2B_HUMAN
15 Dec 2023 01:55:25,023 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,023 INFO : Inserting sp|Q8TDB8|GTR14_HUMAN
15 Dec 2023 01:55:25,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,045 INFO : Inserting sp|Q8TDD5|MCLN3_HUMAN
15 Dec 2023 01:55:25,067 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,067 INFO : Inserting sp|Q8TDP1|RNH2C_HUMAN
15 Dec 2023 01:55:25,080 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,080 INFO : Imported 1400 peptide groups.
15 Dec 2023 01:55:25,080 INFO : Inserting sp|Q8TDQ0|HAVR2_HUMAN
15 Dec 2023 01:55:25,104 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,104 INFO : Inserting sp|Q8TE73|DYH5_HUMAN
15 Dec 2023 01:55:25,196 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:25,196 INFO : Inserting sp|Q8TER0|SNED1_HUMAN
15 Dec 2023 01:55:25,253 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:25,253 INFO : Inserting sp|Q8TEU8|WFKN2_HUMAN
15 Dec 2023 01:55:25,332 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:25,333 INFO : Inserting sp|Q8TF40|FNIP1_HUMAN
15 Dec 2023 01:55:25,370 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:25,370 INFO : Inserting sp|Q8TF72|SHRM3_HUMAN
15 Dec 2023 01:55:25,384 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,384 INFO : Inserting sp|Q8WUM4|PDC6I_HUMAN
15 Dec 2023 01:55:25,660 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:55:25,660 INFO : Inserting sp|Q8WVN6|SCTM1_HUMAN
15 Dec 2023 01:55:25,680 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,680 INFO : Inserting sp|Q8WVQ1|CANT1_HUMAN
15 Dec 2023 01:55:25,735 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:25,736 INFO : Inserting sp|Q8WWI1|LMO7_HUMAN
15 Dec 2023 01:55:25,785 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:25,785 INFO : Inserting sp|Q8WXA3|RUFY2_HUMAN
15 Dec 2023 01:55:25,812 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:25,812 INFO : Inserting sp|Q8WXD2|SCG3_HUMAN
15 Dec 2023 01:55:25,941 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:25,942 INFO : Inserting sp|Q8WXH0|SYNE2_HUMAN
15 Dec 2023 01:55:26,214 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:55:26,214 INFO : Inserting sp|Q8WXR4|MYO3B_HUMAN
15 Dec 2023 01:55:26,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:26,232 INFO : Inserting sp|Q8WZ42|TITIN_HUMAN
15 Dec 2023 01:55:26,753 INFO : 87% Done
15 Dec 2023 01:55:27,124 DEBUG: Total peptides inserted: 47
15 Dec 2023 01:55:27,124 INFO : Inserting sp|Q8WZ75|ROBO4_HUMAN
15 Dec 2023 01:55:27,164 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,164 INFO : Inserting sp|Q8WZA1|PMGT1_HUMAN
15 Dec 2023 01:55:27,213 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,213 INFO : Inserting sp|Q92496|FHR4_HUMAN
15 Dec 2023 01:55:27,478 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:55:27,478 INFO : Inserting sp|Q92520|FAM3C_HUMAN
15 Dec 2023 01:55:27,662 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:27,663 INFO : Inserting sp|Q92530|PSMF1_HUMAN
15 Dec 2023 01:55:27,687 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:27,687 INFO : Inserting sp|Q92563|TICN2_HUMAN
15 Dec 2023 01:55:27,726 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,726 INFO : Inserting sp|Q92608|DOCK2_HUMAN
15 Dec 2023 01:55:27,765 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,765 INFO : Inserting sp|Q92688|AN32B_HUMAN
15 Dec 2023 01:55:27,837 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:27,837 INFO : Inserting sp|Q92752|TENR_HUMAN
15 Dec 2023 01:55:27,875 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,875 INFO : Inserting sp|Q92765|SFRP3_HUMAN
15 Dec 2023 01:55:27,947 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:27,947 INFO : Inserting sp|Q92794|KAT6A_HUMAN
15 Dec 2023 01:55:27,968 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:27,968 INFO : Inserting sp|Q92804|RBP56_HUMAN
15 Dec 2023 01:55:27,993 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:27,993 INFO : Inserting sp|Q92820|GGH_HUMAN
15 Dec 2023 01:55:28,293 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:55:28,293 INFO : Inserting sp|Q92823|NRCAM_HUMAN
15 Dec 2023 01:55:28,681 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:55:28,681 INFO : Inserting sp|Q92835|SHIP1_HUMAN
15 Dec 2023 01:55:28,766 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:28,766 INFO : Inserting sp|Q92854|SEM4D_HUMAN
15 Dec 2023 01:55:28,828 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:28,828 INFO : Inserting sp|Q92859|NEO1_HUMAN
15 Dec 2023 01:55:29,017 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:29,017 INFO : Inserting sp|Q92876|KLK6_HUMAN
15 Dec 2023 01:55:29,336 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:29,337 INFO : Inserting sp|Q92882|OSTF1_HUMAN
15 Dec 2023 01:55:29,435 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:29,435 INFO : Inserting sp|Q92896|GSLG1_HUMAN
15 Dec 2023 01:55:29,476 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:29,476 INFO : Inserting sp|Q92911|SC5A5_HUMAN
15 Dec 2023 01:55:29,532 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:29,532 INFO : Inserting sp|Q92954|PRG4_HUMAN
15 Dec 2023 01:55:30,030 DEBUG: Total peptides inserted: 30
15 Dec 2023 01:55:30,030 INFO : Inserting sp|Q93009|UBP7_HUMAN
15 Dec 2023 01:55:30,054 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,054 INFO : Inserting sp|Q93063|EXT2_HUMAN
15 Dec 2023 01:55:30,132 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:30,132 INFO : Inserting sp|Q93077|H2A1C_HUMAN
15 Dec 2023 01:55:30,222 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:30,222 INFO : Inserting sp|Q93079|H2B1H_HUMAN
15 Dec 2023 01:55:30,330 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:30,330 INFO : Inserting sp|Q93084|AT2A3_HUMAN
15 Dec 2023 01:55:30,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,355 INFO : Inserting sp|Q93091|RNAS6_HUMAN
15 Dec 2023 01:55:30,405 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:30,405 INFO : Inserting sp|Q93097|WNT2B_HUMAN
15 Dec 2023 01:55:30,423 INFO : 88% Done
15 Dec 2023 01:55:30,433 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:30,433 INFO : Inserting sp|Q969P0|IGSF8_HUMAN
15 Dec 2023 01:55:30,557 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:30,557 INFO : Inserting sp|Q969T9|WBP2_HUMAN
15 Dec 2023 01:55:30,580 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,580 INFO : Inserting sp|Q96A72|MGN2_HUMAN
15 Dec 2023 01:55:30,601 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,602 INFO : Inserting sp|Q96AP7|ESAM_HUMAN
15 Dec 2023 01:55:30,616 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,616 INFO : Inserting sp|Q96BZ4|PLD4_HUMAN
15 Dec 2023 01:55:30,641 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,641 INFO : Inserting sp|Q96C23|GALM_HUMAN
15 Dec 2023 01:55:30,670 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,671 INFO : Inserting sp|Q96C24|SYTL4_HUMAN
15 Dec 2023 01:55:30,796 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:30,796 INFO : Inserting sp|Q96CG8|CTHR1_HUMAN
15 Dec 2023 01:55:30,815 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,815 INFO : Inserting sp|Q96DR5|BPIA2_HUMAN
15 Dec 2023 01:55:30,840 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,840 INFO : Inserting sp|Q96E17|RAB3C_HUMAN
15 Dec 2023 01:55:30,876 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:30,876 INFO : Inserting sp|Q96F07|CYFP2_HUMAN
15 Dec 2023 01:55:30,922 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:30,923 INFO : Inserting sp|Q96F85|CNRP1_HUMAN
15 Dec 2023 01:55:30,936 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:30,937 INFO : Inserting sp|Q96FE7|P3IP1_HUMAN
15 Dec 2023 01:55:30,965 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:30,965 INFO : Inserting sp|Q96FW1|OTUB1_HUMAN
15 Dec 2023 01:55:31,070 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:31,070 INFO : Inserting sp|Q96G03|PGM2_HUMAN
15 Dec 2023 01:55:31,323 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:31,324 INFO : Inserting sp|Q96GG9|DCNL1_HUMAN
15 Dec 2023 01:55:31,355 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:31,355 INFO : Inserting sp|Q96GW7|PGCB_HUMAN
15 Dec 2023 01:55:31,482 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:31,482 INFO : Inserting sp|Q96HD1|CREL1_HUMAN
15 Dec 2023 01:55:31,514 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:31,514 INFO : Inserting sp|Q96HR3|MED30_HUMAN
15 Dec 2023 01:55:31,560 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:31,560 INFO : Inserting sp|Q96IU4|ABHEB_HUMAN
15 Dec 2023 01:55:31,646 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:31,646 INFO : Inserting sp|Q96IY4|CBPB2_HUMAN
15 Dec 2023 01:55:32,234 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:55:32,235 INFO : Inserting sp|Q96KG7|MEG10_HUMAN
15 Dec 2023 01:55:32,273 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:32,273 INFO : Inserting sp|Q96KK5|H2A1H_HUMAN
15 Dec 2023 01:55:32,368 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:32,368 INFO : Inserting sp|Q96KN2|CNDP1_HUMAN
15 Dec 2023 01:55:33,186 DEBUG: Total peptides inserted: 36
15 Dec 2023 01:55:33,186 INFO : Inserting sp|Q96KP4|CNDP2_HUMAN
15 Dec 2023 01:55:33,357 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:33,357 INFO : Inserting sp|Q96LB3|IFT74_HUMAN
15 Dec 2023 01:55:33,392 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:33,393 INFO : Inserting sp|Q96LC7|SIG10_HUMAN
15 Dec 2023 01:55:33,408 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:33,409 INFO : Inserting sp|Q96MM3|ZFP42_HUMAN
15 Dec 2023 01:55:33,436 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:33,436 INFO : Inserting sp|Q96PD5|PGRP2_HUMAN
15 Dec 2023 01:55:34,274 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:55:34,275 INFO : Inserting sp|Q96Q15|SMG1_HUMAN
15 Dec 2023 01:55:34,312 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:34,312 INFO : Inserting sp|Q96Q89|KI20B_HUMAN
15 Dec 2023 01:55:34,335 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:34,335 INFO : Inserting sp|Q96QC0|PP1RA_HUMAN
15 Dec 2023 01:55:34,349 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:34,349 INFO : Inserting sp|Q96QK1|VPS35_HUMAN
15 Dec 2023 01:55:34,500 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:34,500 INFO : Inserting sp|Q99435|NELL2_HUMAN
15 Dec 2023 01:55:34,508 INFO : 89% Done
15 Dec 2023 01:55:34,982 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:55:34,982 INFO : Inserting sp|Q99436|PSB7_HUMAN
15 Dec 2023 01:55:35,102 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:35,102 INFO : Inserting sp|Q99439|CNN2_HUMAN
15 Dec 2023 01:55:35,151 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:35,151 INFO : Inserting sp|Q99453|PHX2B_HUMAN
15 Dec 2023 01:55:35,168 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,168 INFO : Inserting sp|Q99471|PFD5_HUMAN
15 Dec 2023 01:55:35,196 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,196 INFO : Inserting sp|Q99497|PARK7_HUMAN
15 Dec 2023 01:55:35,411 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:35,411 INFO : Inserting sp|Q99519|NEUR1_HUMAN
15 Dec 2023 01:55:35,480 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:35,480 INFO : Inserting sp|Q99538|LGMN_HUMAN
15 Dec 2023 01:55:35,613 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:35,613 INFO : Inserting sp|Q99574|NEUS_HUMAN
15 Dec 2023 01:55:35,765 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:35,765 INFO : Inserting sp|Q99590|SCAFB_HUMAN
15 Dec 2023 01:55:35,769 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,769 INFO : Inserting sp|Q99598|TSNAX_HUMAN
15 Dec 2023 01:55:35,793 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,793 INFO : Inserting sp|Q99623|PHB2_HUMAN
15 Dec 2023 01:55:35,830 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,830 INFO : Inserting sp|Q99650|OSMR_HUMAN
15 Dec 2023 01:55:35,845 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:35,845 INFO : Inserting sp|Q99784|NOE1_HUMAN
15 Dec 2023 01:55:36,045 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:36,045 INFO : Inserting sp|Q99829|CPNE1_HUMAN
15 Dec 2023 01:55:36,057 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:36,057 INFO : Inserting sp|Q99832|TCPH_HUMAN
15 Dec 2023 01:55:36,201 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:36,201 INFO : Inserting sp|Q99877|H2B1N_HUMAN
15 Dec 2023 01:55:36,305 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:36,305 INFO : Inserting sp|Q99878|H2A1J_HUMAN
15 Dec 2023 01:55:36,391 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:36,391 INFO : Inserting sp|Q99879|H2B1M_HUMAN
15 Dec 2023 01:55:36,493 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:36,494 INFO : Inserting sp|Q99880|H2B1L_HUMAN
15 Dec 2023 01:55:36,598 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:36,598 INFO : Inserting sp|Q99932|SPAG8_HUMAN
15 Dec 2023 01:55:36,611 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:36,611 INFO : Inserting sp|Q99963|SH3G3_HUMAN
15 Dec 2023 01:55:36,646 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:36,646 INFO : Inserting sp|Q99969|RARR2_HUMAN
15 Dec 2023 01:55:36,763 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:36,764 INFO : Imported 1500 peptide groups.
15 Dec 2023 01:55:36,764 INFO : Inserting sp|Q99983|OMD_HUMAN
15 Dec 2023 01:55:36,829 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:36,829 INFO : Inserting sp|Q99996|AKAP9_HUMAN
15 Dec 2023 01:55:36,858 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:36,858 INFO : Inserting sp|Q9BQ16|TICN3_HUMAN
15 Dec 2023 01:55:36,909 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:36,909 INFO : Inserting sp|Q9BQ51|PD1L2_HUMAN
15 Dec 2023 01:55:36,935 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:36,935 INFO : Inserting sp|Q9BQE3|TBA1C_HUMAN
15 Dec 2023 01:55:37,184 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:37,184 INFO : Inserting sp|Q9BQT9|CSTN3_HUMAN
15 Dec 2023 01:55:37,208 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:37,208 INFO : Inserting sp|Q9BRA2|TXD17_HUMAN
15 Dec 2023 01:55:37,262 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:37,262 INFO : Inserting sp|Q9BRF8|CPPED_HUMAN
15 Dec 2023 01:55:37,347 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:37,347 INFO : Inserting sp|Q9BRK3|MXRA8_HUMAN
15 Dec 2023 01:55:37,395 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:37,395 INFO : Inserting sp|Q9BRK5|CAB45_HUMAN
15 Dec 2023 01:55:37,449 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:37,449 INFO : Inserting sp|Q9BRL6|SRSF8_HUMAN
15 Dec 2023 01:55:37,462 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:37,462 INFO : Inserting sp|Q9BS40|LXN_HUMAN
15 Dec 2023 01:55:37,530 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:37,530 INFO : Inserting sp|Q9BTT0|AN32E_HUMAN
15 Dec 2023 01:55:37,672 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:37,672 INFO : Inserting sp|Q9BTV5|FSD1_HUMAN
15 Dec 2023 01:55:37,693 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:37,693 INFO : Inserting sp|Q9BTY2|FUCO2_HUMAN
15 Dec 2023 01:55:37,788 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:37,788 INFO : Inserting sp|Q9BUF5|TBB6_HUMAN
15 Dec 2023 01:55:37,959 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:37,959 INFO : Inserting sp|Q9BWD1|THIC_HUMAN
15 Dec 2023 01:55:38,006 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:38,006 INFO : Inserting sp|Q9BWP8|COL11_HUMAN
15 Dec 2023 01:55:38,114 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:38,114 INFO : Inserting sp|Q9BX79|STRA6_HUMAN
15 Dec 2023 01:55:38,138 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:38,138 INFO : Inserting sp|Q9BXR6|FHR5_HUMAN
15 Dec 2023 01:55:38,227 INFO : 90% Done
15 Dec 2023 01:55:38,526 DEBUG: Total peptides inserted: 22
15 Dec 2023 01:55:38,526 INFO : Inserting sp|Q9BXX0|EMIL2_HUMAN
15 Dec 2023 01:55:38,642 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:38,642 INFO : Inserting sp|Q9BY66|KDM5D_HUMAN
15 Dec 2023 01:55:38,754 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:38,754 INFO : Inserting sp|Q9BY67|CADM1_HUMAN
15 Dec 2023 01:55:38,858 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:38,858 INFO : Inserting sp|Q9BYH1|SE6L1_HUMAN
15 Dec 2023 01:55:38,883 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:38,883 INFO : Inserting sp|Q9BYV7|BCDO2_HUMAN
15 Dec 2023 01:55:38,897 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:38,897 INFO : Inserting sp|Q9BZQ8|NIBA1_HUMAN
15 Dec 2023 01:55:38,956 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:38,956 INFO : Inserting sp|Q9C0C9|UBE2O_HUMAN
15 Dec 2023 01:55:39,069 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:39,069 INFO : Inserting sp|Q9GZS3|SKI8_HUMAN
15 Dec 2023 01:55:39,096 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,096 INFO : Inserting sp|Q9GZT8|NIF3L_HUMAN
15 Dec 2023 01:55:39,160 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:39,160 INFO : Inserting sp|Q9GZX9|TWSG1_HUMAN
15 Dec 2023 01:55:39,183 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,183 INFO : Inserting sp|Q9GZZ8|LACRT_HUMAN
15 Dec 2023 01:55:39,197 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,197 INFO : Inserting sp|Q9H008|LHPP_HUMAN
15 Dec 2023 01:55:39,220 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,220 INFO : Inserting sp|Q9H0E2|TOLIP_HUMAN
15 Dec 2023 01:55:39,244 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,244 INFO : Inserting sp|Q9H0J4|QRIC2_HUMAN
15 Dec 2023 01:55:39,267 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,267 INFO : Inserting sp|Q9H0Q3|FXYD6_HUMAN
15 Dec 2023 01:55:39,290 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,290 INFO : Inserting sp|Q9H0U4|RAB1B_HUMAN
15 Dec 2023 01:55:39,382 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:39,382 INFO : Inserting sp|Q9H254|SPTN4_HUMAN
15 Dec 2023 01:55:39,470 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:39,470 INFO : Inserting sp|Q9H269|VPS16_HUMAN
15 Dec 2023 01:55:39,524 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:39,524 INFO : Inserting sp|Q9H299|SH3L3_HUMAN
15 Dec 2023 01:55:39,667 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:39,668 INFO : Inserting sp|Q9H2A7|CXL16_HUMAN
15 Dec 2023 01:55:39,708 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:39,708 INFO : Inserting sp|Q9H2U2|IPYR2_HUMAN
15 Dec 2023 01:55:39,732 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:39,732 INFO : Inserting sp|Q9H3K6|BOLA2_HUMAN
15 Dec 2023 01:55:39,804 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:39,804 INFO : Inserting sp|Q9H3S1|SEM4A_HUMAN
15 Dec 2023 01:55:39,858 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:39,858 INFO : Inserting sp|Q9H479|FN3K_HUMAN
15 Dec 2023 01:55:39,914 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:39,914 INFO : Inserting sp|Q9H4A9|DPEP2_HUMAN
15 Dec 2023 01:55:40,118 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:40,118 INFO : Inserting sp|Q9H4B7|TBB1_HUMAN
15 Dec 2023 01:55:40,459 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:55:40,459 INFO : Inserting sp|Q9H4G4|GAPR1_HUMAN
15 Dec 2023 01:55:40,518 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:40,518 INFO : Inserting sp|Q9H4M9|EHD1_HUMAN
15 Dec 2023 01:55:40,671 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:40,671 INFO : Inserting sp|Q9H7C4|SYNCI_HUMAN
15 Dec 2023 01:55:40,699 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:40,699 INFO : Inserting sp|Q9H8L6|MMRN2_HUMAN
15 Dec 2023 01:55:40,781 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:40,781 INFO : Inserting sp|Q9H8S9|MOB1A_HUMAN
15 Dec 2023 01:55:40,828 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:40,828 INFO : Inserting sp|Q9HA38|ZMAT3_HUMAN
15 Dec 2023 01:55:40,857 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:40,857 INFO : Inserting sp|Q9HAT2|SIAE_HUMAN
15 Dec 2023 01:55:40,944 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:40,944 INFO : Inserting sp|Q9HBI1|PARVB_HUMAN
15 Dec 2023 01:55:41,056 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:41,057 INFO : Inserting sp|Q9HC35|EMAL4_HUMAN
15 Dec 2023 01:55:41,081 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,081 INFO : Inserting sp|Q9HCB6|SPON1_HUMAN
15 Dec 2023 01:55:41,106 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,107 INFO : Inserting sp|Q9HCD6|TANC2_HUMAN
15 Dec 2023 01:55:41,148 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:41,148 INFO : Inserting sp|Q9HD89|RETN_HUMAN
15 Dec 2023 01:55:41,252 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:41,252 INFO : Inserting sp|Q9HDC9|APMAP_HUMAN
15 Dec 2023 01:55:41,383 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:41,383 INFO : Inserting sp|Q9NPA0|EMC7_HUMAN
15 Dec 2023 01:55:41,397 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,397 INFO : Inserting sp|Q9NPH3|IL1AP_HUMAN
15 Dec 2023 01:55:41,568 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:41,568 INFO : Inserting sp|Q9NPY3|C1QR1_HUMAN
15 Dec 2023 01:55:41,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,592 INFO : Inserting sp|Q9NQ79|CRAC1_HUMAN
15 Dec 2023 01:55:41,903 INFO : 91% Done
15 Dec 2023 01:55:41,912 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:55:41,913 INFO : Inserting sp|Q9NQC3|RTN4_HUMAN
15 Dec 2023 01:55:41,936 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,936 INFO : Inserting sp|Q9NQH7|XPP3_HUMAN
15 Dec 2023 01:55:41,959 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,959 INFO : Inserting sp|Q9NQR4|NIT2_HUMAN
15 Dec 2023 01:55:41,973 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,973 INFO : Inserting sp|Q9NQX5|NPDC1_HUMAN
15 Dec 2023 01:55:41,998 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:41,998 INFO : Inserting sp|Q9NR34|MA1C1_HUMAN
15 Dec 2023 01:55:42,020 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,020 INFO : Inserting sp|Q9NR45|SIAS_HUMAN
15 Dec 2023 01:55:42,045 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,045 INFO : Inserting sp|Q9NR99|MXRA5_HUMAN
15 Dec 2023 01:55:42,068 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,068 INFO : Inserting sp|Q9NRX4|PHP14_HUMAN
15 Dec 2023 01:55:42,088 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,088 INFO : Inserting sp|Q9NSB4|KRT82_HUMAN
15 Dec 2023 01:55:42,102 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,102 INFO : Inserting sp|Q9NSV4|DIAP3_HUMAN
15 Dec 2023 01:55:42,125 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,125 INFO : Inserting sp|Q9NT62|ATG3_HUMAN
15 Dec 2023 01:55:42,153 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,153 INFO : Inserting sp|Q9NT99|LRC4B_HUMAN
15 Dec 2023 01:55:42,232 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:42,232 INFO : Inserting sp|Q9NTK5|OLA1_HUMAN
15 Dec 2023 01:55:42,348 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:42,348 INFO : Inserting sp|Q9NUJ1|ABHDA_HUMAN
15 Dec 2023 01:55:42,376 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,376 INFO : Inserting sp|Q9NUQ9|CYRIB_HUMAN
15 Dec 2023 01:55:42,461 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:42,462 INFO : Inserting sp|Q9NVD3|SETD4_HUMAN
15 Dec 2023 01:55:42,496 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,496 INFO : Inserting sp|Q9NX46|ADPRS_HUMAN
15 Dec 2023 01:55:42,524 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,524 INFO : Inserting sp|Q9NXC2|GFOD1_HUMAN
15 Dec 2023 01:55:42,539 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,539 INFO : Inserting sp|Q9NY15|STAB1_HUMAN
15 Dec 2023 01:55:42,571 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,571 INFO : Inserting sp|Q9NY33|DPP3_HUMAN
15 Dec 2023 01:55:42,684 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:42,684 INFO : Inserting sp|Q9NY97|B3GN2_HUMAN
15 Dec 2023 01:55:42,803 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:42,804 INFO : Inserting sp|Q9NZ08|ERAP1_HUMAN
15 Dec 2023 01:55:42,854 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:42,854 INFO : Inserting sp|Q9NZC2|TREM2_HUMAN
15 Dec 2023 01:55:42,882 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:42,882 INFO : Inserting sp|Q9NZK5|ADA2_HUMAN
15 Dec 2023 01:55:43,233 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:55:43,233 INFO : Inserting sp|Q9NZL9|MAT2B_HUMAN
15 Dec 2023 01:55:43,271 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:43,271 INFO : Inserting sp|Q9NZP8|C1RL_HUMAN
15 Dec 2023 01:55:43,610 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:55:43,610 INFO : Inserting sp|Q9NZR2|LRP1B_HUMAN
15 Dec 2023 01:55:43,685 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:43,685 INFO : Inserting sp|Q9P121|NTRI_HUMAN
15 Dec 2023 01:55:43,842 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:43,842 INFO : Inserting sp|Q9P232|CNTN3_HUMAN
15 Dec 2023 01:55:43,885 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:43,885 INFO : Inserting sp|Q9P258|RCC2_HUMAN
15 Dec 2023 01:55:43,934 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:43,935 INFO : Inserting sp|Q9P2B2|FPRP_HUMAN
15 Dec 2023 01:55:43,958 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:43,958 INFO : Inserting sp|Q9P2J5|SYLC_HUMAN
15 Dec 2023 01:55:43,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:43,982 INFO : Inserting sp|Q9P2S2|NRX2A_HUMAN
15 Dec 2023 01:55:44,078 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:44,078 INFO : Inserting sp|Q9UBG0|MRC2_HUMAN
15 Dec 2023 01:55:44,229 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:44,229 INFO : Inserting sp|Q9UBP4|DKK3_HUMAN
15 Dec 2023 01:55:44,538 DEBUG: Total peptides inserted: 15
15 Dec 2023 01:55:44,538 INFO : Inserting sp|Q9UBQ0|VPS29_HUMAN
15 Dec 2023 01:55:44,560 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:44,560 INFO : Inserting sp|Q9UBQ6|EXTL2_HUMAN
15 Dec 2023 01:55:44,627 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:44,627 INFO : Imported 1600 peptide groups.
15 Dec 2023 01:55:44,627 INFO : Inserting sp|Q9UBQ7|GRHPR_HUMAN
15 Dec 2023 01:55:44,658 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:44,658 INFO : Inserting sp|Q9UBR2|CATZ_HUMAN
15 Dec 2023 01:55:44,758 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:44,758 INFO : Inserting sp|Q9UBS4|DJB11_HUMAN
15 Dec 2023 01:55:44,772 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:44,772 INFO : Inserting sp|Q9UBW5|BIN2_HUMAN
15 Dec 2023 01:55:44,849 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:44,849 INFO : Inserting sp|Q9UBX1|CATF_HUMAN
15 Dec 2023 01:55:44,916 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:44,916 INFO : Inserting sp|Q9UBX5|FBLN5_HUMAN
15 Dec 2023 01:55:44,950 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:44,951 INFO : Inserting sp|Q9UBX7|KLK11_HUMAN
15 Dec 2023 01:55:45,005 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:45,005 INFO : Inserting sp|Q9UDY4|DNJB4_HUMAN
15 Dec 2023 01:55:45,048 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:45,048 INFO : Inserting sp|Q9UEW3|MARCO_HUMAN
15 Dec 2023 01:55:45,119 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:45,119 INFO : Inserting sp|Q9UGJ0|AAKG2_HUMAN
15 Dec 2023 01:55:45,141 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:45,141 INFO : Inserting sp|Q9UGM5|FETUB_HUMAN
15 Dec 2023 01:55:45,416 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:45,416 INFO : Inserting sp|Q9UGN4|CLM8_HUMAN
15 Dec 2023 01:55:45,441 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:45,441 INFO : Inserting sp|Q9UHG2|PCS1N_HUMAN
15 Dec 2023 01:55:45,557 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:45,557 INFO : Inserting sp|Q9UHG3|PCYOX_HUMAN
15 Dec 2023 01:55:45,569 INFO : 92% Done
15 Dec 2023 01:55:46,067 DEBUG: Total peptides inserted: 24
15 Dec 2023 01:55:46,067 INFO : Inserting sp|Q9UHL4|DPP2_HUMAN
15 Dec 2023 01:55:46,238 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:46,238 INFO : Inserting sp|Q9UHV7|MED13_HUMAN
15 Dec 2023 01:55:46,263 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:46,264 INFO : Inserting sp|Q9UI42|CBPA4_HUMAN
15 Dec 2023 01:55:46,310 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:46,310 INFO : Inserting sp|Q9UIA9|XPO7_HUMAN
15 Dec 2023 01:55:46,406 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:46,406 INFO : Inserting sp|Q9UIB8|SLAF5_HUMAN
15 Dec 2023 01:55:46,461 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:46,461 INFO : Inserting sp|Q9UJ68|MSRA_HUMAN
15 Dec 2023 01:55:46,509 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:46,509 INFO : Inserting sp|Q9UJ70|NAGK_HUMAN
15 Dec 2023 01:55:46,676 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:46,676 INFO : Inserting sp|Q9UJJ9|GNPTG_HUMAN
15 Dec 2023 01:55:46,769 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:46,769 INFO : Inserting sp|Q9UJU6|DBNL_HUMAN
15 Dec 2023 01:55:46,857 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:46,857 INFO : Inserting sp|Q9UK55|ZPI_HUMAN
15 Dec 2023 01:55:47,513 DEBUG: Total peptides inserted: 29
15 Dec 2023 01:55:47,513 INFO : Inserting sp|Q9UKE5|TNIK_HUMAN
15 Dec 2023 01:55:47,528 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:47,528 INFO : Inserting sp|Q9UKJ1|PILRA_HUMAN
15 Dec 2023 01:55:47,541 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:47,541 INFO : Inserting sp|Q9UKU6|TRHDE_HUMAN
15 Dec 2023 01:55:47,696 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:47,696 INFO : Inserting sp|Q9UL25|RAB21_HUMAN
15 Dec 2023 01:55:47,710 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:47,710 INFO : Inserting sp|Q9UL46|PSME2_HUMAN
15 Dec 2023 01:55:47,849 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:47,849 INFO : Inserting sp|Q9ULB1|NRX1A_HUMAN
15 Dec 2023 01:55:47,940 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:47,940 INFO : Inserting sp|Q9ULC4|MCTS1_HUMAN
15 Dec 2023 01:55:47,963 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:47,963 INFO : Inserting sp|Q9ULT8|HECD1_HUMAN
15 Dec 2023 01:55:48,023 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:48,024 INFO : Inserting sp|Q9ULV4|COR1C_HUMAN
15 Dec 2023 01:55:48,113 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:48,113 INFO : Inserting sp|Q9ULZ3|ASC_HUMAN
15 Dec 2023 01:55:48,239 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:48,239 INFO : Inserting sp|Q9UM07|PADI4_HUMAN
15 Dec 2023 01:55:48,454 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:48,454 INFO : Inserting sp|Q9UMX5|NENF_HUMAN
15 Dec 2023 01:55:48,502 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:48,502 INFO : Inserting sp|Q9UNN8|EPCR_HUMAN
15 Dec 2023 01:55:48,645 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:48,645 INFO : Inserting sp|Q9UNW1|MINP1_HUMAN
15 Dec 2023 01:55:48,949 DEBUG: Total peptides inserted: 13
15 Dec 2023 01:55:48,949 INFO : Inserting sp|Q9UNZ2|NSF1C_HUMAN
15 Dec 2023 01:55:49,006 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:49,006 INFO : Inserting sp|Q9UQ07|MOK_HUMAN
15 Dec 2023 01:55:49,042 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:49,042 INFO : Inserting sp|Q9UQ80|PA2G4_HUMAN
15 Dec 2023 01:55:49,208 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:55:49,208 INFO : Inserting sp|Q9UQB8|BAIP2_HUMAN
15 Dec 2023 01:55:49,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,232 INFO : Inserting sp|Q9UQE7|SMC3_HUMAN
15 Dec 2023 01:55:49,259 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,259 INFO : Inserting sp|Q9UQK1|PPR3C_HUMAN
15 Dec 2023 01:55:49,273 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,273 INFO : Inserting sp|Q9Y243|AKT3_HUMAN
15 Dec 2023 01:55:49,287 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,287 INFO : Inserting sp|Q9Y253|POLH_HUMAN
15 Dec 2023 01:55:49,309 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,309 INFO : Inserting sp|Q9Y277|VDAC3_HUMAN
15 Dec 2023 01:55:49,318 INFO : 93% Done
15 Dec 2023 01:55:49,338 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,338 INFO : Inserting sp|Q9Y279|VSIG4_HUMAN
15 Dec 2023 01:55:49,466 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:49,466 INFO : Inserting sp|Q9Y287|ITM2B_HUMAN
15 Dec 2023 01:55:49,500 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:49,500 INFO : Inserting sp|Q9Y2B0|CNPY2_HUMAN
15 Dec 2023 01:55:49,528 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,528 INFO : Inserting sp|Q9Y2K3|MYH15_HUMAN
15 Dec 2023 01:55:49,553 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,553 INFO : Inserting sp|Q9Y2Q3|GSTK1_HUMAN
15 Dec 2023 01:55:49,578 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,578 INFO : Inserting sp|Q9Y2Q5|LTOR2_HUMAN
15 Dec 2023 01:55:49,604 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,604 INFO : Inserting sp|Q9Y2V0|CDIN1_HUMAN
15 Dec 2023 01:55:49,618 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,618 INFO : Inserting sp|Q9Y2V2|CHSP1_HUMAN
15 Dec 2023 01:55:49,671 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:49,671 INFO : Inserting sp|Q9Y2X8|UB2D4_HUMAN
15 Dec 2023 01:55:49,695 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,695 INFO : Inserting sp|Q9Y315|DEOC_HUMAN
15 Dec 2023 01:55:49,718 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,718 INFO : Inserting sp|Q9Y376|CAB39_HUMAN
15 Dec 2023 01:55:49,772 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:49,772 INFO : Inserting sp|Q9Y3I1|FBX7_HUMAN
15 Dec 2023 01:55:49,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,800 INFO : Inserting sp|Q9Y473|ZN175_HUMAN
15 Dec 2023 01:55:49,825 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:49,825 INFO : Inserting sp|Q9Y490|TLN1_HUMAN
15 Dec 2023 01:55:50,796 DEBUG: Inserted 50 peptides
15 Dec 2023 01:55:51,670 DEBUG: Total peptides inserted: 88
15 Dec 2023 01:55:51,670 INFO : Inserting sp|Q9Y4C0|NRX3A_HUMAN
15 Dec 2023 01:55:51,770 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:51,770 INFO : Inserting sp|Q9Y4E8|UBP15_HUMAN
15 Dec 2023 01:55:51,851 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:51,851 INFO : Inserting sp|Q9Y4G6|TLN2_HUMAN
15 Dec 2023 01:55:52,170 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:55:52,170 INFO : Inserting sp|Q9Y4L1|HYOU1_HUMAN
15 Dec 2023 01:55:52,362 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:52,362 INFO : Inserting sp|Q9Y5C1|ANGL3_HUMAN
15 Dec 2023 01:55:52,498 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:52,498 INFO : Inserting sp|Q9Y5Y7|LYVE1_HUMAN
15 Dec 2023 01:55:52,679 DEBUG: Total peptides inserted: 11
15 Dec 2023 01:55:52,679 INFO : Inserting sp|Q9Y5Z4|HEBP2_HUMAN
15 Dec 2023 01:55:52,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:52,716 INFO : Inserting sp|Q9Y608|LRRF2_HUMAN
15 Dec 2023 01:55:52,761 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:52,761 INFO : Inserting sp|Q9Y646|CBPQ_HUMAN
15 Dec 2023 01:55:52,916 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:52,916 INFO : Inserting sp|Q9Y696|CLIC4_HUMAN
15 Dec 2023 01:55:52,982 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:52,982 INFO : Inserting sp|Q9Y6K9|NEMO_HUMAN
15 Dec 2023 01:55:53,000 INFO : 94% Done
15 Dec 2023 01:55:53,044 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:53,044 INFO : Inserting sp|Q9Y6N5|SQOR_HUMAN
15 Dec 2023 01:55:53,068 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:53,068 INFO : Inserting sp|Q9Y6N7|ROBO1_HUMAN
15 Dec 2023 01:55:53,104 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:53,104 INFO : Inserting sp|Q9Y6R7|FCGBP_HUMAN
15 Dec 2023 01:55:54,316 DEBUG: Inserted 50 peptides
15 Dec 2023 01:55:55,624 DEBUG: Inserted 100 peptides
15 Dec 2023 01:55:55,839 DEBUG: Total peptides inserted: 111
15 Dec 2023 01:55:55,839 INFO : Inserting sp|Q9Y6Z7|COL10_HUMAN
15 Dec 2023 01:55:55,924 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:55,924 INFO : Inserting sp|A0A075B6Q5|HV364_HUMAN
15 Dec 2023 01:55:56,029 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:56,029 INFO : Inserting sp|A0A075B6R2|HV404_HUMAN
15 Dec 2023 01:55:56,070 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:56,070 INFO : Inserting sp|A0A087WSY4|HV432_HUMAN
15 Dec 2023 01:55:56,124 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:56,124 INFO : Inserting sp|A0A0A0MS14|HV145_HUMAN
15 Dec 2023 01:55:56,141 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:56,141 INFO : Inserting sp|A0A0A0MS15|HV349_HUMAN
15 Dec 2023 01:55:56,207 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:56,207 INFO : Inserting sp|A0A0B4J1U7|HV601_HUMAN
15 Dec 2023 01:55:56,253 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:56,254 INFO : Inserting sp|A0A0B4J1V0|HV315_HUMAN
15 Dec 2023 01:55:56,390 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:56,390 INFO : Inserting sp|A0A0B4J1V2|HV226_HUMAN
15 Dec 2023 01:55:56,449 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:56,450 INFO : Inserting sp|A0A0B4J1V6|HV373_HUMAN
15 Dec 2023 01:55:56,502 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:56,502 INFO : Inserting sp|A0A0B4J1X5|HV374_HUMAN
15 Dec 2023 01:55:56,637 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:56,637 INFO : Inserting sp|A0A0B4J1X8|HV343_HUMAN
15 Dec 2023 01:55:56,755 INFO : 95% Done
15 Dec 2023 01:55:56,769 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:56,770 INFO : Inserting sp|A0A0B4J1Y9|HV372_HUMAN
15 Dec 2023 01:55:56,882 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:55:56,882 INFO : Inserting sp|A0A0B4J2H0|HV69D_HUMAN
15 Dec 2023 01:55:56,926 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:56,926 INFO : Inserting sp|A0A0C4DH29|HV103_HUMAN
15 Dec 2023 01:55:56,959 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:56,959 INFO : Inserting sp|A0A0C4DH30|HV316_HUMAN
15 Dec 2023 01:55:57,039 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:57,039 INFO : Inserting sp|A0A0C4DH31|HV118_HUMAN
15 Dec 2023 01:55:57,127 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:57,127 INFO : Inserting sp|A0A0C4DH32|HV320_HUMAN
15 Dec 2023 01:55:57,260 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:55:57,260 INFO : Inserting sp|A0A0C4DH33|HV124_HUMAN
15 Dec 2023 01:55:57,347 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:57,347 INFO : Inserting sp|A0A0C4DH34|HV428_HUMAN
15 Dec 2023 01:55:57,425 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:57,425 INFO : Inserting sp|A0A0C4DH35|HV335_HUMAN
15 Dec 2023 01:55:57,482 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:57,482 INFO : Inserting sp|A0A0C4DH36|HV338_HUMAN
15 Dec 2023 01:55:57,521 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:57,521 INFO : Inserting sp|A0A0C4DH38|HV551_HUMAN
15 Dec 2023 01:55:57,609 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:55:57,609 INFO : Inserting sp|A0A0J9YX35|HV64D_HUMAN
15 Dec 2023 01:55:57,691 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:57,691 INFO : Inserting sp|A0A0J9YXX1|HV5X1_HUMAN
15 Dec 2023 01:55:57,772 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:57,772 INFO : Imported 1700 peptide groups.
15 Dec 2023 01:55:57,772 INFO : Inserting sp|A0A8I5KQE6|RPSA2_HUMAN
15 Dec 2023 01:55:57,816 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:57,816 INFO : Inserting sp|A5A3E0|POTEF_HUMAN
15 Dec 2023 01:55:58,196 DEBUG: Total peptides inserted: 18
15 Dec 2023 01:55:58,196 INFO : Inserting sp|A5D6W6|FITM1_HUMAN
15 Dec 2023 01:55:58,225 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:58,225 INFO : Inserting sp|B2RXH8|HNRC2_HUMAN
15 Dec 2023 01:55:58,265 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:58,265 INFO : Inserting sp|B9A064|IGLL5_HUMAN
15 Dec 2023 01:55:58,546 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:55:58,546 INFO : Inserting sp|E9PAV3|NACAM_HUMAN
15 Dec 2023 01:55:58,570 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:58,570 INFO : Inserting sp|O60234|GMFG_HUMAN
15 Dec 2023 01:55:58,647 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:58,647 INFO : Inserting sp|O60279|SUSD5_HUMAN
15 Dec 2023 01:55:58,709 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:58,709 INFO : Inserting sp|O75678|RFPL2_HUMAN
15 Dec 2023 01:55:58,730 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:58,730 INFO : Inserting sp|O75711|SCRG1_HUMAN
15 Dec 2023 01:55:58,766 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:58,766 INFO : Inserting sp|O76009|KT33A_HUMAN
15 Dec 2023 01:55:58,828 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:58,828 INFO : Inserting sp|O94772|LY6H_HUMAN
15 Dec 2023 01:55:58,852 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:58,852 INFO : Inserting sp|O94903|PLPHP_HUMAN
15 Dec 2023 01:55:58,875 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:58,875 INFO : Inserting sp|O95336|6PGL_HUMAN
15 Dec 2023 01:55:58,974 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:55:58,975 INFO : Inserting sp|O95757|HS74L_HUMAN
15 Dec 2023 01:55:59,012 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:59,012 INFO : Inserting sp|P01599|KV117_HUMAN
15 Dec 2023 01:55:59,120 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:59,120 INFO : Inserting sp|P01601|KVD16_HUMAN
15 Dec 2023 01:55:59,144 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:59,144 INFO : Inserting sp|P01614|KVD40_HUMAN
15 Dec 2023 01:55:59,211 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:59,211 INFO : Inserting sp|P01624|KV315_HUMAN
15 Dec 2023 01:55:59,278 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:59,279 INFO : Inserting sp|P01703|LV140_HUMAN
15 Dec 2023 01:55:59,348 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:59,348 INFO : Inserting sp|P01714|LV319_HUMAN
15 Dec 2023 01:55:59,436 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:55:59,436 INFO : Inserting sp|P01718|LV327_HUMAN
15 Dec 2023 01:55:59,537 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:59,538 INFO : Inserting sp|P04211|LV743_HUMAN
15 Dec 2023 01:55:59,607 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:59,607 INFO : Inserting sp|P04430|KV116_HUMAN
15 Dec 2023 01:55:59,672 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:55:59,672 INFO : Inserting sp|P04432|KVD39_HUMAN
15 Dec 2023 01:55:59,778 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:59,778 INFO : Inserting sp|P04433|KV311_HUMAN
15 Dec 2023 01:55:59,879 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:59,879 INFO : Inserting sp|P06310|KV230_HUMAN
15 Dec 2023 01:55:59,960 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:55:59,960 INFO : Inserting sp|P07311|ACYP1_HUMAN
15 Dec 2023 01:55:59,991 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:55:59,991 INFO : Inserting sp|P09105|HBAT_HUMAN
15 Dec 2023 01:56:00,117 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:00,117 INFO : Inserting sp|P0DOX5|IGG1_HUMAN
15 Dec 2023 01:56:00,468 INFO : 96% Done
15 Dec 2023 01:56:00,663 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:56:00,663 INFO : Inserting sp|P0DP01|HV108_HUMAN
15 Dec 2023 01:56:00,688 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:00,688 INFO : Inserting sp|P0DP02|HVC33_HUMAN
15 Dec 2023 01:56:00,827 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:56:00,827 INFO : Inserting sp|P0DP03|HVC05_HUMAN
15 Dec 2023 01:56:01,003 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:56:01,003 INFO : Inserting sp|P0DP08|HVD82_HUMAN
15 Dec 2023 01:56:01,068 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:01,068 INFO : Inserting sp|P35542|SAA4_HUMAN
15 Dec 2023 01:56:01,202 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:56:01,202 INFO : Inserting sp|P47972|NPTX2_HUMAN
15 Dec 2023 01:56:01,216 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:01,216 INFO : Inserting sp|P49406|RM19_HUMAN
15 Dec 2023 01:56:01,237 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:01,237 INFO : Inserting sp|P55103|INHBC_HUMAN
15 Dec 2023 01:56:01,295 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:01,295 INFO : Inserting sp|P60983|GMFB_HUMAN
15 Dec 2023 01:56:01,344 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:01,344 INFO : Inserting sp|P80748|LV321_HUMAN
15 Dec 2023 01:56:01,394 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:01,394 INFO : Inserting sp|Q01459|DIAC_HUMAN
15 Dec 2023 01:56:01,676 DEBUG: Total peptides inserted: 19
15 Dec 2023 01:56:01,676 INFO : Inserting sp|Q01995|TAGL_HUMAN
15 Dec 2023 01:56:01,818 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:56:01,818 INFO : Inserting sp|Q06732|ZN33B_HUMAN
15 Dec 2023 01:56:01,880 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:01,880 INFO : Inserting sp|Q13103|SPP24_HUMAN
15 Dec 2023 01:56:01,946 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:01,947 INFO : Inserting sp|Q15404|RSU1_HUMAN
15 Dec 2023 01:56:01,992 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:01,992 INFO : Inserting sp|Q2TV78|MST1L_HUMAN
15 Dec 2023 01:56:02,308 DEBUG: Total peptides inserted: 16
15 Dec 2023 01:56:02,308 INFO : Inserting sp|Q562R1|ACTBL_HUMAN
15 Dec 2023 01:56:02,561 DEBUG: Total peptides inserted: 14
15 Dec 2023 01:56:02,561 INFO : Inserting sp|Q58FG1|HS904_HUMAN
15 Dec 2023 01:56:02,614 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:02,614 INFO : Inserting sp|Q5T013|HYI_HUMAN
15 Dec 2023 01:56:02,652 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:02,653 INFO : Inserting sp|Q5TEC6|H37_HUMAN
15 Dec 2023 01:56:02,706 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:02,706 INFO : Inserting sp|Q5VTE0|EF1A3_HUMAN
15 Dec 2023 01:56:02,811 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:02,811 INFO : Inserting sp|Q5VU97|CAHD1_HUMAN
15 Dec 2023 01:56:02,833 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:02,833 INFO : Inserting sp|Q5VW32|BROX_HUMAN
15 Dec 2023 01:56:02,870 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:02,870 INFO : Inserting sp|Q641Q3|METRL_HUMAN
15 Dec 2023 01:56:02,901 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:02,902 INFO : Inserting sp|Q68BL8|OLM2B_HUMAN
15 Dec 2023 01:56:02,946 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:02,946 INFO : Inserting sp|Q6B0K9|HBM_HUMAN
15 Dec 2023 01:56:03,084 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:03,084 INFO : Inserting sp|Q6S8J3|POTEE_HUMAN
15 Dec 2023 01:56:03,564 DEBUG: Total peptides inserted: 21
15 Dec 2023 01:56:03,564 INFO : Inserting sp|Q6UX73|CP089_HUMAN
15 Dec 2023 01:56:03,608 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:03,608 INFO : Inserting sp|Q6ZMR3|LDH6A_HUMAN
15 Dec 2023 01:56:03,676 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:03,676 INFO : Inserting sp|Q7Z7L7|ZER1_HUMAN
15 Dec 2023 01:56:03,714 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:03,714 INFO : Inserting sp|Q8IXS6|PALM2_HUMAN
15 Dec 2023 01:56:03,739 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:03,739 INFO : Inserting sp|Q8IZ83|A16A1_HUMAN
15 Dec 2023 01:56:03,784 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:03,784 INFO : Inserting sp|Q8N436|CPXM2_HUMAN
15 Dec 2023 01:56:03,859 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:03,859 INFO : Inserting sp|Q8N8A2|ANR44_HUMAN
15 Dec 2023 01:56:03,883 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:03,885 INFO : Inserting sp|Q8N8K9|K1958_HUMAN
15 Dec 2023 01:56:03,928 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:03,928 INFO : Inserting sp|Q8TBB5|KLDC4_HUMAN
15 Dec 2023 01:56:03,958 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:03,958 INFO : Inserting sp|Q8WUT4|LRRN4_HUMAN
15 Dec 2023 01:56:03,981 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:03,981 INFO : Inserting sp|Q93073|SBP2L_HUMAN
15 Dec 2023 01:56:04,005 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:04,005 INFO : Inserting sp|Q96C19|EFHD2_HUMAN
15 Dec 2023 01:56:04,111 INFO : 97% Done
15 Dec 2023 01:56:04,121 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:04,121 INFO : Inserting sp|Q96CX2|KCD12_HUMAN
15 Dec 2023 01:56:04,243 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:56:04,243 INFO : Inserting sp|Q96DA0|ZG16B_HUMAN
15 Dec 2023 01:56:04,291 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:04,291 INFO : Inserting sp|Q96J88|ESIP1_HUMAN
15 Dec 2023 01:56:04,318 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:04,318 INFO : Inserting sp|Q96S96|PEBP4_HUMAN
15 Dec 2023 01:56:04,401 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:04,401 INFO : Inserting sp|Q9BTM1|H2AJ_HUMAN
15 Dec 2023 01:56:04,495 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:04,495 INFO : Inserting sp|Q9BUN1|MENT_HUMAN
15 Dec 2023 01:56:04,543 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:04,543 INFO : Inserting sp|Q9BYX7|ACTBM_HUMAN
15 Dec 2023 01:56:04,666 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:04,666 INFO : Inserting sp|Q9GZP4|PITH1_HUMAN
15 Dec 2023 01:56:04,733 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:04,733 INFO : Inserting sp|Q9GZR7|DDX24_HUMAN
15 Dec 2023 01:56:04,747 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:04,747 INFO : Inserting sp|Q9H3G5|CPVL_HUMAN
15 Dec 2023 01:56:04,834 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:56:04,834 INFO : Inserting sp|Q9H4A4|AMPB_HUMAN
15 Dec 2023 01:56:04,953 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:04,953 INFO : Inserting sp|Q9HBR0|S38AA_HUMAN
15 Dec 2023 01:56:04,980 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:04,981 INFO : Inserting sp|Q9HC38|GLOD4_HUMAN
15 Dec 2023 01:56:05,145 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:56:05,145 INFO : Inserting sp|Q9NRN5|OLFL3_HUMAN
15 Dec 2023 01:56:05,280 DEBUG: Total peptides inserted: 7
15 Dec 2023 01:56:05,280 INFO : Inserting sp|Q9NRV9|HEBP1_HUMAN
15 Dec 2023 01:56:05,302 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,302 INFO : Inserting sp|Q9NW68|BSDC1_HUMAN
15 Dec 2023 01:56:05,324 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,325 INFO : Inserting sp|Q9NWV4|CZIB_HUMAN
15 Dec 2023 01:56:05,350 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,350 INFO : Inserting sp|Q9NZT2|OGFR_HUMAN
15 Dec 2023 01:56:05,373 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,374 INFO : Inserting sp|Q9UJW7|ZN229_HUMAN
15 Dec 2023 01:56:05,394 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,394 INFO : Inserting sp|A0A075B6H7|KV37_HUMAN
15 Dec 2023 01:56:05,443 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:05,443 INFO : Inserting sp|A0A075B6H9|LV469_HUMAN
15 Dec 2023 01:56:05,499 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:05,499 INFO : Inserting sp|A0A075B6I0|LV861_HUMAN
15 Dec 2023 01:56:05,540 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:05,541 INFO : Inserting sp|A0A075B6I9|LV746_HUMAN
15 Dec 2023 01:56:05,598 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:05,598 INFO : Inserting sp|A0A075B6K4|LV310_HUMAN
15 Dec 2023 01:56:05,682 DEBUG: Total peptides inserted: 5
15 Dec 2023 01:56:05,682 INFO : Inserting sp|A0A075B6K5|LV39_HUMAN
15 Dec 2023 01:56:05,759 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:05,760 INFO : Inserting sp|A0A075B6N3|TVBX1_HUMAN
15 Dec 2023 01:56:05,789 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,789 INFO : Inserting sp|A0A075B6R9|KVD24_HUMAN
15 Dec 2023 01:56:05,813 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:05,813 INFO : Inserting sp|A0A075B6S2|KVD29_HUMAN
15 Dec 2023 01:56:05,867 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:05,868 INFO : Inserting sp|A0A075B6S5|KV127_HUMAN
15 Dec 2023 01:56:05,983 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:05,984 INFO : Inserting sp|A0A075B6S9|KV137_HUMAN
15 Dec 2023 01:56:06,038 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:06,038 INFO : Inserting sp|A0A087WSX0|LV545_HUMAN
15 Dec 2023 01:56:06,066 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:06,066 INFO : Imported 1800 peptide groups.
15 Dec 2023 01:56:06,066 INFO : Inserting sp|A0A087WSY6|KVD15_HUMAN
15 Dec 2023 01:56:06,136 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:06,136 INFO : Inserting sp|A0A087WSZ0|KVD08_HUMAN
15 Dec 2023 01:56:06,167 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:06,167 INFO : Inserting sp|A0A087WW87|KV240_HUMAN
15 Dec 2023 01:56:06,244 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:06,244 INFO : Inserting sp|A0A0A0MT36|KVD21_HUMAN
15 Dec 2023 01:56:06,331 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:06,331 INFO : Inserting sp|A0A0B4J1U3|LV136_HUMAN
15 Dec 2023 01:56:06,392 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:06,393 INFO : Inserting sp|A0A0B4J1Y8|LV949_HUMAN
15 Dec 2023 01:56:06,458 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:06,458 INFO : Inserting sp|A0A0C4DH24|KV621_HUMAN
15 Dec 2023 01:56:06,520 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:06,520 INFO : Inserting sp|A0A0C4DH25|KVD20_HUMAN
15 Dec 2023 01:56:06,569 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:06,569 INFO : Inserting sp|A0A0C4DH67|KV108_HUMAN
15 Dec 2023 01:56:06,672 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:06,672 INFO : Inserting sp|A0A0C4DH68|KV224_HUMAN
15 Dec 2023 01:56:06,696 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:06,696 INFO : Inserting sp|A0A0C4DH73|KV112_HUMAN
15 Dec 2023 01:56:06,796 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:06,796 INFO : Inserting sp|A2NJV5|KV229_HUMAN
15 Dec 2023 01:56:06,850 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:06,850 INFO : Inserting sp|A6NES4|MRO2A_HUMAN
15 Dec 2023 01:56:06,874 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:06,874 INFO : Inserting sp|O14498|ISLR_HUMAN
15 Dec 2023 01:56:07,084 DEBUG: Total peptides inserted: 8
15 Dec 2023 01:56:07,084 INFO : Inserting sp|O43361|ZN749_HUMAN
15 Dec 2023 01:56:07,108 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:07,109 INFO : Inserting sp|O95502|NPTXR_HUMAN
15 Dec 2023 01:56:07,223 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:07,223 INFO : Inserting sp|P0CG39|POTEJ_HUMAN
15 Dec 2023 01:56:07,528 DEBUG: Total peptides inserted: 17
15 Dec 2023 01:56:07,529 INFO : Inserting sp|P0DOX2|IGA2_HUMAN
15 Dec 2023 01:56:07,743 DEBUG: Total peptides inserted: 9
15 Dec 2023 01:56:07,743 INFO : Inserting sp|P0DOX8|IGL1_HUMAN
15 Dec 2023 01:56:07,889 INFO : 98% Done
15 Dec 2023 01:56:08,012 DEBUG: Total peptides inserted: 10
15 Dec 2023 01:56:08,012 INFO : Inserting sp|P0DSN7|KVD37_HUMAN
15 Dec 2023 01:56:08,056 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,056 INFO : Inserting sp|P0DTE1|HV383_HUMAN
15 Dec 2023 01:56:08,115 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:08,115 INFO : Inserting sp|Q03938|ZNF90_HUMAN
15 Dec 2023 01:56:08,154 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,154 INFO : Inserting sp|Q15181|IPYR_HUMAN
15 Dec 2023 01:56:08,187 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,187 INFO : Inserting sp|Q1KMD3|HNRL2_HUMAN
15 Dec 2023 01:56:08,213 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,213 INFO : Inserting sp|Q30KQ8|DB112_HUMAN
15 Dec 2023 01:56:08,226 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,226 INFO : Inserting sp|Q3MIS6|ZN528_HUMAN
15 Dec 2023 01:56:08,246 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,246 INFO : Inserting sp|Q3ZCW2|LEGL_HUMAN
15 Dec 2023 01:56:08,267 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,267 INFO : Inserting sp|Q58FF6|H90B4_HUMAN
15 Dec 2023 01:56:08,345 DEBUG: Total peptides inserted: 4
15 Dec 2023 01:56:08,345 INFO : Inserting sp|Q5T9S5|CCD18_HUMAN
15 Dec 2023 01:56:08,385 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,385 INFO : Inserting sp|Q68DN1|CB016_HUMAN
15 Dec 2023 01:56:08,426 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,426 INFO : Inserting sp|Q6P3R8|NEK5_HUMAN
15 Dec 2023 01:56:08,471 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,471 INFO : Inserting sp|Q6TFL3|CC171_HUMAN
15 Dec 2023 01:56:08,497 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,497 INFO : Inserting sp|Q6UWF7|NXPE4_HUMAN
15 Dec 2023 01:56:08,509 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,509 INFO : Inserting sp|Q7Z5L0|VMO1_HUMAN
15 Dec 2023 01:56:08,530 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,530 INFO : Inserting sp|Q86XN6|ZN761_HUMAN
15 Dec 2023 01:56:08,569 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,569 INFO : Inserting sp|Q86XZ4|SPAS2_HUMAN
15 Dec 2023 01:56:08,592 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,592 INFO : Inserting sp|Q8IZ13|F200C_HUMAN
15 Dec 2023 01:56:08,619 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,619 INFO : Inserting sp|Q8NCR9|CLRN3_HUMAN
15 Dec 2023 01:56:08,646 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,646 INFO : Inserting sp|Q96E39|RMXL1_HUMAN
15 Dec 2023 01:56:08,668 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,668 INFO : Inserting sp|Q96EL2|RT24_HUMAN
15 Dec 2023 01:56:08,716 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,716 INFO : Inserting sp|Q96H40|ZN486_HUMAN
15 Dec 2023 01:56:08,729 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,729 INFO : Inserting sp|Q9BWW9|APOL5_HUMAN
15 Dec 2023 01:56:08,756 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,756 INFO : Inserting sp|Q9H0R4|HDHD2_HUMAN
15 Dec 2023 01:56:08,785 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,785 INFO : Inserting sp|Q9H4K1|RIBC2_HUMAN
15 Dec 2023 01:56:08,800 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,800 INFO : Inserting sp|Q9H6N6|MYH16_HUMAN
15 Dec 2023 01:56:08,840 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:08,840 INFO : Inserting sp|Q9P1Z9|CC180_HUMAN
15 Dec 2023 01:56:08,902 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:08,902 INFO : Inserting sp|Q9UJC5|SH3L2_HUMAN
15 Dec 2023 01:56:08,927 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,927 INFO : Inserting sp|Q9UKY7|CDV3_HUMAN
15 Dec 2023 01:56:08,949 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,949 INFO : Inserting sp|Q9UL59|ZN214_HUMAN
15 Dec 2023 01:56:08,976 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:08,976 INFO : Inserting sp|Q9Y2G7|ZFP30_HUMAN
15 Dec 2023 01:56:09,019 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:09,020 INFO : Inserting sp|Q9Y2H5|PKHA6_HUMAN
15 Dec 2023 01:56:09,033 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,033 INFO : Inserting sp|Q9Y485|DMXL1_HUMAN
15 Dec 2023 01:56:09,059 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,059 INFO : Inserting sp|A0A096LNW5|NT2NR_HUMAN
15 Dec 2023 01:56:09,073 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,074 INFO : Inserting sp|A0A0A0MT76|LJ01_HUMAN
15 Dec 2023 01:56:09,098 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,098 INFO : Inserting sp|A0A3B3IRV3|MCTS2_HUMAN
15 Dec 2023 01:56:09,121 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,121 INFO : Inserting sp|A6NLU5|VTM2B_HUMAN
15 Dec 2023 01:56:09,172 DEBUG: Total peptides inserted: 3
15 Dec 2023 01:56:09,173 INFO : Inserting sp|B7ZW38|HNRC3_HUMAN
15 Dec 2023 01:56:09,212 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:09,212 INFO : Inserting sp|C9JTQ0|ANR63_HUMAN
15 Dec 2023 01:56:09,231 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,231 INFO : Inserting sp|P0DMR1|HNRC4_HUMAN
15 Dec 2023 01:56:09,270 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:09,270 INFO : Inserting sp|Q3MJ40|C144B_HUMAN
15 Dec 2023 01:56:09,294 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,294 INFO : Inserting sp|Q5VSP4|LC1L1_HUMAN
15 Dec 2023 01:56:09,318 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,318 INFO : Inserting sp|Q6ZST4|LCNL1_HUMAN
15 Dec 2023 01:56:09,332 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,332 INFO : Inserting sp|Q6ZUS5|CC121_HUMAN
15 Dec 2023 01:56:09,372 DEBUG: Total peptides inserted: 2
15 Dec 2023 01:56:09,372 INFO : Inserting sp|Q86U17|SPA11_HUMAN
15 Dec 2023 01:56:09,542 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:09,543 INFO : Inserting sp|Q86UD1|OAF_HUMAN
15 Dec 2023 01:56:09,675 DEBUG: Total peptides inserted: 6
15 Dec 2023 01:56:09,675 INFO : Inserting sp|Q8IYA2|C144C_HUMAN
15 Dec 2023 01:56:09,699 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,699 INFO : Inserting sp|Q8N7X1|RMXL3_HUMAN
15 Dec 2023 01:56:09,720 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,720 INFO : Inserting sp|Q8NEE8|TTC16_HUMAN
15 Dec 2023 01:56:09,744 DEBUG: Total peptides inserted: 1
15 Dec 2023 01:56:09,744 INFO : None of the 2503472 TransitionChromInfos in the file were imported because they exceed the limit of 100000 and there are more than 1000 precursors
15 Dec 2023 01:59:37,205 INFO : Updated 826733 PrecursorChromInfos with transition chromatogram index information
15 Dec 2023 01:59:37,209 INFO : Done parsing Skyline document.
15 Dec 2023 01:59:37,236 WARN : Missed importing 57 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.27_F3_1_S4-E12_1_4529.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 58 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.51_F3_2_S1-H3_1_4458.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 43 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.62_F3_2_S4-C7_1_4498.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 53 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.31_F3_2_S4-G9_1_4550.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 45 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.31_F3_1_S4-G8_1_4549.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 53 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.34_F3_2_S4-H7_1_4560.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 65 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.64_F3_2_S4-D5_1_4510.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 58 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.49_F3_1_S1-G4_1_4447.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 52 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.36_F3_2_S1-A5_1_4572.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 57 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.54_F3_1_S1-H12_1_4467.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 26 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.58_F3_2_S4-A11_1_4478.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 44 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.64_F3_1_S4-D4_1_4509.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 54 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.62_F3_1_S4-C6_1_4497.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 54 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.66_F3_1_S4-E2_1_4519.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 56 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.36_F3_1_S1-A4_1_4571.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 51 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.51_F3_1_S1-H2_1_4457.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 54 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.29_F3_2_S4-F11_1_4540.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 54 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.54_F3_2_S4-A1_1_4468.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 55 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.60_F3_2_S4-B9_1_4488.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 56 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.27_F3_2_S4-F1_1_4530.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 63 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.58_F3_1_S4-A10_1_4477.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 75 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.29_F3_1_S4-F10_1_4539.d
15 Dec 2023 01:59:37,236 WARN : Missed importing 65 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.66_F3_2_S4-E3_1_4520.d
15 Dec 2023 01:59:37,237 WARN : Missed importing 48 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.60_F3_1_S4-B8_1_4487.d
15 Dec 2023 01:59:37,237 WARN : Missed importing 49 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6666.34_F3_1_S4-H6_1_4559.d
15 Dec 2023 01:59:37,237 WARN : Missed importing 65 chromatograms from sample file D:\SILK\P017\Plasma\DATA\F3b\6653.49_F3_2_S1-G5_1_4448.d
15 Dec 2023 01:59:37,237 INFO : Creating and populating temp tables for Proportion values
15 Dec 2023 01:59:46,727 INFO : Setting PrecursorModifiedAreaProportion values on precursorchrominfo
15 Dec 2023 02:00:21,769 INFO : Setting ModifiedAreaProportion values on generalmoleculechrominfo
15 Dec 2023 02:00:35,072 INFO : Cleaning up temp tables
15 Dec 2023 02:00:35,439 INFO : Completed import of Skyline document from SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 02:00:35,441 INFO : 100% Done
15 Dec 2023 02:00:35,486 DEBUG: Finished trying to load data file file:///data/labkey/files/Panorama%20Public/2023/IRMB%20PPC%20-%20SILK_P017/@files/export/xar/experiments_and_runs.xar.exploded/Run179833/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip into the system
15 Dec 2023 02:00:35,507 INFO : Done importing xar
15 Dec 2023 02:00:35,509 INFO : Loading pages and webpart properties
15 Dec 2023 02:00:35,588 INFO : Done importing 3 page(s) with 5 webpart(s)
15 Dec 2023 02:00:35,588 INFO : Loading File Browser config
15 Dec 2023 02:00:35,588 INFO : Done importing File Browser config
15 Dec 2023 02:00:35,590 INFO : Starting Sample Status Data import
15 Dec 2023 02:00:35,591 INFO : No sample types XAR file to process.
15 Dec 2023 02:00:35,591 INFO : Finished importing Sample Status Data
15 Dec 2023 02:00:35,610 INFO : Starting data import from QCAnnotationType.tsv into targetedms.QCAnnotationType
15 Dec 2023 02:00:35,612 INFO : A row containing [Name: 'Reagent Change', Description: 'null', Color: '800000'] values already exists. Skipping
15 Dec 2023 02:00:35,612 INFO : A row containing [Name: 'Instrumentation Change', Description: 'null', Color: 'FF0000'] values already exists. Skipping
15 Dec 2023 02:00:35,613 INFO : A row containing [Name: 'Technician Change', Description: 'null', Color: '0000FF'] values already exists. Skipping
15 Dec 2023 02:00:35,614 INFO : A row containing [Name: 'Instrument Downtime', Description: 'null', Color: 'CCCC00'] values already exists. Skipping
15 Dec 2023 02:00:35,620 INFO : Finished importing 0 rows from QCAnnotationType.tsv into targetedms.QCAnnotationType
15 Dec 2023 02:00:35,626 INFO : Creating a new TargetedMS experiment entry in panoramapublic.ExperimentAnnotations.
15 Dec 2023 02:00:35,640 INFO : Moving files to folder /Panorama Public/2023/IRMB PPC - SILK_P017 and creating symlinks
15 Dec 2023 02:00:35,642 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37
15 Dec 2023 02:00:35,643 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/Plasma_P017_F2b.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/Plasma_P017_F2b.imsdb
15 Dec 2023 02:00:35,646 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/Plasma_P017_F2b.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/Plasma_P017_F2b.imsdb
15 Dec 2023 02:00:35,648 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd
15 Dec 2023 02:00:35,649 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd
15 Dec 2023 02:00:35,651 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.blib
15 Dec 2023 02:00:35,652 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.blib
15 Dec 2023 02:00:35,654 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/human.protdb
15 Dec 2023 02:00:35,655 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/human.protdb
15 Dec 2023 02:00:35,657 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky
15 Dec 2023 02:00:35,658 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky
15 Dec 2023 02:00:35,660 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.redundant.blib
15 Dec 2023 02:00:35,662 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.redundant.blib
15 Dec 2023 02:00:35,663 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyl
15 Dec 2023 02:00:35,665 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyl
15 Dec 2023 02:00:35,667 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky.view
15 Dec 2023 02:00:35,668 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.sky.view
15 Dec 2023 02:00:35,670 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01
15 Dec 2023 02:00:35,672 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky
15 Dec 2023 02:00:35,673 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky
15 Dec 2023 02:00:35,675 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/human.protdb
15 Dec 2023 02:00:35,676 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/human.protdb
15 Dec 2023 02:00:35,678 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd
15 Dec 2023 02:00:35,679 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd
15 Dec 2023 02:00:35,681 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky.view
15 Dec 2023 02:00:35,682 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.sky.view
15 Dec 2023 02:00:35,683 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.blib
15 Dec 2023 02:00:35,684 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.blib
15 Dec 2023 02:00:35,686 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyl
15 Dec 2023 02:00:35,687 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyl
15 Dec 2023 02:00:35,689 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/CSF_P017_F5.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/CSF_P017_F5.imsdb
15 Dec 2023 02:00:35,690 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/CSF_P017_F5.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/CSF_P017_F5.imsdb
15 Dec 2023 02:00:35,692 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.redundant.blib
15 Dec 2023 02:00:35,693 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.redundant.blib
15 Dec 2023 02:00:35,696 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37
15 Dec 2023 02:00:35,697 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/Plasma_P017_F1b.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/Plasma_P017_F1b.imsdb
15 Dec 2023 02:00:35,698 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/Plasma_P017_F1b.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/Plasma_P017_F1b.imsdb
15 Dec 2023 02:00:35,700 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.blib
15 Dec 2023 02:00:35,701 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.blib
15 Dec 2023 02:00:35,702 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.redundant.blib
15 Dec 2023 02:00:35,703 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.redundant.blib
15 Dec 2023 02:00:35,705 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyl
15 Dec 2023 02:00:35,706 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyl
15 Dec 2023 02:00:35,708 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd
15 Dec 2023 02:00:35,709 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd
15 Dec 2023 02:00:35,711 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/human.protdb
15 Dec 2023 02:00:35,712 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/human.protdb
15 Dec 2023 02:00:35,714 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky
15 Dec 2023 02:00:35,715 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky
15 Dec 2023 02:00:35,717 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky.view
15 Dec 2023 02:00:35,718 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.sky.view
15 Dec 2023 02:00:35,720 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49
15 Dec 2023 02:00:35,721 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyl
15 Dec 2023 02:00:35,722 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyl
15 Dec 2023 02:00:35,724 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd
15 Dec 2023 02:00:35,725 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd
15 Dec 2023 02:00:35,727 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/human.protdb
15 Dec 2023 02:00:35,728 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/human.protdb
15 Dec 2023 02:00:35,729 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.blib
15 Dec 2023 02:00:35,730 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.blib
15 Dec 2023 02:00:35,732 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/Plasma_P017_F3b.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/Plasma_P017_F3b.imsdb
15 Dec 2023 02:00:35,733 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/Plasma_P017_F3b.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/Plasma_P017_F3b.imsdb
15 Dec 2023 02:00:35,735 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky.view
15 Dec 2023 02:00:35,736 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky.view
15 Dec 2023 02:00:35,737 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.redundant.blib
15 Dec 2023 02:00:35,739 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.redundant.blib
15 Dec 2023 02:00:35,740 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky
15 Dec 2023 02:00:35,741 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.sky
15 Dec 2023 02:00:35,743 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 02:00:35,744 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 02:00:35,747 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34
15 Dec 2023 02:00:36,477 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/CSF_P017_F2.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/CSF_P017_F2.imsdb
15 Dec 2023 02:00:36,479 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/CSF_P017_F2.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/CSF_P017_F2.imsdb
15 Dec 2023 02:00:36,481 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.blib
15 Dec 2023 02:00:36,482 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.blib
15 Dec 2023 02:00:36,485 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.redundant.blib
15 Dec 2023 02:00:36,486 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.redundant.blib
15 Dec 2023 02:00:36,488 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/human.protdb
15 Dec 2023 02:00:36,489 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/human.protdb
15 Dec 2023 02:00:36,491 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyl
15 Dec 2023 02:00:36,492 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyl
15 Dec 2023 02:00:36,494 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky
15 Dec 2023 02:00:36,495 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky
15 Dec 2023 02:00:36,497 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd
15 Dec 2023 02:00:36,498 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd
15 Dec 2023 02:00:36,500 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky.view
15 Dec 2023 02:00:36,501 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.sky.view
15 Dec 2023 02:00:36,503 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 02:00:36,504 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 02:00:36,506 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 02:00:36,507 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 02:00:36,509 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 02:00:36,510 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 02:00:36,513 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 02:00:36,514 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 02:00:36,516 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles
15 Dec 2023 02:00:36,520 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/991cf479-5cf7-4315-a7e8-39cd21a1e4bd_1692351620.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/991cf479-5cf7-4315-a7e8-39cd21a1e4bd_1692351620.mgf
15 Dec 2023 02:00:36,522 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/991cf479-5cf7-4315-a7e8-39cd21a1e4bd_1692351620.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/991cf479-5cf7-4315-a7e8-39cd21a1e4bd_1692351620.mgf
15 Dec 2023 02:00:36,524 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (9).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (9).mzid
15 Dec 2023 02:00:36,525 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (9).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (9).mzid
15 Dec 2023 02:00:36,528 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cdca76c0-f572-4b5d-9db8-af30a82ad595_1692207043.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cdca76c0-f572-4b5d-9db8-af30a82ad595_1692207043.mgf
15 Dec 2023 02:00:36,529 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cdca76c0-f572-4b5d-9db8-af30a82ad595_1692207043.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cdca76c0-f572-4b5d-9db8-af30a82ad595_1692207043.mgf
15 Dec 2023 02:00:36,531 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5e25a0a4-fc3d-419a-88e8-07500ab43b3b_1692205620.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5e25a0a4-fc3d-419a-88e8-07500ab43b3b_1692205620.mgf
15 Dec 2023 02:00:36,532 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5e25a0a4-fc3d-419a-88e8-07500ab43b3b_1692205620.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5e25a0a4-fc3d-419a-88e8-07500ab43b3b_1692205620.mgf
15 Dec 2023 02:00:36,534 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/11ca1a3e-e89c-4eb1-b3c0-01966e1400d5_1692331447.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/11ca1a3e-e89c-4eb1-b3c0-01966e1400d5_1692331447.mgf
15 Dec 2023 02:00:36,535 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/11ca1a3e-e89c-4eb1-b3c0-01966e1400d5_1692331447.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/11ca1a3e-e89c-4eb1-b3c0-01966e1400d5_1692331447.mgf
15 Dec 2023 02:00:36,537 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A7_1_2819.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A7_1_2819.d.zip
15 Dec 2023 02:00:36,538 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A7_1_2819.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A7_1_2819.d.zip
15 Dec 2023 02:00:36,540 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F4_S2-B3_1_2829.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F4_S2-B3_1_2829.d.zip
15 Dec 2023 02:00:36,541 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F4_S2-B3_1_2829.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F4_S2-B3_1_2829.d.zip
15 Dec 2023 02:00:36,543 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ba58832f-02ad-4502-827b-78787ae89008_1688243329.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ba58832f-02ad-4502-827b-78787ae89008_1688243329.mgf
15 Dec 2023 02:00:36,544 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ba58832f-02ad-4502-827b-78787ae89008_1688243329.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ba58832f-02ad-4502-827b-78787ae89008_1688243329.mgf
15 Dec 2023 02:00:36,546 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/131ad680-ebc7-4490-b4ae-5703c7680ce1_1688167489.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/131ad680-ebc7-4490-b4ae-5703c7680ce1_1688167489.mgf
15 Dec 2023 02:00:36,547 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/131ad680-ebc7-4490-b4ae-5703c7680ce1_1688167489.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/131ad680-ebc7-4490-b4ae-5703c7680ce1_1688167489.mgf
15 Dec 2023 02:00:36,548 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F3_2_S1-H3_1_4458.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F3_2_S1-H3_1_4458.d.zip
15 Dec 2023 02:00:36,549 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F3_2_S1-H3_1_4458.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F3_2_S1-H3_1_4458.d.zip
15 Dec 2023 02:00:36,551 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F4_S2-E4_1_2921.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F4_S2-E4_1_2921.d.zip
15 Dec 2023 02:00:36,553 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F4_S2-E4_1_2921.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F4_S2-E4_1_2921.d.zip
15 Dec 2023 02:00:36,555 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F5_S2-F7_1_2863.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F5_S2-F7_1_2863.d.zip
15 Dec 2023 02:00:36,559 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F5_S2-F7_1_2863.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F5_S2-F7_1_2863.d.zip
15 Dec 2023 02:00:36,561 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6ad4057b-7a20-4e1f-938f-d1e6a97ed6a7_1692350197.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6ad4057b-7a20-4e1f-938f-d1e6a97ed6a7_1692350197.mgf
15 Dec 2023 02:00:36,563 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6ad4057b-7a20-4e1f-938f-d1e6a97ed6a7_1692350197.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6ad4057b-7a20-4e1f-938f-d1e6a97ed6a7_1692350197.mgf
15 Dec 2023 02:00:36,564 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/90fb2387-8750-4f72-a9cc-f30338ebe60b_1688158115.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/90fb2387-8750-4f72-a9cc-f30338ebe60b_1688158115.mgf
15 Dec 2023 02:00:36,566 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/90fb2387-8750-4f72-a9cc-f30338ebe60b_1688158115.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/90fb2387-8750-4f72-a9cc-f30338ebe60b_1688158115.mgf
15 Dec 2023 02:00:36,567 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F5_S2-A7_1_2822.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F5_S2-A7_1_2822.d.zip
15 Dec 2023 02:00:36,569 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F5_S2-A7_1_2822.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F5_S2-A7_1_2822.d.zip
15 Dec 2023 02:00:36,570 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F5_S2-G7_1_2874.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F5_S2-G7_1_2874.d.zip
15 Dec 2023 02:00:36,572 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F5_S2-G7_1_2874.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F5_S2-G7_1_2874.d.zip
15 Dec 2023 02:00:36,573 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/51fdcf72-718c-4f5b-ac27-e9879943e4c9_1688145895.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/51fdcf72-718c-4f5b-ac27-e9879943e4c9_1688145895.mgf
15 Dec 2023 02:00:36,574 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/51fdcf72-718c-4f5b-ac27-e9879943e4c9_1688145895.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/51fdcf72-718c-4f5b-ac27-e9879943e4c9_1688145895.mgf
15 Dec 2023 02:00:36,576 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/177a7583-c13d-4511-80b0-cd5d22e457ff_1688229690.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/177a7583-c13d-4511-80b0-cd5d22e457ff_1688229690.mgf
15 Dec 2023 02:00:36,578 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/177a7583-c13d-4511-80b0-cd5d22e457ff_1688229690.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/177a7583-c13d-4511-80b0-cd5d22e457ff_1688229690.mgf
15 Dec 2023 02:00:36,580 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/37cd1eb1-2f77-4b0a-8a35-46a74c11800f_1692317802.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/37cd1eb1-2f77-4b0a-8a35-46a74c11800f_1692317802.mgf
15 Dec 2023 02:00:36,581 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/37cd1eb1-2f77-4b0a-8a35-46a74c11800f_1692317802.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/37cd1eb1-2f77-4b0a-8a35-46a74c11800f_1692317802.mgf
15 Dec 2023 02:00:36,582 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c67312b3-5f68-4bfc-ac79-b0129df226d6_1688244752.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c67312b3-5f68-4bfc-ac79-b0129df226d6_1688244752.mgf
15 Dec 2023 02:00:36,584 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c67312b3-5f68-4bfc-ac79-b0129df226d6_1688244752.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c67312b3-5f68-4bfc-ac79-b0129df226d6_1688244752.mgf
15 Dec 2023 02:00:36,585 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/16000212-8876-480e-a468-493e94be3ae8_1692286254.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/16000212-8876-480e-a468-493e94be3ae8_1692286254.mgf
15 Dec 2023 02:00:36,586 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/16000212-8876-480e-a468-493e94be3ae8_1692286254.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/16000212-8876-480e-a468-493e94be3ae8_1692286254.mgf
15 Dec 2023 02:00:36,588 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F5_S2-E7_1_2855.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F5_S2-E7_1_2855.d.zip
15 Dec 2023 02:00:36,590 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F5_S2-E7_1_2855.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F5_S2-E7_1_2855.d.zip
15 Dec 2023 02:00:36,591 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F2_2_S1-H11_1_4466.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F2_2_S1-H11_1_4466.d.zip
15 Dec 2023 02:00:36,592 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F2_2_S1-H11_1_4466.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F2_2_S1-H11_1_4466.d.zip
15 Dec 2023 02:00:36,595 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/48db951f-8eaa-4870-bc9c-2e5758e81500_1692193398.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/48db951f-8eaa-4870-bc9c-2e5758e81500_1692193398.mgf
15 Dec 2023 02:00:36,596 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/48db951f-8eaa-4870-bc9c-2e5758e81500_1692193398.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/48db951f-8eaa-4870-bc9c-2e5758e81500_1692193398.mgf
15 Dec 2023 02:00:36,598 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/aad3a8f3-4e4c-419b-a261-bff4298ea4fc_1688223160.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/aad3a8f3-4e4c-419b-a261-bff4298ea4fc_1688223160.mgf
15 Dec 2023 02:00:36,599 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/aad3a8f3-4e4c-419b-a261-bff4298ea4fc_1688223160.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/aad3a8f3-4e4c-419b-a261-bff4298ea4fc_1688223160.mgf
15 Dec 2023 02:00:36,601 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/fd025027-3d8e-450c-9ff6-b680ef51c9e9_1688520311.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/fd025027-3d8e-450c-9ff6-b680ef51c9e9_1688520311.mgf
15 Dec 2023 02:00:36,602 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/fd025027-3d8e-450c-9ff6-b680ef51c9e9_1688520311.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/fd025027-3d8e-450c-9ff6-b680ef51c9e9_1688520311.mgf
15 Dec 2023 02:00:36,604 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cfd48dfc-7e6e-4196-a170-dabcddebc480_1692234334.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cfd48dfc-7e6e-4196-a170-dabcddebc480_1692234334.mgf
15 Dec 2023 02:00:36,606 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cfd48dfc-7e6e-4196-a170-dabcddebc480_1692234334.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cfd48dfc-7e6e-4196-a170-dabcddebc480_1692234334.mgf
15 Dec 2023 02:00:36,608 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F2_1_S4-D12_1_4517.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F2_1_S4-D12_1_4517.d.zip
15 Dec 2023 02:00:36,609 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F2_1_S4-D12_1_4517.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F2_1_S4-D12_1_4517.d.zip
15 Dec 2023 02:00:36,611 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7cd3cc77-e7bd-450a-a236-beebc902528c_1692370524.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7cd3cc77-e7bd-450a-a236-beebc902528c_1692370524.mgf
15 Dec 2023 02:00:36,612 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7cd3cc77-e7bd-450a-a236-beebc902528c_1692370524.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7cd3cc77-e7bd-450a-a236-beebc902528c_1692370524.mgf
15 Dec 2023 02:00:36,614 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/fda626f8-cda3-4ee5-bdaf-3d9259896322_1692268737.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/fda626f8-cda3-4ee5-bdaf-3d9259896322_1692268737.mgf
15 Dec 2023 02:00:36,615 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/fda626f8-cda3-4ee5-bdaf-3d9259896322_1692268737.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/fda626f8-cda3-4ee5-bdaf-3d9259896322_1692268737.mgf
15 Dec 2023 02:00:36,618 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9be3f844-33eb-4dc3-a6b4-e085071ba198_1688282836.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9be3f844-33eb-4dc3-a6b4-e085071ba198_1688282836.mgf
15 Dec 2023 02:00:36,620 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9be3f844-33eb-4dc3-a6b4-e085071ba198_1688282836.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9be3f844-33eb-4dc3-a6b4-e085071ba198_1688282836.mgf
15 Dec 2023 02:00:36,622 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F1-4_2_S1-G8_1_4451.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F1-4_2_S1-G8_1_4451.d.zip
15 Dec 2023 02:00:36,623 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F1-4_2_S1-G8_1_4451.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F1-4_2_S1-G8_1_4451.d.zip
15 Dec 2023 02:00:36,625 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F3_1_S4-D4_1_4509.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F3_1_S4-D4_1_4509.d.zip
15 Dec 2023 02:00:36,627 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F3_1_S4-D4_1_4509.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F3_1_S4-D4_1_4509.d.zip
15 Dec 2023 02:00:36,629 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/26ec5a3d-e948-4976-966e-2fcf1adc385f_1688566964.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/26ec5a3d-e948-4976-966e-2fcf1adc385f_1688566964.mgf
15 Dec 2023 02:00:36,630 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/26ec5a3d-e948-4976-966e-2fcf1adc385f_1688566964.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/26ec5a3d-e948-4976-966e-2fcf1adc385f_1688566964.mgf
15 Dec 2023 02:00:36,632 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4c43512f-491f-461b-82ba-e05a4bb3564d_1688571231.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4c43512f-491f-461b-82ba-e05a4bb3564d_1688571231.mgf
15 Dec 2023 02:00:36,634 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4c43512f-491f-461b-82ba-e05a4bb3564d_1688571231.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4c43512f-491f-461b-82ba-e05a4bb3564d_1688571231.mgf
15 Dec 2023 02:00:36,636 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7e41810e-ce5b-4dff-bd30-31952b7fd3ab_1688241906.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7e41810e-ce5b-4dff-bd30-31952b7fd3ab_1688241906.mgf
15 Dec 2023 02:00:36,637 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7e41810e-ce5b-4dff-bd30-31952b7fd3ab_1688241906.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7e41810e-ce5b-4dff-bd30-31952b7fd3ab_1688241906.mgf
15 Dec 2023 02:00:36,639 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/415d6b38-652f-4bbf-af2b-6389513c60f4_1688148740.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/415d6b38-652f-4bbf-af2b-6389513c60f4_1688148740.mgf
15 Dec 2023 02:00:36,640 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/415d6b38-652f-4bbf-af2b-6389513c60f4_1688148740.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/415d6b38-652f-4bbf-af2b-6389513c60f4_1688148740.mgf
15 Dec 2023 02:00:36,642 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d
15 Dec 2023 02:00:36,643 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m
15 Dec 2023 02:00:36,644 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/microTOFQImpacTemAcquisition.method to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/microTOFQImpacTemAcquisition.method
15 Dec 2023 02:00:36,646 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/microTOFQImpacTemAcquisition.method targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/microTOFQImpacTemAcquisition.method
15 Dec 2023 02:00:36,648 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/diaSettings.diasqlite to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/diaSettings.diasqlite
15 Dec 2023 02:00:36,649 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/diaSettings.diasqlite targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/diaSettings.diasqlite
15 Dec 2023 02:00:36,651 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/submethods.xml to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/submethods.xml
15 Dec 2023 02:00:36,652 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/submethods.xml targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/submethods.xml
15 Dec 2023 02:00:36,654 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/Maldi.method to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/Maldi.method
15 Dec 2023 02:00:36,655 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/Maldi.method targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/Maldi.method
15 Dec 2023 02:00:36,657 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/hystar.method to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/hystar.method
15 Dec 2023 02:00:36,658 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/hystar.method targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/hystar.method
15 Dec 2023 02:00:36,660 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/lock.file to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/lock.file
15 Dec 2023 02:00:36,662 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/lock.file targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/lock.file
15 Dec 2023 02:00:36,664 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/prmSettings.prmsqlite to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/prmSettings.prmsqlite
15 Dec 2023 02:00:36,665 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/prmSettings.prmsqlite targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C11_1_2838.d/2838.m/prmSettings.prmsqlite
15 Dec 2023 02:00:36,667 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F1-4_1_S4-A3_1_4470.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F1-4_1_S4-A3_1_4470.d.zip
15 Dec 2023 02:00:36,668 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F1-4_1_S4-A3_1_4470.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F1-4_1_S4-A3_1_4470.d.zip
15 Dec 2023 02:00:36,669 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8be47456-3c04-4aba-9548-744aeeec01e6_1692264470.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8be47456-3c04-4aba-9548-744aeeec01e6_1692264470.mgf
15 Dec 2023 02:00:36,670 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8be47456-3c04-4aba-9548-744aeeec01e6_1692264470.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8be47456-3c04-4aba-9548-744aeeec01e6_1692264470.mgf
15 Dec 2023 02:00:36,672 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (11).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (11).mzid
15 Dec 2023 02:00:36,673 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (11).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (11).mzid
15 Dec 2023 02:00:36,676 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0e66c2db-fdc2-4067-bcf7-a53448c1994d_1688233957.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0e66c2db-fdc2-4067-bcf7-a53448c1994d_1688233957.mgf
15 Dec 2023 02:00:36,677 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0e66c2db-fdc2-4067-bcf7-a53448c1994d_1688233957.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0e66c2db-fdc2-4067-bcf7-a53448c1994d_1688233957.mgf
15 Dec 2023 02:00:36,679 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F2_2_S4-D3_1_4508.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F2_2_S4-D3_1_4508.d.zip
15 Dec 2023 02:00:36,680 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F2_2_S4-D3_1_4508.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F2_2_S4-D3_1_4508.d.zip
15 Dec 2023 02:00:36,684 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cf308cbd-b753-410d-9808-0602a4ba52b7_1692336553.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cf308cbd-b753-410d-9808-0602a4ba52b7_1692336553.mgf
15 Dec 2023 02:00:36,685 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cf308cbd-b753-410d-9808-0602a4ba52b7_1692336553.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cf308cbd-b753-410d-9808-0602a4ba52b7_1692336553.mgf
15 Dec 2023 02:00:36,687 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/232f8bb5-2692-48de-93c9-52dc4f1fb866_1692376214.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/232f8bb5-2692-48de-93c9-52dc4f1fb866_1692376214.mgf
15 Dec 2023 02:00:36,689 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/232f8bb5-2692-48de-93c9-52dc4f1fb866_1692376214.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/232f8bb5-2692-48de-93c9-52dc4f1fb866_1692376214.mgf
15 Dec 2023 02:00:36,690 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F3_S1-C12_1_2904.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F3_S1-C12_1_2904.d.zip
15 Dec 2023 02:00:36,692 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F3_S1-C12_1_2904.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F3_S1-C12_1_2904.d.zip
15 Dec 2023 02:00:36,694 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/06a5806f-a225-475c-801b-cdd317384664_1692325755.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/06a5806f-a225-475c-801b-cdd317384664_1692325755.mgf
15 Dec 2023 02:00:36,695 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/06a5806f-a225-475c-801b-cdd317384664_1692325755.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/06a5806f-a225-475c-801b-cdd317384664_1692325755.mgf
15 Dec 2023 02:00:36,697 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/eb4b298c-c38a-4ec0-ae23-4312276bafec_1688320335.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/eb4b298c-c38a-4ec0-ae23-4312276bafec_1688320335.mgf
15 Dec 2023 02:00:36,698 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/eb4b298c-c38a-4ec0-ae23-4312276bafec_1688320335.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/eb4b298c-c38a-4ec0-ae23-4312276bafec_1688320335.mgf
15 Dec 2023 02:00:36,700 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A2_1_3063.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A2_1_3063.d.zip
15 Dec 2023 02:00:36,701 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A2_1_3063.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A2_1_3063.d.zip
15 Dec 2023 02:00:36,703 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f3031767-7348-409d-89a9-1b704b10d7a8_1692343670.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f3031767-7348-409d-89a9-1b704b10d7a8_1692343670.mgf
15 Dec 2023 02:00:36,705 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f3031767-7348-409d-89a9-1b704b10d7a8_1692343670.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f3031767-7348-409d-89a9-1b704b10d7a8_1692343670.mgf
15 Dec 2023 02:00:36,706 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/84b3cc48-a8cd-4257-b337-cbec47a232ce_1688256972.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/84b3cc48-a8cd-4257-b337-cbec47a232ce_1688256972.mgf
15 Dec 2023 02:00:36,707 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/84b3cc48-a8cd-4257-b337-cbec47a232ce_1688256972.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/84b3cc48-a8cd-4257-b337-cbec47a232ce_1688256972.mgf
15 Dec 2023 02:00:36,709 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F2_2_S4-A9_1_4476.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F2_2_S4-A9_1_4476.d.zip
15 Dec 2023 02:00:36,710 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F2_2_S4-A9_1_4476.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F2_2_S4-A9_1_4476.d.zip
15 Dec 2023 02:00:36,712 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F3_2_S4-B9_1_4488.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F3_2_S4-B9_1_4488.d.zip
15 Dec 2023 02:00:36,713 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F3_2_S4-B9_1_4488.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F3_2_S4-B9_1_4488.d.zip
15 Dec 2023 02:00:36,715 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F2_1_S1-H10_1_4465.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F2_1_S1-H10_1_4465.d.zip
15 Dec 2023 02:00:36,716 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F2_1_S1-H10_1_4465.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F2_1_S1-H10_1_4465.d.zip
15 Dec 2023 02:00:36,718 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/58a03e19-d26d-4d57-aaef-b9769fe71da1_1688213352.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/58a03e19-d26d-4d57-aaef-b9769fe71da1_1688213352.mgf
15 Dec 2023 02:00:36,720 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/58a03e19-d26d-4d57-aaef-b9769fe71da1_1688213352.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/58a03e19-d26d-4d57-aaef-b9769fe71da1_1688213352.mgf
15 Dec 2023 02:00:36,721 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/48e3df58-bc23-43d1-831d-a602c40770e0_1692297049.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/48e3df58-bc23-43d1-831d-a602c40770e0_1692297049.mgf
15 Dec 2023 02:00:36,722 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/48e3df58-bc23-43d1-831d-a602c40770e0_1692297049.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/48e3df58-bc23-43d1-831d-a602c40770e0_1692297049.mgf
15 Dec 2023 02:00:36,724 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F4_S2-A3_1_2821.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F4_S2-A3_1_2821.d.zip
15 Dec 2023 02:00:36,725 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F4_S2-A3_1_2821.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F4_S2-A3_1_2821.d.zip
15 Dec 2023 02:00:36,727 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a3ef5062-92bd-4929-a2d6-efd468d23e0d_1688292209.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a3ef5062-92bd-4929-a2d6-efd468d23e0d_1688292209.mgf
15 Dec 2023 02:00:36,728 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a3ef5062-92bd-4929-a2d6-efd468d23e0d_1688292209.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a3ef5062-92bd-4929-a2d6-efd468d23e0d_1688292209.mgf
15 Dec 2023 02:00:36,730 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (10).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (10).mzid
15 Dec 2023 02:00:36,731 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (10).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (10).mzid
15 Dec 2023 02:00:36,733 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F4_S2-D4_1_2913.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F4_S2-D4_1_2913.d.zip
15 Dec 2023 02:00:36,734 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F4_S2-D4_1_2913.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F4_S2-D4_1_2913.d.zip
15 Dec 2023 02:00:36,736 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F3_S1-G11_1_2872.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F3_S1-G11_1_2872.d.zip
15 Dec 2023 02:00:36,737 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F3_S1-G11_1_2872.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F3_S1-G11_1_2872.d.zip
15 Dec 2023 02:00:36,739 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/65b46407-cc4d-40e0-9eda-3391071f1565_1692330025.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/65b46407-cc4d-40e0-9eda-3391071f1565_1692330025.mgf
15 Dec 2023 02:00:36,740 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/65b46407-cc4d-40e0-9eda-3391071f1565_1692330025.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/65b46407-cc4d-40e0-9eda-3391071f1565_1692330025.mgf
15 Dec 2023 02:00:36,742 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F2_S1-A8_1_2887.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F2_S1-A8_1_2887.d.zip
15 Dec 2023 02:00:36,743 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F2_S1-A8_1_2887.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F2_S1-A8_1_2887.d.zip
15 Dec 2023 02:00:36,745 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/be239e96-410c-4622-af94-6ba981283008_1692240028.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/be239e96-410c-4622-af94-6ba981283008_1692240028.mgf
15 Dec 2023 02:00:36,747 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/be239e96-410c-4622-af94-6ba981283008_1692240028.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/be239e96-410c-4622-af94-6ba981283008_1692240028.mgf
15 Dec 2023 02:00:36,749 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F1-4_2_S4-G2_1_4543.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F1-4_2_S4-G2_1_4543.d.zip
15 Dec 2023 02:00:36,750 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F1-4_2_S4-G2_1_4543.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F1-4_2_S4-G2_1_4543.d.zip
15 Dec 2023 02:00:36,752 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A3_1_2818.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A3_1_2818.d.zip
15 Dec 2023 02:00:36,753 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A3_1_2818.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F1_S1-A3_1_2818.d.zip
15 Dec 2023 02:00:36,754 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F1-4_1_S4-B1_1_4480.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F1-4_1_S4-B1_1_4480.d.zip
15 Dec 2023 02:00:36,755 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F1-4_1_S4-B1_1_4480.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F1-4_1_S4-B1_1_4480.d.zip
15 Dec 2023 02:00:36,757 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/49f1a1e9-c35a-41a6-96cb-686aa8b1b80c_1688235380.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/49f1a1e9-c35a-41a6-96cb-686aa8b1b80c_1688235380.mgf
15 Dec 2023 02:00:36,758 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/49f1a1e9-c35a-41a6-96cb-686aa8b1b80c_1688235380.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/49f1a1e9-c35a-41a6-96cb-686aa8b1b80c_1688235380.mgf
15 Dec 2023 02:00:36,760 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F5_S2-H7_1_2882.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F5_S2-H7_1_2882.d.zip
15 Dec 2023 02:00:36,761 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F5_S2-H7_1_2882.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F5_S2-H7_1_2882.d.zip
15 Dec 2023 02:00:36,762 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F3_1_S4-A10_1_4477.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F3_1_S4-A10_1_4477.d.zip
15 Dec 2023 02:00:36,763 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F3_1_S4-A10_1_4477.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F3_1_S4-A10_1_4477.d.zip
15 Dec 2023 02:00:36,765 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F5_S2-B7_1_2830.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F5_S2-B7_1_2830.d.zip
15 Dec 2023 02:00:36,766 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F5_S2-B7_1_2830.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F5_S2-B7_1_2830.d.zip
15 Dec 2023 02:00:36,768 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F4_S2-G3_1_2873.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F4_S2-G3_1_2873.d.zip
15 Dec 2023 02:00:36,769 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F4_S2-G3_1_2873.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F4_S2-G3_1_2873.d.zip
15 Dec 2023 02:00:36,771 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F3_S1-D11_1_2845.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F3_S1-D11_1_2845.d.zip
15 Dec 2023 02:00:36,772 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F3_S1-D11_1_2845.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F3_S1-D11_1_2845.d.zip
15 Dec 2023 02:00:36,774 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8b0b48a7-167f-44ed-bbbc-562f633756c2_1688300162.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8b0b48a7-167f-44ed-bbbc-562f633756c2_1688300162.mgf
15 Dec 2023 02:00:36,775 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8b0b48a7-167f-44ed-bbbc-562f633756c2_1688300162.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8b0b48a7-167f-44ed-bbbc-562f633756c2_1688300162.mgf
15 Dec 2023 02:00:36,777 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/bbf55c10-805a-4d93-a08a-478d9cb67abe_1688153846.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/bbf55c10-805a-4d93-a08a-478d9cb67abe_1688153846.mgf
15 Dec 2023 02:00:36,778 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/bbf55c10-805a-4d93-a08a-478d9cb67abe_1688153846.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/bbf55c10-805a-4d93-a08a-478d9cb67abe_1688153846.mgf
15 Dec 2023 02:00:36,780 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/858382b6-ca6f-440b-a1b0-10e057e2c4af_1692304164.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/858382b6-ca6f-440b-a1b0-10e057e2c4af_1692304164.mgf
15 Dec 2023 02:00:36,781 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/858382b6-ca6f-440b-a1b0-10e057e2c4af_1692304164.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/858382b6-ca6f-440b-a1b0-10e057e2c4af_1692304164.mgf
15 Dec 2023 02:00:36,782 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (13).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (13).mzid
15 Dec 2023 02:00:37,027 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (13).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (13).mzid
15 Dec 2023 02:00:37,031 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5337ee0e-6c20-40fa-bf60-aef1e25de04a_1692232911.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5337ee0e-6c20-40fa-bf60-aef1e25de04a_1692232911.mgf
15 Dec 2023 02:00:37,033 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5337ee0e-6c20-40fa-bf60-aef1e25de04a_1692232911.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5337ee0e-6c20-40fa-bf60-aef1e25de04a_1692232911.mgf
15 Dec 2023 02:00:37,036 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0c8998d7-6176-4f6b-b719-b7dd3b7db89f_1692302741.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0c8998d7-6176-4f6b-b719-b7dd3b7db89f_1692302741.mgf
15 Dec 2023 02:00:37,037 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0c8998d7-6176-4f6b-b719-b7dd3b7db89f_1692302741.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0c8998d7-6176-4f6b-b719-b7dd3b7db89f_1692302741.mgf
15 Dec 2023 02:00:37,040 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F3_2_S4-F11_1_4540.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F3_2_S4-F11_1_4540.d.zip
15 Dec 2023 02:00:37,048 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F3_2_S4-F11_1_4540.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F3_2_S4-F11_1_4540.d.zip
15 Dec 2023 02:00:37,051 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F1-4_2_S4-D8_1_4513.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F1-4_2_S4-D8_1_4513.d.zip
15 Dec 2023 02:00:37,053 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F1-4_2_S4-D8_1_4513.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F1-4_2_S4-D8_1_4513.d.zip
15 Dec 2023 02:00:37,056 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F2_1_S4-D2_1_4507.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F2_1_S4-D2_1_4507.d.zip
15 Dec 2023 02:00:37,058 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F2_1_S4-D2_1_4507.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F2_1_S4-D2_1_4507.d.zip
15 Dec 2023 02:00:37,061 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/152a943c-b83b-4c55-8e3d-2615fd93bea8_1692255097.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/152a943c-b83b-4c55-8e3d-2615fd93bea8_1692255097.mgf
15 Dec 2023 02:00:37,063 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/152a943c-b83b-4c55-8e3d-2615fd93bea8_1692255097.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/152a943c-b83b-4c55-8e3d-2615fd93bea8_1692255097.mgf
15 Dec 2023 02:00:37,066 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b171ec73-d419-430d-aef1-83923b2f9657_1692313535.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b171ec73-d419-430d-aef1-83923b2f9657_1692313535.mgf
15 Dec 2023 02:00:37,067 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b171ec73-d419-430d-aef1-83923b2f9657_1692313535.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b171ec73-d419-430d-aef1-83923b2f9657_1692313535.mgf
15 Dec 2023 02:00:37,070 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ceb17f1f-aa1c-4d61-a37a-6a9d0b64f2af_1688261241.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ceb17f1f-aa1c-4d61-a37a-6a9d0b64f2af_1688261241.mgf
15 Dec 2023 02:00:37,071 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ceb17f1f-aa1c-4d61-a37a-6a9d0b64f2af_1688261241.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ceb17f1f-aa1c-4d61-a37a-6a9d0b64f2af_1688261241.mgf
15 Dec 2023 02:00:37,085 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/82c04442-2b62-4768-9ac1-662e46f09eb4_1692327178.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/82c04442-2b62-4768-9ac1-662e46f09eb4_1692327178.mgf
15 Dec 2023 02:00:37,086 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/82c04442-2b62-4768-9ac1-662e46f09eb4_1692327178.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/82c04442-2b62-4768-9ac1-662e46f09eb4_1692327178.mgf
15 Dec 2023 02:00:37,089 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/687dd840-8f41-42f5-8472-b80a4bb5a506_1692371946.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/687dd840-8f41-42f5-8472-b80a4bb5a506_1692371946.mgf
15 Dec 2023 02:00:37,090 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/687dd840-8f41-42f5-8472-b80a4bb5a506_1692371946.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/687dd840-8f41-42f5-8472-b80a4bb5a506_1692371946.mgf
15 Dec 2023 02:00:37,094 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8ce457a3-4fa4-4ef5-9629-f6a4189950fc_1692214156.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8ce457a3-4fa4-4ef5-9629-f6a4189950fc_1692214156.mgf
15 Dec 2023 02:00:37,095 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8ce457a3-4fa4-4ef5-9629-f6a4189950fc_1692214156.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8ce457a3-4fa4-4ef5-9629-f6a4189950fc_1692214156.mgf
15 Dec 2023 02:00:37,098 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a1a45a06-4646-4943-bf81-f10ad0e27191_1692354466.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a1a45a06-4646-4943-bf81-f10ad0e27191_1692354466.mgf
15 Dec 2023 02:00:37,119 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a1a45a06-4646-4943-bf81-f10ad0e27191_1692354466.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a1a45a06-4646-4943-bf81-f10ad0e27191_1692354466.mgf
15 Dec 2023 02:00:37,122 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9f340a92-e914-4077-a329-c4fef0d72f9c_1692241453.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9f340a92-e914-4077-a329-c4fef0d72f9c_1692241453.mgf
15 Dec 2023 02:00:37,123 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9f340a92-e914-4077-a329-c4fef0d72f9c_1692241453.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9f340a92-e914-4077-a329-c4fef0d72f9c_1692241453.mgf
15 Dec 2023 02:00:37,126 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b3b9f2d1-5707-4394-ab4b-ead5e338fd9d_1688310960.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b3b9f2d1-5707-4394-ab4b-ead5e338fd9d_1688310960.mgf
15 Dec 2023 02:00:37,127 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b3b9f2d1-5707-4394-ab4b-ead5e338fd9d_1688310960.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b3b9f2d1-5707-4394-ab4b-ead5e338fd9d_1688310960.mgf
15 Dec 2023 02:00:37,130 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F4_S2-C3_1_2837.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F4_S2-C3_1_2837.d.zip
15 Dec 2023 02:00:37,132 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F4_S2-C3_1_2837.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F4_S2-C3_1_2837.d.zip
15 Dec 2023 02:00:37,135 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F5_S2-C8_1_2906.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F5_S2-C8_1_2906.d.zip
15 Dec 2023 02:00:37,136 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F5_S2-C8_1_2906.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F5_S2-C8_1_2906.d.zip
15 Dec 2023 02:00:37,160 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F3_1_S4-E2_1_4519.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F3_1_S4-E2_1_4519.d.zip
15 Dec 2023 02:00:37,162 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F3_1_S4-E2_1_4519.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F3_1_S4-E2_1_4519.d.zip
15 Dec 2023 02:00:37,166 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F3_2_S4-A1_1_4468.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F3_2_S4-A1_1_4468.d.zip
15 Dec 2023 02:00:37,168 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F3_2_S4-A1_1_4468.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F3_2_S4-A1_1_4468.d.zip
15 Dec 2023 02:00:37,186 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a6785a76-bb20-4807-9ebc-5e5e7e7741d1_1692322909.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a6785a76-bb20-4807-9ebc-5e5e7e7741d1_1692322909.mgf
15 Dec 2023 02:00:37,187 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a6785a76-bb20-4807-9ebc-5e5e7e7741d1_1692322909.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a6785a76-bb20-4807-9ebc-5e5e7e7741d1_1692322909.mgf
15 Dec 2023 02:00:37,189 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/727dbc19-7ab9-479a-b88d-83c708b9aa28_1692267314.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/727dbc19-7ab9-479a-b88d-83c708b9aa28_1692267314.mgf
15 Dec 2023 02:00:37,190 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/727dbc19-7ab9-479a-b88d-83c708b9aa28_1692267314.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/727dbc19-7ab9-479a-b88d-83c708b9aa28_1692267314.mgf
15 Dec 2023 02:00:37,192 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6b4f77a1-8a4c-49aa-b953-556263dc63bd_1692199092.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6b4f77a1-8a4c-49aa-b953-556263dc63bd_1692199092.mgf
15 Dec 2023 02:00:37,193 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6b4f77a1-8a4c-49aa-b953-556263dc63bd_1692199092.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6b4f77a1-8a4c-49aa-b953-556263dc63bd_1692199092.mgf
15 Dec 2023 02:00:37,195 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b7528860-0d09-4124-95e4-7477a551ae24_1692290521.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b7528860-0d09-4124-95e4-7477a551ae24_1692290521.mgf
15 Dec 2023 02:00:37,196 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/b7528860-0d09-4124-95e4-7477a551ae24_1692290521.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/b7528860-0d09-4124-95e4-7477a551ae24_1692290521.mgf
15 Dec 2023 02:00:37,198 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F1_S1-C4_1_2902.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F1_S1-C4_1_2902.d.zip
15 Dec 2023 02:00:37,198 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F1_S1-C4_1_2902.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F1_S1-C4_1_2902.d.zip
15 Dec 2023 02:00:37,200 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F3_2_S4-E3_1_4520.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F3_2_S4-E3_1_4520.d.zip
15 Dec 2023 02:00:37,201 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F3_2_S4-E3_1_4520.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F3_2_S4-E3_1_4520.d.zip
15 Dec 2023 02:00:37,203 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f49edaa4-ff7b-4619-9c1c-24e897a15358_1692353043.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f49edaa4-ff7b-4619-9c1c-24e897a15358_1692353043.mgf
15 Dec 2023 02:00:37,204 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f49edaa4-ff7b-4619-9c1c-24e897a15358_1692353043.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f49edaa4-ff7b-4619-9c1c-24e897a15358_1692353043.mgf
15 Dec 2023 02:00:37,205 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F3_S1-A12_1_2888.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F3_S1-A12_1_2888.d.zip
15 Dec 2023 02:00:37,206 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F3_S1-A12_1_2888.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F3_S1-A12_1_2888.d.zip
15 Dec 2023 02:00:37,208 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F3_2_S4-A11_1_4478.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F3_2_S4-A11_1_4478.d.zip
15 Dec 2023 02:00:37,209 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F3_2_S4-A11_1_4478.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F3_2_S4-A11_1_4478.d.zip
15 Dec 2023 02:00:37,211 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/038dc1c5-369b-4020-bd0d-663497ddab76_1692281985.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/038dc1c5-369b-4020-bd0d-663497ddab76_1692281985.mgf
15 Dec 2023 02:00:37,212 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/038dc1c5-369b-4020-bd0d-663497ddab76_1692281985.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/038dc1c5-369b-4020-bd0d-663497ddab76_1692281985.mgf
15 Dec 2023 02:00:37,214 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2426cbf8-a1b9-495c-8ee6-da5ca21db3b1_1692310690.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2426cbf8-a1b9-495c-8ee6-da5ca21db3b1_1692310690.mgf
15 Dec 2023 02:00:37,215 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2426cbf8-a1b9-495c-8ee6-da5ca21db3b1_1692310690.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2426cbf8-a1b9-495c-8ee6-da5ca21db3b1_1692310690.mgf
15 Dec 2023 02:00:37,218 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2ba369d2-383a-48c7-b682-db5b97ffdd11_1688259819.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2ba369d2-383a-48c7-b682-db5b97ffdd11_1688259819.mgf
15 Dec 2023 02:00:37,219 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2ba369d2-383a-48c7-b682-db5b97ffdd11_1688259819.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2ba369d2-383a-48c7-b682-db5b97ffdd11_1688259819.mgf
15 Dec 2023 02:00:37,222 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F1-4_2_S4-E6_1_4523.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F1-4_2_S4-E6_1_4523.d.zip
15 Dec 2023 02:00:37,223 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F1-4_2_S4-E6_1_4523.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F1-4_2_S4-E6_1_4523.d.zip
15 Dec 2023 02:00:37,226 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e6f10182-3bc6-41b7-b5e4-f114113d872a_1688155270.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e6f10182-3bc6-41b7-b5e4-f114113d872a_1688155270.mgf
15 Dec 2023 02:00:37,227 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e6f10182-3bc6-41b7-b5e4-f114113d872a_1688155270.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e6f10182-3bc6-41b7-b5e4-f114113d872a_1688155270.mgf
15 Dec 2023 02:00:37,230 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/86662164-edaa-4afb-9eea-dd6928b93e59_1692377636.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/86662164-edaa-4afb-9eea-dd6928b93e59_1692377636.mgf
15 Dec 2023 02:00:37,231 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/86662164-edaa-4afb-9eea-dd6928b93e59_1692377636.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/86662164-edaa-4afb-9eea-dd6928b93e59_1692377636.mgf
15 Dec 2023 02:00:37,234 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F5_S2-D8_1_2914.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F5_S2-D8_1_2914.d.zip
15 Dec 2023 02:00:37,235 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F5_S2-D8_1_2914.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F5_S2-D8_1_2914.d.zip
15 Dec 2023 02:00:37,238 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F1_S1-C3_1_2834.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F1_S1-C3_1_2834.d.zip
15 Dec 2023 02:00:37,239 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F1_S1-C3_1_2834.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F1_S1-C3_1_2834.d.zip
15 Dec 2023 02:00:37,242 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F5_S2-D7_1_2847.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F5_S2-D7_1_2847.d.zip
15 Dec 2023 02:00:37,245 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F5_S2-D7_1_2847.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F5_S2-D7_1_2847.d.zip
15 Dec 2023 02:00:37,248 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F1-4_1_S4-F3_1_4532.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F1-4_1_S4-F3_1_4532.d.zip
15 Dec 2023 02:00:37,249 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F1-4_1_S4-F3_1_4532.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F1-4_1_S4-F3_1_4532.d.zip
15 Dec 2023 02:00:37,290 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C7_1_2839.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C7_1_2839.d.zip
15 Dec 2023 02:00:37,292 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C7_1_2839.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F5_S2-C7_1_2839.d.zip
15 Dec 2023 02:00:37,301 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/522a28b7-eae3-468d-bf14-14b3726a19df_1688221737.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/522a28b7-eae3-468d-bf14-14b3726a19df_1688221737.mgf
15 Dec 2023 02:00:37,303 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/522a28b7-eae3-468d-bf14-14b3726a19df_1688221737.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/522a28b7-eae3-468d-bf14-14b3726a19df_1688221737.mgf
15 Dec 2023 02:00:37,341 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F2_1_S4-H4_1_4557.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F2_1_S4-H4_1_4557.d.zip
15 Dec 2023 02:00:37,343 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F2_1_S4-H4_1_4557.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F2_1_S4-H4_1_4557.d.zip
15 Dec 2023 02:00:37,349 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a3e0b416-daa0-475e-9198-735d04c50fd4_1692369100.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a3e0b416-daa0-475e-9198-735d04c50fd4_1692369100.mgf
15 Dec 2023 02:00:37,350 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a3e0b416-daa0-475e-9198-735d04c50fd4_1692369100.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a3e0b416-daa0-475e-9198-735d04c50fd4_1692369100.mgf
15 Dec 2023 02:00:37,354 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2438824a-27d3-45ee-865f-e28501bb38c2_1688231112.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2438824a-27d3-45ee-865f-e28501bb38c2_1688231112.mgf
15 Dec 2023 02:00:37,356 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2438824a-27d3-45ee-865f-e28501bb38c2_1688231112.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2438824a-27d3-45ee-865f-e28501bb38c2_1688231112.mgf
15 Dec 2023 02:00:37,360 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F1-4_1_S4-C9_1_4500.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F1-4_1_S4-C9_1_4500.d.zip
15 Dec 2023 02:00:37,362 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F1-4_1_S4-C9_1_4500.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F1-4_1_S4-C9_1_4500.d.zip
15 Dec 2023 02:00:37,367 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F1-4_2_S1-A8_1_4575.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F1-4_2_S1-A8_1_4575.d.zip
15 Dec 2023 02:00:37,370 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F1-4_2_S1-A8_1_4575.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F1-4_2_S1-A8_1_4575.d.zip
15 Dec 2023 02:00:37,373 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F3_1_S1-A4_1_4571.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F3_1_S1-A4_1_4571.d.zip
15 Dec 2023 02:00:37,413 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F3_1_S1-A4_1_4571.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F3_1_S1-A4_1_4571.d.zip
15 Dec 2023 02:00:37,419 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F1-4_1_S4-B11_1_4490.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F1-4_1_S4-B11_1_4490.d.zip
15 Dec 2023 02:00:37,421 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F1-4_1_S4-B11_1_4490.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F1-4_1_S4-B11_1_4490.d.zip
15 Dec 2023 02:00:37,427 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/07787fb6-b7cd-446f-8a56-0d00c8bc3813_1688321758.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/07787fb6-b7cd-446f-8a56-0d00c8bc3813_1688321758.mgf
15 Dec 2023 02:00:37,428 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/07787fb6-b7cd-446f-8a56-0d00c8bc3813_1688321758.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/07787fb6-b7cd-446f-8a56-0d00c8bc3813_1688321758.mgf
15 Dec 2023 02:00:37,431 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12a98c18-08c2-439d-ad41-5edce2d3b994_1688572653.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12a98c18-08c2-439d-ad41-5edce2d3b994_1688572653.mgf
15 Dec 2023 02:00:37,435 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12a98c18-08c2-439d-ad41-5edce2d3b994_1688572653.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12a98c18-08c2-439d-ad41-5edce2d3b994_1688572653.mgf
15 Dec 2023 02:00:37,438 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F3_S1-H11_1_2880.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F3_S1-H11_1_2880.d.zip
15 Dec 2023 02:00:37,439 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F3_S1-H11_1_2880.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F3_S1-H11_1_2880.d.zip
15 Dec 2023 02:00:37,442 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F5_S2-A8_1_2890.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F5_S2-A8_1_2890.d.zip
15 Dec 2023 02:00:37,446 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F5_S2-A8_1_2890.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F5_S2-A8_1_2890.d.zip
15 Dec 2023 02:00:37,474 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F3_1_S1-H2_1_4457.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F3_1_S1-H2_1_4457.d.zip
15 Dec 2023 02:00:37,475 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F3_1_S1-H2_1_4457.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F3_1_S1-H2_1_4457.d.zip
15 Dec 2023 02:00:37,504 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c1e2d473-9172-4c60-a7c6-87bf1613209d_1688309536.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c1e2d473-9172-4c60-a7c6-87bf1613209d_1688309536.mgf
15 Dec 2023 02:00:37,506 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c1e2d473-9172-4c60-a7c6-87bf1613209d_1688309536.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c1e2d473-9172-4c60-a7c6-87bf1613209d_1688309536.mgf
15 Dec 2023 02:00:37,509 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/872fc59b-4bf4-4cc4-900d-cc97490c8dea_1688568386.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/872fc59b-4bf4-4cc4-900d-cc97490c8dea_1688568386.mgf
15 Dec 2023 02:00:37,511 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/872fc59b-4bf4-4cc4-900d-cc97490c8dea_1688568386.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/872fc59b-4bf4-4cc4-900d-cc97490c8dea_1688568386.mgf
15 Dec 2023 02:00:37,542 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3d66876b-5bcb-4a0b-8a76-77171efa760b_1688293632.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3d66876b-5bcb-4a0b-8a76-77171efa760b_1688293632.mgf
15 Dec 2023 02:00:37,546 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3d66876b-5bcb-4a0b-8a76-77171efa760b_1688293632.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3d66876b-5bcb-4a0b-8a76-77171efa760b_1688293632.mgf
15 Dec 2023 02:00:37,551 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/85c0cb1b-b5b1-4f41-aab6-6553875501c4_1692337976.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/85c0cb1b-b5b1-4f41-aab6-6553875501c4_1692337976.mgf
15 Dec 2023 02:00:37,553 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/85c0cb1b-b5b1-4f41-aab6-6553875501c4_1692337976.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/85c0cb1b-b5b1-4f41-aab6-6553875501c4_1692337976.mgf
15 Dec 2023 02:00:37,558 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F2_S1-F7_1_2860.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F2_S1-F7_1_2860.d.zip
15 Dec 2023 02:00:37,562 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F2_S1-F7_1_2860.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F2_S1-F7_1_2860.d.zip
15 Dec 2023 02:00:37,577 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a4daa484-5461-434c-9630-38451f942d23_1688270615.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a4daa484-5461-434c-9630-38451f942d23_1688270615.mgf
15 Dec 2023 02:00:37,579 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a4daa484-5461-434c-9630-38451f942d23_1688270615.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a4daa484-5461-434c-9630-38451f942d23_1688270615.mgf
15 Dec 2023 02:00:37,612 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F1_S1-B3_1_2826.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F1_S1-B3_1_2826.d.zip
15 Dec 2023 02:00:37,614 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F1_S1-B3_1_2826.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F1_S1-B3_1_2826.d.zip
15 Dec 2023 02:00:37,617 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F1-4_2_S4-H10_1_4563.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F1-4_2_S4-H10_1_4563.d.zip
15 Dec 2023 02:00:37,618 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F1-4_2_S4-H10_1_4563.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F1-4_2_S4-H10_1_4563.d.zip
15 Dec 2023 02:00:37,646 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (1).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (1).mzid
15 Dec 2023 02:00:37,647 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (1).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (1).mzid
15 Dec 2023 02:00:37,680 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F4_S1-A8_1_3066.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F4_S1-A8_1_3066.d.zip
15 Dec 2023 02:00:37,682 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F4_S1-A8_1_3066.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F4_S1-A8_1_3066.d.zip
15 Dec 2023 02:00:37,716 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F2_S1-E7_1_2852.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F2_S1-E7_1_2852.d.zip
15 Dec 2023 02:00:37,717 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F2_S1-E7_1_2852.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F2_S1-E7_1_2852.d.zip
15 Dec 2023 02:00:37,724 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0f6d035f-3d95-43e1-9f34-4fc55c53d979_1692324333.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0f6d035f-3d95-43e1-9f34-4fc55c53d979_1692324333.mgf
15 Dec 2023 02:00:37,750 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0f6d035f-3d95-43e1-9f34-4fc55c53d979_1692324333.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0f6d035f-3d95-43e1-9f34-4fc55c53d979_1692324333.mgf
15 Dec 2023 02:00:37,757 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F3_2_S4-F1_1_4530.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F3_2_S4-F1_1_4530.d.zip
15 Dec 2023 02:00:38,115 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F3_2_S4-F1_1_4530.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F3_2_S4-F1_1_4530.d.zip
15 Dec 2023 02:00:38,119 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c376148c-60e4-438b-87a6-c9b3152ea9dd_1688304430.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c376148c-60e4-438b-87a6-c9b3152ea9dd_1688304430.mgf
15 Dec 2023 02:00:38,121 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c376148c-60e4-438b-87a6-c9b3152ea9dd_1688304430.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c376148c-60e4-438b-87a6-c9b3152ea9dd_1688304430.mgf
15 Dec 2023 02:00:38,127 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F3_S1-B11_1_2828.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F3_S1-B11_1_2828.d.zip
15 Dec 2023 02:00:38,129 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F3_S1-B11_1_2828.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F3_S1-B11_1_2828.d.zip
15 Dec 2023 02:00:38,132 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F1_S1-H3_1_2878.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F1_S1-H3_1_2878.d.zip
15 Dec 2023 02:00:38,135 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F1_S1-H3_1_2878.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F1_S1-H3_1_2878.d.zip
15 Dec 2023 02:00:38,138 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6da02e06-5df1-40ec-b88e-cd8ab35db669_1692357312.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6da02e06-5df1-40ec-b88e-cd8ab35db669_1692357312.mgf
15 Dec 2023 02:00:38,140 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6da02e06-5df1-40ec-b88e-cd8ab35db669_1692357312.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6da02e06-5df1-40ec-b88e-cd8ab35db669_1692357312.mgf
15 Dec 2023 02:00:38,143 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/25f8efeb-3d9a-41f7-af87-2049f5498b5c_1688301585.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/25f8efeb-3d9a-41f7-af87-2049f5498b5c_1688301585.mgf
15 Dec 2023 02:00:38,145 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/25f8efeb-3d9a-41f7-af87-2049f5498b5c_1688301585.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/25f8efeb-3d9a-41f7-af87-2049f5498b5c_1688301585.mgf
15 Dec 2023 02:00:38,155 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ed74f19f-cd34-48d6-8f1c-d871840c523b_1688326025.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ed74f19f-cd34-48d6-8f1c-d871840c523b_1688326025.mgf
15 Dec 2023 02:00:38,157 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ed74f19f-cd34-48d6-8f1c-d871840c523b_1688326025.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ed74f19f-cd34-48d6-8f1c-d871840c523b_1688326025.mgf
15 Dec 2023 02:00:38,160 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8c28a9cb-5137-4afa-9fc3-ce09167d08a5_1692212734.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8c28a9cb-5137-4afa-9fc3-ce09167d08a5_1692212734.mgf
15 Dec 2023 02:00:38,169 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8c28a9cb-5137-4afa-9fc3-ce09167d08a5_1692212734.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8c28a9cb-5137-4afa-9fc3-ce09167d08a5_1692212734.mgf
15 Dec 2023 02:00:38,173 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12fcec38-09b1-41bd-aafc-3f48663e43de_1688269191.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12fcec38-09b1-41bd-aafc-3f48663e43de_1688269191.mgf
15 Dec 2023 02:00:38,174 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12fcec38-09b1-41bd-aafc-3f48663e43de_1688269191.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12fcec38-09b1-41bd-aafc-3f48663e43de_1688269191.mgf
15 Dec 2023 02:00:38,178 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F3_S1-E12_1_2920.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F3_S1-E12_1_2920.d.zip
15 Dec 2023 02:00:38,204 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F3_S1-E12_1_2920.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F3_S1-E12_1_2920.d.zip
15 Dec 2023 02:00:38,208 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F3_2_S4-D5_1_4510.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F3_2_S4-D5_1_4510.d.zip
15 Dec 2023 02:00:38,209 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F3_2_S4-D5_1_4510.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F3_2_S4-D5_1_4510.d.zip
15 Dec 2023 02:00:38,213 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f6429a4a-84e4-4121-be65-9a8f2f4429f3_1688324603.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f6429a4a-84e4-4121-be65-9a8f2f4429f3_1688324603.mgf
15 Dec 2023 02:00:38,214 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f6429a4a-84e4-4121-be65-9a8f2f4429f3_1688324603.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f6429a4a-84e4-4121-be65-9a8f2f4429f3_1688324603.mgf
15 Dec 2023 02:00:38,218 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ef13c31a-1b14-4fab-8269-1ee57b6049b9_1688224582.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ef13c31a-1b14-4fab-8269-1ee57b6049b9_1688224582.mgf
15 Dec 2023 02:00:38,220 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ef13c31a-1b14-4fab-8269-1ee57b6049b9_1688224582.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ef13c31a-1b14-4fab-8269-1ee57b6049b9_1688224582.mgf
15 Dec 2023 02:00:38,223 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F4_S2-D3_1_2846.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F4_S2-D3_1_2846.d.zip
15 Dec 2023 02:00:38,225 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F4_S2-D3_1_2846.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F4_S2-D3_1_2846.d.zip
15 Dec 2023 02:00:38,233 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F3_1_S4-F10_1_4539.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F3_1_S4-F10_1_4539.d.zip
15 Dec 2023 02:00:38,237 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F3_1_S4-F10_1_4539.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F3_1_S4-F10_1_4539.d.zip
15 Dec 2023 02:00:38,240 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/def4414a-3774-4ac5-8a84-fbd6e58249e0_1688147317.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/def4414a-3774-4ac5-8a84-fbd6e58249e0_1688147317.mgf
15 Dec 2023 02:00:38,241 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/def4414a-3774-4ac5-8a84-fbd6e58249e0_1688147317.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/def4414a-3774-4ac5-8a84-fbd6e58249e0_1688147317.mgf
15 Dec 2023 02:00:38,244 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (14).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (14).mzid
15 Dec 2023 02:00:38,246 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (14).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (14).mzid
15 Dec 2023 02:00:38,249 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F2_S1-D7_1_2844.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F2_S1-D7_1_2844.d.zip
15 Dec 2023 02:00:38,252 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F2_S1-D7_1_2844.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F2_S1-D7_1_2844.d.zip
15 Dec 2023 02:00:38,276 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9696bb3d-0740-4092-b5ad-88f835c548dd_1692196245.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9696bb3d-0740-4092-b5ad-88f835c548dd_1692196245.mgf
15 Dec 2023 02:00:38,278 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9696bb3d-0740-4092-b5ad-88f835c548dd_1692196245.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9696bb3d-0740-4092-b5ad-88f835c548dd_1692196245.mgf
15 Dec 2023 02:00:38,281 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6df3f5d3-a808-425f-9ba0-a1ea665c3326_1688303007.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6df3f5d3-a808-425f-9ba0-a1ea665c3326_1688303007.mgf
15 Dec 2023 02:00:38,282 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6df3f5d3-a808-425f-9ba0-a1ea665c3326_1688303007.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6df3f5d3-a808-425f-9ba0-a1ea665c3326_1688303007.mgf
15 Dec 2023 02:00:38,285 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0c51c3c4-3e3b-49f1-9dbe-6cd985d1597c_1688246174.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0c51c3c4-3e3b-49f1-9dbe-6cd985d1597c_1688246174.mgf
15 Dec 2023 02:00:38,287 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0c51c3c4-3e3b-49f1-9dbe-6cd985d1597c_1688246174.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0c51c3c4-3e3b-49f1-9dbe-6cd985d1597c_1688246174.mgf
15 Dec 2023 02:00:38,290 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (5).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (5).mzid
15 Dec 2023 02:00:38,315 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (5).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (5).mzid
15 Dec 2023 02:00:38,319 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F3_1_S1-G4_1_4447.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F3_1_S1-G4_1_4447.d.zip
15 Dec 2023 02:00:38,320 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F3_1_S1-G4_1_4447.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F3_1_S1-G4_1_4447.d.zip
15 Dec 2023 02:00:38,326 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F3_S1-E11_1_2853.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F3_S1-E11_1_2853.d.zip
15 Dec 2023 02:00:38,327 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F3_S1-E11_1_2853.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F3_S1-E11_1_2853.d.zip
15 Dec 2023 02:00:38,340 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F2_S1-C7_1_2835.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F2_S1-C7_1_2835.d.zip
15 Dec 2023 02:00:38,342 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F2_S1-C7_1_2835.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F2_S1-C7_1_2835.d.zip
15 Dec 2023 02:00:38,344 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0d8c3a8f-c78a-4a68-943f-0b8ab65526d1_1688267768.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0d8c3a8f-c78a-4a68-943f-0b8ab65526d1_1688267768.mgf
15 Dec 2023 02:00:38,345 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0d8c3a8f-c78a-4a68-943f-0b8ab65526d1_1688267768.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0d8c3a8f-c78a-4a68-943f-0b8ab65526d1_1688267768.mgf
15 Dec 2023 02:00:38,347 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A11_1_2820.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A11_1_2820.d.zip
15 Dec 2023 02:00:38,348 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A11_1_2820.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A11_1_2820.d.zip
15 Dec 2023 02:00:38,350 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F4_S2-C4_1_2905.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F4_S2-C4_1_2905.d.zip
15 Dec 2023 02:00:38,351 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F4_S2-C4_1_2905.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F4_S2-C4_1_2905.d.zip
15 Dec 2023 02:00:38,353 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F3_2_S1-A5_1_4572.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F3_2_S1-A5_1_4572.d.zip
15 Dec 2023 02:00:38,353 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F3_2_S1-A5_1_4572.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F3_2_S1-A5_1_4572.d.zip
15 Dec 2023 02:00:38,356 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F1_S1-A4_1_2886.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F1_S1-A4_1_2886.d.zip
15 Dec 2023 02:00:38,357 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F1_S1-A4_1_2886.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F1_S1-A4_1_2886.d.zip
15 Dec 2023 02:00:38,359 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F1-4_2_S4-G12_1_4553.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F1-4_2_S4-G12_1_4553.d.zip
15 Dec 2023 02:00:38,360 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F1-4_2_S4-G12_1_4553.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F1-4_2_S4-G12_1_4553.d.zip
15 Dec 2023 02:00:38,362 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F2_1_S1-G12_1_4455.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F2_1_S1-G12_1_4455.d.zip
15 Dec 2023 02:00:38,363 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F2_1_S1-G12_1_4455.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F2_1_S1-G12_1_4455.d.zip
15 Dec 2023 02:00:38,366 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F1-4_2_S4-B2_1_4481.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F1-4_2_S4-B2_1_4481.d.zip
15 Dec 2023 02:00:38,367 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F1-4_2_S4-B2_1_4481.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F1-4_2_S4-B2_1_4481.d.zip
15 Dec 2023 02:00:38,368 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12cea1bd-25d1-4579-a273-b7d0b6e3910a_1692289099.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12cea1bd-25d1-4579-a273-b7d0b6e3910a_1692289099.mgf
15 Dec 2023 02:00:38,369 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/12cea1bd-25d1-4579-a273-b7d0b6e3910a_1692289099.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/12cea1bd-25d1-4579-a273-b7d0b6e3910a_1692289099.mgf
15 Dec 2023 02:00:38,371 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F3_2_S4-G9_1_4550.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F3_2_S4-G9_1_4550.d.zip
15 Dec 2023 02:00:38,372 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F3_2_S4-G9_1_4550.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F3_2_S4-G9_1_4550.d.zip
15 Dec 2023 02:00:38,374 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/83999097-7708-4b2f-8dff-f9f027745f2c_1692298472.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/83999097-7708-4b2f-8dff-f9f027745f2c_1692298472.mgf
15 Dec 2023 02:00:38,375 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/83999097-7708-4b2f-8dff-f9f027745f2c_1692298472.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/83999097-7708-4b2f-8dff-f9f027745f2c_1692298472.mgf
15 Dec 2023 02:00:38,377 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F3_1_S4-H6_1_4559.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F3_1_S4-H6_1_4559.d.zip
15 Dec 2023 02:00:38,378 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F3_1_S4-H6_1_4559.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F3_1_S4-H6_1_4559.d.zip
15 Dec 2023 02:00:38,380 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8f3447e0-4188-4f85-b525-38f67b283c7f_1688313807.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8f3447e0-4188-4f85-b525-38f67b283c7f_1688313807.mgf
15 Dec 2023 02:00:38,381 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8f3447e0-4188-4f85-b525-38f67b283c7f_1688313807.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8f3447e0-4188-4f85-b525-38f67b283c7f_1688313807.mgf
15 Dec 2023 02:00:38,383 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F4_S2-F3_1_2862.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F4_S2-F3_1_2862.d.zip
15 Dec 2023 02:00:38,384 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F4_S2-F3_1_2862.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F4_S2-F3_1_2862.d.zip
15 Dec 2023 02:00:38,385 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F3_2_S4-C7_1_4498.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F3_2_S4-C7_1_4498.d.zip
15 Dec 2023 02:00:38,387 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F3_2_S4-C7_1_4498.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F3_2_S4-C7_1_4498.d.zip
15 Dec 2023 02:00:38,389 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A6_1_3065.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A6_1_3065.d.zip
15 Dec 2023 02:00:38,390 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A6_1_3065.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F3_S1-A6_1_3065.d.zip
15 Dec 2023 02:00:38,392 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F2_S1-B7_1_2827.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F2_S1-B7_1_2827.d.zip
15 Dec 2023 02:00:38,393 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.9_F2_S1-B7_1_2827.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.9_F2_S1-B7_1_2827.d.zip
15 Dec 2023 02:00:38,395 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F1_S1-D4_1_2910.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F1_S1-D4_1_2910.d.zip
15 Dec 2023 02:00:38,396 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F1_S1-D4_1_2910.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F1_S1-D4_1_2910.d.zip
15 Dec 2023 02:00:38,399 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/00c51992-4c03-45c0-a552-dd48fbaf1f35_1692249404.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/00c51992-4c03-45c0-a552-dd48fbaf1f35_1692249404.mgf
15 Dec 2023 02:00:38,400 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/00c51992-4c03-45c0-a552-dd48fbaf1f35_1692249404.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/00c51992-4c03-45c0-a552-dd48fbaf1f35_1692249404.mgf
15 Dec 2023 02:00:38,402 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6c9fc2f6-0661-4fca-b5dc-8dfd22373f08_1692222112.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6c9fc2f6-0661-4fca-b5dc-8dfd22373f08_1692222112.mgf
15 Dec 2023 02:00:38,403 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6c9fc2f6-0661-4fca-b5dc-8dfd22373f08_1692222112.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6c9fc2f6-0661-4fca-b5dc-8dfd22373f08_1692222112.mgf
15 Dec 2023 02:00:38,405 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (4).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (4).mzid
15 Dec 2023 02:00:38,406 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (4).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (4).mzid
15 Dec 2023 02:00:38,408 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3e456ea9-80a1-4530-aa08-8113c9b88ee8_1688159538.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3e456ea9-80a1-4530-aa08-8113c9b88ee8_1688159538.mgf
15 Dec 2023 02:00:38,410 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3e456ea9-80a1-4530-aa08-8113c9b88ee8_1688159538.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3e456ea9-80a1-4530-aa08-8113c9b88ee8_1688159538.mgf
15 Dec 2023 02:00:38,412 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F5_S2-B8_1_2898.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F5_S2-B8_1_2898.d.zip
15 Dec 2023 02:00:38,413 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F5_S2-B8_1_2898.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F5_S2-B8_1_2898.d.zip
15 Dec 2023 02:00:38,415 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d073518b-2464-4de2-8283-e18944fb186e_1688218892.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d073518b-2464-4de2-8283-e18944fb186e_1688218892.mgf
15 Dec 2023 02:00:38,416 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d073518b-2464-4de2-8283-e18944fb186e_1688218892.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d073518b-2464-4de2-8283-e18944fb186e_1688218892.mgf
15 Dec 2023 02:00:38,418 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e7a46d39-9143-4ba3-83ea-a34dbf10192c_1692208465.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e7a46d39-9143-4ba3-83ea-a34dbf10192c_1692208465.mgf
15 Dec 2023 02:00:38,419 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e7a46d39-9143-4ba3-83ea-a34dbf10192c_1692208465.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e7a46d39-9143-4ba3-83ea-a34dbf10192c_1692208465.mgf
15 Dec 2023 02:00:38,421 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/841255c3-eb04-45c5-aa47-0a64bf08e753_1692373369.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/841255c3-eb04-45c5-aa47-0a64bf08e753_1692373369.mgf
15 Dec 2023 02:00:38,422 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/841255c3-eb04-45c5-aa47-0a64bf08e753_1692373369.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/841255c3-eb04-45c5-aa47-0a64bf08e753_1692373369.mgf
15 Dec 2023 02:00:38,426 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F3_S1-D12_1_2912.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F3_S1-D12_1_2912.d.zip
15 Dec 2023 02:00:38,427 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F3_S1-D12_1_2912.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F3_S1-D12_1_2912.d.zip
15 Dec 2023 02:00:38,429 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F2_1_S4-E10_1_4527.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F2_1_S4-E10_1_4527.d.zip
15 Dec 2023 02:00:38,431 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F2_1_S4-E10_1_4527.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F2_1_S4-E10_1_4527.d.zip
15 Dec 2023 02:00:38,432 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/14aa3bf7-8a73-4158-b097-7fb06cf9cef7_1692235758.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/14aa3bf7-8a73-4158-b097-7fb06cf9cef7_1692235758.mgf
15 Dec 2023 02:00:38,433 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/14aa3bf7-8a73-4158-b097-7fb06cf9cef7_1692235758.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/14aa3bf7-8a73-4158-b097-7fb06cf9cef7_1692235758.mgf
15 Dec 2023 02:00:38,435 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a795219b-d989-49dd-9f55-5d41ad82530d_1692226379.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a795219b-d989-49dd-9f55-5d41ad82530d_1692226379.mgf
15 Dec 2023 02:00:38,436 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a795219b-d989-49dd-9f55-5d41ad82530d_1692226379.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a795219b-d989-49dd-9f55-5d41ad82530d_1692226379.mgf
15 Dec 2023 02:00:38,438 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9f761956-3e52-4d9a-992e-51b5a6a59a1e_1692237180.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9f761956-3e52-4d9a-992e-51b5a6a59a1e_1692237180.mgf
15 Dec 2023 02:00:38,440 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/9f761956-3e52-4d9a-992e-51b5a6a59a1e_1692237180.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/9f761956-3e52-4d9a-992e-51b5a6a59a1e_1692237180.mgf
15 Dec 2023 02:00:38,442 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a185b6f7-55fa-41ca-85a2-a6d48e8a544e_1688287941.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a185b6f7-55fa-41ca-85a2-a6d48e8a544e_1688287941.mgf
15 Dec 2023 02:00:38,443 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a185b6f7-55fa-41ca-85a2-a6d48e8a544e_1688287941.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a185b6f7-55fa-41ca-85a2-a6d48e8a544e_1688287941.mgf
15 Dec 2023 02:00:38,445 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F2_2_S4-F9_1_4538.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F2_2_S4-F9_1_4538.d.zip
15 Dec 2023 02:00:38,447 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F2_2_S4-F9_1_4538.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F2_2_S4-F9_1_4538.d.zip
15 Dec 2023 02:00:38,448 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6a2311dc-5a89-4d5d-a44a-66ee980a87a0_1692263047.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6a2311dc-5a89-4d5d-a44a-66ee980a87a0_1692263047.mgf
15 Dec 2023 02:00:38,450 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6a2311dc-5a89-4d5d-a44a-66ee980a87a0_1692263047.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6a2311dc-5a89-4d5d-a44a-66ee980a87a0_1692263047.mgf
15 Dec 2023 02:00:38,451 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/05383cfe-62be-4da8-9894-2b6e75b054ba_1688255549.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/05383cfe-62be-4da8-9894-2b6e75b054ba_1688255549.mgf
15 Dec 2023 02:00:38,452 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/05383cfe-62be-4da8-9894-2b6e75b054ba_1688255549.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/05383cfe-62be-4da8-9894-2b6e75b054ba_1688255549.mgf
15 Dec 2023 02:00:38,454 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/485bb0f9-0e14-4b9b-8c33-2b2912e4ba27_1688272038.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/485bb0f9-0e14-4b9b-8c33-2b2912e4ba27_1688272038.mgf
15 Dec 2023 02:00:38,455 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/485bb0f9-0e14-4b9b-8c33-2b2912e4ba27_1688272038.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/485bb0f9-0e14-4b9b-8c33-2b2912e4ba27_1688272038.mgf
15 Dec 2023 02:00:38,457 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F1-4_1_S4-G1_1_4542.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F1-4_1_S4-G1_1_4542.d.zip
15 Dec 2023 02:00:38,459 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F1-4_1_S4-G1_1_4542.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F1-4_1_S4-G1_1_4542.d.zip
15 Dec 2023 02:00:38,461 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F2_1_S1-A2_1_4569.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F2_1_S1-A2_1_4569.d.zip
15 Dec 2023 02:00:38,462 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F2_1_S1-A2_1_4569.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F2_1_S1-A2_1_4569.d.zip
15 Dec 2023 02:00:38,464 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/bd9770df-adeb-4549-adf4-f7f7842fba7c_1688156693.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/bd9770df-adeb-4549-adf4-f7f7842fba7c_1688156693.mgf
15 Dec 2023 02:00:38,465 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/bd9770df-adeb-4549-adf4-f7f7842fba7c_1688156693.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/bd9770df-adeb-4549-adf4-f7f7842fba7c_1688156693.mgf
15 Dec 2023 02:00:38,468 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4f8a3199-62e8-4f33-9461-cc7ba9ceb608_1692260203.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4f8a3199-62e8-4f33-9461-cc7ba9ceb608_1692260203.mgf
15 Dec 2023 02:00:38,536 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4f8a3199-62e8-4f33-9461-cc7ba9ceb608_1692260203.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4f8a3199-62e8-4f33-9461-cc7ba9ceb608_1692260203.mgf
15 Dec 2023 02:00:38,538 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F1-4_1_S1-G7_1_4450.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F1-4_1_S1-G7_1_4450.d.zip
15 Dec 2023 02:00:38,540 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F1-4_1_S1-G7_1_4450.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F1-4_1_S1-G7_1_4450.d.zip
15 Dec 2023 02:00:38,541 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F3_S1-C11_1_2836.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F3_S1-C11_1_2836.d.zip
15 Dec 2023 02:00:38,543 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.15_F3_S1-C11_1_2836.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.15_F3_S1-C11_1_2836.d.zip
15 Dec 2023 02:00:38,544 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F3_S1-B12_1_2896.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F3_S1-B12_1_2896.d.zip
15 Dec 2023 02:00:38,546 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F3_S1-B12_1_2896.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F3_S1-B12_1_2896.d.zip
15 Dec 2023 02:00:38,548 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0fe1bb77-c5da-49fc-956e-8f3ca840799b_1688143050.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0fe1bb77-c5da-49fc-956e-8f3ca840799b_1688143050.mgf
15 Dec 2023 02:00:38,549 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0fe1bb77-c5da-49fc-956e-8f3ca840799b_1688143050.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0fe1bb77-c5da-49fc-956e-8f3ca840799b_1688143050.mgf
15 Dec 2023 02:00:38,552 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F2_1_S4-F8_1_4537.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F2_1_S4-F8_1_4537.d.zip
15 Dec 2023 02:00:38,553 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.29_F2_1_S4-F8_1_4537.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.29_F2_1_S4-F8_1_4537.d.zip
15 Dec 2023 02:00:38,555 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F3_1_S4-C6_1_4497.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F3_1_S4-C6_1_4497.d.zip
15 Dec 2023 02:00:38,556 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F3_1_S4-C6_1_4497.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F3_1_S4-C6_1_4497.d.zip
15 Dec 2023 02:00:38,558 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F1_S1-F3_1_2859.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F1_S1-F3_1_2859.d.zip
15 Dec 2023 02:00:38,559 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F1_S1-F3_1_2859.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F1_S1-F3_1_2859.d.zip
15 Dec 2023 02:00:38,561 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ad08f8e3-cb47-427e-82b3-3250a367866a_1688315230.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ad08f8e3-cb47-427e-82b3-3250a367866a_1688315230.mgf
15 Dec 2023 02:00:38,562 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ad08f8e3-cb47-427e-82b3-3250a367866a_1688315230.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ad08f8e3-cb47-427e-82b3-3250a367866a_1688315230.mgf
15 Dec 2023 02:00:38,564 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F2_2_S1-A3_1_4570.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F2_2_S1-A3_1_4570.d.zip
15 Dec 2023 02:00:38,565 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F2_2_S1-A3_1_4570.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F2_2_S1-A3_1_4570.d.zip
15 Dec 2023 02:00:38,567 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F3_S1-F11_1_2861.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F3_S1-F11_1_2861.d.zip
15 Dec 2023 02:00:38,568 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.35_F3_S1-F11_1_2861.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.35_F3_S1-F11_1_2861.d.zip
15 Dec 2023 02:00:38,570 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F2_2_S4-G7_1_4548.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F2_2_S4-G7_1_4548.d.zip
15 Dec 2023 02:00:38,571 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F2_2_S4-G7_1_4548.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F2_2_S4-G7_1_4548.d.zip
15 Dec 2023 02:00:38,573 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F1-4_2_S4-B12_1_4491.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F1-4_2_S4-B12_1_4491.d.zip
15 Dec 2023 02:00:38,574 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F1-4_2_S4-B12_1_4491.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F1-4_2_S4-B12_1_4491.d.zip
15 Dec 2023 02:00:38,576 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F4_S2-E3_1_2854.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F4_S2-E3_1_2854.d.zip
15 Dec 2023 02:00:38,577 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F4_S2-E3_1_2854.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F4_S2-E3_1_2854.d.zip
15 Dec 2023 02:00:38,579 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/22f36c55-c73b-4df4-90b2-9028596ba5dc_1688258395.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/22f36c55-c73b-4df4-90b2-9028596ba5dc_1688258395.mgf
15 Dec 2023 02:00:38,580 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/22f36c55-c73b-4df4-90b2-9028596ba5dc_1688258395.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/22f36c55-c73b-4df4-90b2-9028596ba5dc_1688258395.mgf
15 Dec 2023 02:00:38,582 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F1-4_1_S1-H5_1_4460.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F1-4_1_S1-H5_1_4460.d.zip
15 Dec 2023 02:00:38,583 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F1-4_1_S1-H5_1_4460.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F1-4_1_S1-H5_1_4460.d.zip
15 Dec 2023 02:00:38,585 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5a179279-082b-4239-ae5f-741973fbf912_1692209888.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5a179279-082b-4239-ae5f-741973fbf912_1692209888.mgf
15 Dec 2023 02:00:38,586 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5a179279-082b-4239-ae5f-741973fbf912_1692209888.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5a179279-082b-4239-ae5f-741973fbf912_1692209888.mgf
15 Dec 2023 02:00:38,588 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F3_1_S1-H12_1_4467.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F3_1_S1-H12_1_4467.d.zip
15 Dec 2023 02:00:38,589 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F3_1_S1-H12_1_4467.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F3_1_S1-H12_1_4467.d.zip
15 Dec 2023 02:00:38,591 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F2_S1-H7_1_2879.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F2_S1-H7_1_2879.d.zip
15 Dec 2023 02:00:38,592 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F2_S1-H7_1_2879.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F2_S1-H7_1_2879.d.zip
15 Dec 2023 02:00:38,594 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/40c27072-d098-4f5f-8a1e-ca1054e99c07_1692299895.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/40c27072-d098-4f5f-8a1e-ca1054e99c07_1692299895.mgf
15 Dec 2023 02:00:38,596 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/40c27072-d098-4f5f-8a1e-ca1054e99c07_1692299895.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/40c27072-d098-4f5f-8a1e-ca1054e99c07_1692299895.mgf
15 Dec 2023 02:00:38,598 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (7).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (7).mzid
15 Dec 2023 02:00:38,599 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (7).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (7).mzid
15 Dec 2023 02:00:38,601 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a0c40d46-3838-4b2f-a1ea-6dafc2aa5505_1688168912.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a0c40d46-3838-4b2f-a1ea-6dafc2aa5505_1688168912.mgf
15 Dec 2023 02:00:38,602 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/a0c40d46-3838-4b2f-a1ea-6dafc2aa5505_1688168912.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/a0c40d46-3838-4b2f-a1ea-6dafc2aa5505_1688168912.mgf
15 Dec 2023 02:00:38,604 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ae5887b2-1b59-4bac-8a26-d9407b5722c8_1692339398.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ae5887b2-1b59-4bac-8a26-d9407b5722c8_1692339398.mgf
15 Dec 2023 02:00:38,607 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/ae5887b2-1b59-4bac-8a26-d9407b5722c8_1692339398.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/ae5887b2-1b59-4bac-8a26-d9407b5722c8_1692339398.mgf
15 Dec 2023 02:00:38,609 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7da209f9-1afa-485f-bfa0-3e762ed17706_1692312113.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7da209f9-1afa-485f-bfa0-3e762ed17706_1692312113.mgf
15 Dec 2023 02:00:38,610 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/7da209f9-1afa-485f-bfa0-3e762ed17706_1692312113.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/7da209f9-1afa-485f-bfa0-3e762ed17706_1692312113.mgf
15 Dec 2023 02:00:38,612 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F2_2_S4-E1_1_4518.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F2_2_S4-E1_1_4518.d.zip
15 Dec 2023 02:00:38,614 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F2_2_S4-E1_1_4518.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F2_2_S4-E1_1_4518.d.zip
15 Dec 2023 02:00:38,616 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F1_S1-G3_1_2870.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F1_S1-G3_1_2870.d.zip
15 Dec 2023 02:00:38,617 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F1_S1-G3_1_2870.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F1_S1-G3_1_2870.d.zip
15 Dec 2023 02:00:38,619 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8afa17a2-e5ca-4621-bd4b-c5834b037c94_1688281413.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8afa17a2-e5ca-4621-bd4b-c5834b037c94_1688281413.mgf
15 Dec 2023 02:00:38,620 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8afa17a2-e5ca-4621-bd4b-c5834b037c94_1688281413.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8afa17a2-e5ca-4621-bd4b-c5834b037c94_1688281413.mgf
15 Dec 2023 02:00:38,622 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (8).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (8).mzid
15 Dec 2023 02:00:38,623 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (8).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (8).mzid
15 Dec 2023 02:00:38,625 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (3).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (3).mzid
15 Dec 2023 02:00:38,626 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (3).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (3).mzid
15 Dec 2023 02:00:38,629 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F2_2_S4-C5_1_4496.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F2_2_S4-C5_1_4496.d.zip
15 Dec 2023 02:00:38,630 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F2_2_S4-C5_1_4496.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F2_2_S4-C5_1_4496.d.zip
15 Dec 2023 02:00:38,632 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F1-4_1_S4-D7_1_4512.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F1-4_1_S4-D7_1_4512.d.zip
15 Dec 2023 02:00:38,634 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.64_F1-4_1_S4-D7_1_4512.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.64_F1-4_1_S4-D7_1_4512.d.zip
15 Dec 2023 02:00:38,636 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F2_S1-E8_1_2919.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F2_S1-E8_1_2919.d.zip
15 Dec 2023 02:00:38,637 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F2_S1-E8_1_2919.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F2_S1-E8_1_2919.d.zip
15 Dec 2023 02:00:38,639 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F2_1_S4-G6_1_4547.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F2_1_S4-G6_1_4547.d.zip
15 Dec 2023 02:00:38,641 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F2_1_S4-G6_1_4547.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F2_1_S4-G6_1_4547.d.zip
15 Dec 2023 02:00:38,643 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F5_S2-E8_1_2922.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F5_S2-E8_1_2922.d.zip
15 Dec 2023 02:00:38,644 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F5_S2-E8_1_2922.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F5_S2-E8_1_2922.d.zip
15 Dec 2023 02:00:38,646 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2e4b6a05-2292-45b0-909c-11844571b94a_1692261625.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2e4b6a05-2292-45b0-909c-11844571b94a_1692261625.mgf
15 Dec 2023 02:00:38,647 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/2e4b6a05-2292-45b0-909c-11844571b94a_1692261625.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/2e4b6a05-2292-45b0-909c-11844571b94a_1692261625.mgf
15 Dec 2023 02:00:38,649 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f3e9e096-e600-4abf-ab09-9839879f6bdd_1688266345.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f3e9e096-e600-4abf-ab09-9839879f6bdd_1688266345.mgf
15 Dec 2023 02:00:38,650 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f3e9e096-e600-4abf-ab09-9839879f6bdd_1688266345.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f3e9e096-e600-4abf-ab09-9839879f6bdd_1688266345.mgf
15 Dec 2023 02:00:38,652 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/1e56a141-d9e7-43ba-8ee4-8e1b98194be0_1688144472.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/1e56a141-d9e7-43ba-8ee4-8e1b98194be0_1688144472.mgf
15 Dec 2023 02:00:38,653 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/1e56a141-d9e7-43ba-8ee4-8e1b98194be0_1688144472.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/1e56a141-d9e7-43ba-8ee4-8e1b98194be0_1688144472.mgf
15 Dec 2023 02:00:38,655 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4a189a88-adb7-4dc4-a81b-67218a6528f2_1688240484.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4a189a88-adb7-4dc4-a81b-67218a6528f2_1688240484.mgf
15 Dec 2023 02:00:38,657 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/4a189a88-adb7-4dc4-a81b-67218a6528f2_1688240484.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/4a189a88-adb7-4dc4-a81b-67218a6528f2_1688240484.mgf
15 Dec 2023 02:00:38,659 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F1-4_2_S1-H6_1_4461.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F1-4_2_S1-H6_1_4461.d.zip
15 Dec 2023 02:00:38,661 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F1-4_2_S1-H6_1_4461.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F1-4_2_S1-H6_1_4461.d.zip
15 Dec 2023 02:00:38,663 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F2_S1-C8_1_2903.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F2_S1-C8_1_2903.d.zip
15 Dec 2023 02:00:38,664 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.11_F2_S1-C8_1_2903.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.11_F2_S1-C8_1_2903.d.zip
15 Dec 2023 02:00:38,666 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F2_2_S1-H1_1_4456.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F2_2_S1-H1_1_4456.d.zip
15 Dec 2023 02:00:38,667 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.51_F2_2_S1-H1_1_4456.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.51_F2_2_S1-H1_1_4456.d.zip
15 Dec 2023 02:00:38,669 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3cfda932-9392-4c61-87f5-bd0c2b3a0c05_1692200515.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3cfda932-9392-4c61-87f5-bd0c2b3a0c05_1692200515.mgf
15 Dec 2023 02:00:38,670 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/3cfda932-9392-4c61-87f5-bd0c2b3a0c05_1692200515.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/3cfda932-9392-4c61-87f5-bd0c2b3a0c05_1692200515.mgf
15 Dec 2023 02:00:38,672 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6543abc0-45e8-4f2e-9387-2bfd4c095a58_1692250829.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6543abc0-45e8-4f2e-9387-2bfd4c095a58_1692250829.mgf
15 Dec 2023 02:00:38,673 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6543abc0-45e8-4f2e-9387-2bfd4c095a58_1692250829.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6543abc0-45e8-4f2e-9387-2bfd4c095a58_1692250829.mgf
15 Dec 2023 02:00:38,675 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F1-4_1_S4-H9_1_4562.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F1-4_1_S4-H9_1_4562.d.zip
15 Dec 2023 02:00:38,677 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F1-4_1_S4-H9_1_4562.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F1-4_1_S4-H9_1_4562.d.zip
15 Dec 2023 02:00:38,678 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F3_2_S1-G5_1_4448.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F3_2_S1-G5_1_4448.d.zip
15 Dec 2023 02:00:38,679 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F3_2_S1-G5_1_4448.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F3_2_S1-G5_1_4448.d.zip
15 Dec 2023 02:00:38,681 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f06aa32c-91d7-4fb6-ac3b-b0ce9e2ee235_1688312384.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f06aa32c-91d7-4fb6-ac3b-b0ce9e2ee235_1688312384.mgf
15 Dec 2023 02:00:38,682 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f06aa32c-91d7-4fb6-ac3b-b0ce9e2ee235_1688312384.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f06aa32c-91d7-4fb6-ac3b-b0ce9e2ee235_1688312384.mgf
15 Dec 2023 02:00:38,684 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F3_1_S4-B8_1_4487.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F3_1_S4-B8_1_4487.d.zip
15 Dec 2023 02:00:38,685 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F3_1_S4-B8_1_4487.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F3_1_S4-B8_1_4487.d.zip
15 Dec 2023 02:00:38,688 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0d7f8dfc-5949-42fa-84f1-f45730357a9a_1688298740.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0d7f8dfc-5949-42fa-84f1-f45730357a9a_1688298740.mgf
15 Dec 2023 02:00:38,689 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0d7f8dfc-5949-42fa-84f1-f45730357a9a_1688298740.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0d7f8dfc-5949-42fa-84f1-f45730357a9a_1688298740.mgf
15 Dec 2023 02:00:38,691 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/faca8ea5-02b0-41fd-b0c8-baef53fc5ac4_1692227802.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/faca8ea5-02b0-41fd-b0c8-baef53fc5ac4_1692227802.mgf
15 Dec 2023 02:00:38,692 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/faca8ea5-02b0-41fd-b0c8-baef53fc5ac4_1692227802.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/faca8ea5-02b0-41fd-b0c8-baef53fc5ac4_1692227802.mgf
15 Dec 2023 02:00:38,694 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F2_2_S4-H5_1_4558.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F2_2_S4-H5_1_4558.d.zip
15 Dec 2023 02:00:38,697 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F2_2_S4-H5_1_4558.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F2_2_S4-H5_1_4558.d.zip
15 Dec 2023 02:00:38,700 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F2_2_S4-E11_1_4528.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F2_2_S4-E11_1_4528.d.zip
15 Dec 2023 02:00:38,701 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F2_2_S4-E11_1_4528.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F2_2_S4-E11_1_4528.d.zip
15 Dec 2023 02:00:38,703 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F1-4_2_S4-A4_1_4471.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F1-4_2_S4-A4_1_4471.d.zip
15 Dec 2023 02:00:38,704 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.54_F1-4_2_S4-A4_1_4471.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.54_F1-4_2_S4-A4_1_4471.d.zip
15 Dec 2023 02:00:38,706 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F1-4_2_S4-F4_1_4533.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F1-4_2_S4-F4_1_4533.d.zip
15 Dec 2023 02:00:38,708 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F1-4_2_S4-F4_1_4533.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F1-4_2_S4-F4_1_4533.d.zip
15 Dec 2023 02:00:38,710 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0b0df2c5-1372-46bf-ab21-1d1108219db7_1688290786.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0b0df2c5-1372-46bf-ab21-1d1108219db7_1688290786.mgf
15 Dec 2023 02:00:38,711 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/0b0df2c5-1372-46bf-ab21-1d1108219db7_1688290786.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/0b0df2c5-1372-46bf-ab21-1d1108219db7_1688290786.mgf
15 Dec 2023 02:00:38,714 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F2_2_S1-G3_1_4446.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F2_2_S1-G3_1_4446.d.zip
15 Dec 2023 02:00:38,715 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F2_2_S1-G3_1_4446.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F2_2_S1-G3_1_4446.d.zip
15 Dec 2023 02:00:38,717 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F1-4_1_S4-G11_1_4552.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F1-4_1_S4-G11_1_4552.d.zip
15 Dec 2023 02:00:38,719 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F1-4_1_S4-G11_1_4552.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F1-4_1_S4-G11_1_4552.d.zip
15 Dec 2023 02:00:38,721 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5afa6b85-cd2e-4fb1-afd7-2c47eea414c0_1692283407.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5afa6b85-cd2e-4fb1-afd7-2c47eea414c0_1692283407.mgf
15 Dec 2023 02:00:38,722 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/5afa6b85-cd2e-4fb1-afd7-2c47eea414c0_1692283407.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/5afa6b85-cd2e-4fb1-afd7-2c47eea414c0_1692283407.mgf
15 Dec 2023 02:00:38,725 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e4eb9333-15d2-4696-a4c4-5391199a747a_1692340823.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e4eb9333-15d2-4696-a4c4-5391199a747a_1692340823.mgf
15 Dec 2023 02:00:38,726 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e4eb9333-15d2-4696-a4c4-5391199a747a_1692340823.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e4eb9333-15d2-4696-a4c4-5391199a747a_1692340823.mgf
15 Dec 2023 02:00:38,728 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F3_1_S4-E12_1_4529.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F3_1_S4-E12_1_4529.d.zip
15 Dec 2023 02:00:38,730 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.27_F3_1_S4-E12_1_4529.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.27_F3_1_S4-E12_1_4529.d.zip
15 Dec 2023 02:00:38,732 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8dd6fc69-8555-4baa-b0f0-e0331e79a97e_1688232535.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8dd6fc69-8555-4baa-b0f0-e0331e79a97e_1688232535.mgf
15 Dec 2023 02:00:38,733 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/8dd6fc69-8555-4baa-b0f0-e0331e79a97e_1688232535.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/8dd6fc69-8555-4baa-b0f0-e0331e79a97e_1688232535.mgf
15 Dec 2023 02:00:38,736 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F2_S1-D8_1_2911.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F2_S1-D8_1_2911.d.zip
15 Dec 2023 02:00:38,737 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.17_F2_S1-D8_1_2911.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.17_F2_S1-D8_1_2911.d.zip
15 Dec 2023 02:00:38,739 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F2_1_S4-C4_1_4495.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F2_1_S4-C4_1_4495.d.zip
15 Dec 2023 02:00:38,741 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F2_1_S4-C4_1_4495.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F2_1_S4-C4_1_4495.d.zip
15 Dec 2023 02:00:38,743 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (6).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (6).mzid
15 Dec 2023 02:00:38,744 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (6).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (6).mzid
15 Dec 2023 02:00:38,746 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F2_1_S1-G2_1_4445.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F2_1_S1-G2_1_4445.d.zip
15 Dec 2023 02:00:38,747 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.49_F2_1_S1-G2_1_4445.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.49_F2_1_S1-G2_1_4445.d.zip
15 Dec 2023 02:00:38,749 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F1_S1-D3_1_2843.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F1_S1-D3_1_2843.d.zip
15 Dec 2023 02:00:38,915 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.22_F1_S1-D3_1_2843.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.22_F1_S1-D3_1_2843.d.zip
15 Dec 2023 02:00:38,918 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F5_S1-A10_1_3067.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F5_S1-A10_1_3067.d.zip
15 Dec 2023 02:00:38,919 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F5_S1-A10_1_3067.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F5_S1-A10_1_3067.d.zip
15 Dec 2023 02:00:38,921 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F4_S2-H3_1_2881.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F4_S2-H3_1_2881.d.zip
15 Dec 2023 02:00:38,922 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.47_F4_S2-H3_1_2881.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.47_F4_S2-H3_1_2881.d.zip
15 Dec 2023 02:00:38,923 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e94e32d7-6fc8-40fd-a753-aeac876897ee_1692316380.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e94e32d7-6fc8-40fd-a753-aeac876897ee_1692316380.mgf
15 Dec 2023 02:00:38,924 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e94e32d7-6fc8-40fd-a753-aeac876897ee_1692316380.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e94e32d7-6fc8-40fd-a753-aeac876897ee_1692316380.mgf
15 Dec 2023 02:00:38,926 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F3_2_S4-H7_1_4560.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F3_2_S4-H7_1_4560.d.zip
15 Dec 2023 02:00:38,927 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.34_F3_2_S4-H7_1_4560.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.34_F3_2_S4-H7_1_4560.d.zip
15 Dec 2023 02:00:38,929 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F1_S1-B4_1_2894.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F1_S1-B4_1_2894.d.zip
15 Dec 2023 02:00:38,930 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F1_S1-B4_1_2894.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F1_S1-B4_1_2894.d.zip
15 Dec 2023 02:00:38,932 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F1-4_1_S4-E5_1_4522.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F1-4_1_S4-E5_1_4522.d.zip
15 Dec 2023 02:00:38,933 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.66_F1-4_1_S4-E5_1_4522.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.66_F1-4_1_S4-E5_1_4522.d.zip
15 Dec 2023 02:00:38,935 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F4_S2-B4_1_2897.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F4_S2-B4_1_2897.d.zip
15 Dec 2023 02:00:38,936 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F4_S2-B4_1_2897.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F4_S2-B4_1_2897.d.zip
15 Dec 2023 02:00:38,938 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d2b6787b-6cd5-48fb-a9f2-dfc86bf3ccbf_1692246559.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d2b6787b-6cd5-48fb-a9f2-dfc86bf3ccbf_1692246559.mgf
15 Dec 2023 02:00:38,939 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d2b6787b-6cd5-48fb-a9f2-dfc86bf3ccbf_1692246559.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d2b6787b-6cd5-48fb-a9f2-dfc86bf3ccbf_1692246559.mgf
15 Dec 2023 02:00:38,940 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/619ecf2a-37a2-45ad-97c1-e7013397e32a_1692253675.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/619ecf2a-37a2-45ad-97c1-e7013397e32a_1692253675.mgf
15 Dec 2023 02:00:38,941 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/619ecf2a-37a2-45ad-97c1-e7013397e32a_1692253675.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/619ecf2a-37a2-45ad-97c1-e7013397e32a_1692253675.mgf
15 Dec 2023 02:00:38,943 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d5429f83-ffe3-4175-9564-126f96197694_1692191974.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d5429f83-ffe3-4175-9564-126f96197694_1692191974.mgf
15 Dec 2023 02:00:38,944 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/d5429f83-ffe3-4175-9564-126f96197694_1692191974.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/d5429f83-ffe3-4175-9564-126f96197694_1692191974.mgf
15 Dec 2023 02:00:38,946 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/10e617fd-c716-410f-979a-cbf0cf9f62ac_1688166066.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/10e617fd-c716-410f-979a-cbf0cf9f62ac_1688166066.mgf
15 Dec 2023 02:00:38,947 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/10e617fd-c716-410f-979a-cbf0cf9f62ac_1688166066.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/10e617fd-c716-410f-979a-cbf0cf9f62ac_1688166066.mgf
15 Dec 2023 02:00:38,949 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/850f5597-7822-42e6-93a9-728c51116cae_1688278567.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/850f5597-7822-42e6-93a9-728c51116cae_1688278567.mgf
15 Dec 2023 02:00:38,950 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/850f5597-7822-42e6-93a9-728c51116cae_1688278567.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/850f5597-7822-42e6-93a9-728c51116cae_1688278567.mgf
15 Dec 2023 02:00:38,952 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/039481d4-3e04-4883-aa7e-d8fb8d21345e_1688279991.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/039481d4-3e04-4883-aa7e-d8fb8d21345e_1688279991.mgf
15 Dec 2023 02:00:38,953 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/039481d4-3e04-4883-aa7e-d8fb8d21345e_1688279991.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/039481d4-3e04-4883-aa7e-d8fb8d21345e_1688279991.mgf
15 Dec 2023 02:00:38,955 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F3_1_S4-G8_1_4549.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F3_1_S4-G8_1_4549.d.zip
15 Dec 2023 02:00:38,956 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.31_F3_1_S4-G8_1_4549.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.31_F3_1_S4-G8_1_4549.d.zip
15 Dec 2023 02:00:38,958 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f9ca3085-4173-4ba0-9e63-53095d564b71_1692345092.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f9ca3085-4173-4ba0-9e63-53095d564b71_1692345092.mgf
15 Dec 2023 02:00:38,959 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/f9ca3085-4173-4ba0-9e63-53095d564b71_1692345092.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/f9ca3085-4173-4ba0-9e63-53095d564b71_1692345092.mgf
15 Dec 2023 02:00:38,961 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F2_S1-G7_1_2871.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F2_S1-G7_1_2871.d.zip
15 Dec 2023 02:00:38,962 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.41_F2_S1-G7_1_2871.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.41_F2_S1-G7_1_2871.d.zip
15 Dec 2023 02:00:38,964 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F1_S1-E3_1_2851.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F1_S1-E3_1_2851.d.zip
15 Dec 2023 02:00:38,965 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.28_F1_S1-E3_1_2851.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.28_F1_S1-E3_1_2851.d.zip
15 Dec 2023 02:00:38,967 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/eb076f67-9864-4fc3-9298-49220103b94c_1688277142.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/eb076f67-9864-4fc3-9298-49220103b94c_1688277142.mgf
15 Dec 2023 02:00:38,968 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/eb076f67-9864-4fc3-9298-49220103b94c_1688277142.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/eb076f67-9864-4fc3-9298-49220103b94c_1688277142.mgf
15 Dec 2023 02:00:38,970 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (2).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (2).mzid
15 Dec 2023 02:00:38,971 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (2).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (2).mzid
15 Dec 2023 02:00:38,972 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/08547816-6648-40c8-84f3-bc2465b8c32f_1688323180.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/08547816-6648-40c8-84f3-bc2465b8c32f_1688323180.mgf
15 Dec 2023 02:00:38,974 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/08547816-6648-40c8-84f3-bc2465b8c32f_1688323180.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/08547816-6648-40c8-84f3-bc2465b8c32f_1688323180.mgf
15 Dec 2023 02:00:38,975 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/02db6531-fa4a-47c3-8202-d999c61ef400_1692358735.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/02db6531-fa4a-47c3-8202-d999c61ef400_1692358735.mgf
15 Dec 2023 02:00:38,976 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/02db6531-fa4a-47c3-8202-d999c61ef400_1692358735.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/02db6531-fa4a-47c3-8202-d999c61ef400_1692358735.mgf
15 Dec 2023 02:00:38,978 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F2_1_S4-A8_1_4475.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F2_1_S4-A8_1_4475.d.zip
15 Dec 2023 02:00:38,980 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.58_F2_1_S4-A8_1_4475.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.58_F2_1_S4-A8_1_4475.d.zip
15 Dec 2023 02:00:38,982 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F1_S1-E4_1_2918.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F1_S1-E4_1_2918.d.zip
15 Dec 2023 02:00:38,983 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.24_F1_S1-E4_1_2918.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.24_F1_S1-E4_1_2918.d.zip
15 Dec 2023 02:00:38,985 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A4_1_3064.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A4_1_3064.d.zip
15 Dec 2023 02:00:38,986 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A4_1_3064.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6653.3_F2_S1-A4_1_3064.d.zip
15 Dec 2023 02:00:38,988 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/781d1bd3-951b-4f18-a935-5dfa7f5b947d_1688569808.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/781d1bd3-951b-4f18-a935-5dfa7f5b947d_1688569808.mgf
15 Dec 2023 02:00:38,989 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/781d1bd3-951b-4f18-a935-5dfa7f5b947d_1688569808.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/781d1bd3-951b-4f18-a935-5dfa7f5b947d_1688569808.mgf
15 Dec 2023 02:00:38,990 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F2_1_S4-B6_1_4485.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F2_1_S4-B6_1_4485.d.zip
15 Dec 2023 02:00:38,992 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F2_1_S4-B6_1_4485.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F2_1_S4-B6_1_4485.d.zip
15 Dec 2023 02:00:38,993 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (12).mzid to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (12).mzid
15 Dec 2023 02:00:38,994 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/DTASelect-filter (12).mzid targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/DTASelect-filter (12).mzid
15 Dec 2023 02:00:38,996 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e2924e1d-856c-480c-ad6f-df019df874e8_1692194821.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e2924e1d-856c-480c-ad6f-df019df874e8_1692194821.mgf
15 Dec 2023 02:00:38,997 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/e2924e1d-856c-480c-ad6f-df019df874e8_1692194821.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/e2924e1d-856c-480c-ad6f-df019df874e8_1692194821.mgf
15 Dec 2023 02:00:38,999 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/288da22d-8478-4f38-96cf-483369930b16_1692284832.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/288da22d-8478-4f38-96cf-483369930b16_1692284832.mgf
15 Dec 2023 02:00:39,000 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/288da22d-8478-4f38-96cf-483369930b16_1692284832.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/288da22d-8478-4f38-96cf-483369930b16_1692284832.mgf
15 Dec 2023 02:00:39,002 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cc67f78e-ce58-4afe-8474-8a658ca26040_1688164644.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cc67f78e-ce58-4afe-8474-8a658ca26040_1688164644.mgf
15 Dec 2023 02:00:39,003 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/cc67f78e-ce58-4afe-8474-8a658ca26040_1688164644.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/cc67f78e-ce58-4afe-8474-8a658ca26040_1688164644.mgf
15 Dec 2023 02:00:39,005 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F2_2_S4-B7_1_4486.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F2_2_S4-B7_1_4486.d.zip
15 Dec 2023 02:00:39,006 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.60_F2_2_S4-B7_1_4486.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.60_F2_2_S4-B7_1_4486.d.zip
15 Dec 2023 02:00:39,008 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F1-4_2_S4-C10_1_4501.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F1-4_2_S4-C10_1_4501.d.zip
15 Dec 2023 02:00:39,009 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6653.62_F1-4_2_S4-C10_1_4501.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6653.62_F1-4_2_S4-C10_1_4501.d.zip
15 Dec 2023 02:00:39,011 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F2_S1-B8_1_2895.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F2_S1-B8_1_2895.d.zip
15 Dec 2023 02:00:39,012 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.7_F2_S1-B8_1_2895.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.7_F2_S1-B8_1_2895.d.zip
15 Dec 2023 02:00:39,014 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F4_S2-A4_1_2889.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F4_S2-A4_1_2889.d.zip
15 Dec 2023 02:00:39,015 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/CSF_6666.3_F4_S2-A4_1_2889.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/CSF_6666.3_F4_S2-A4_1_2889.d.zip
15 Dec 2023 02:00:39,017 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/44550b1c-bcd5-4b9b-846c-e2da0d3662d6_1688220314.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/44550b1c-bcd5-4b9b-846c-e2da0d3662d6_1688220314.mgf
15 Dec 2023 02:00:39,018 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/44550b1c-bcd5-4b9b-846c-e2da0d3662d6_1688220314.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/44550b1c-bcd5-4b9b-846c-e2da0d3662d6_1688220314.mgf
15 Dec 2023 02:00:39,020 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c4a2b47e-58c5-4606-9c4f-4fecd13a33af_1692220689.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c4a2b47e-58c5-4606-9c4f-4fecd13a33af_1692220689.mgf
15 Dec 2023 02:00:39,021 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/c4a2b47e-58c5-4606-9c4f-4fecd13a33af_1692220689.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/c4a2b47e-58c5-4606-9c4f-4fecd13a33af_1692220689.mgf
15 Dec 2023 02:00:39,023 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F1-4_1_S1-A7_1_4574.d.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F1-4_1_S1-A7_1_4574.d.zip
15 Dec 2023 02:00:39,024 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/6666.36_F1-4_1_S1-A7_1_4574.d.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/6666.36_F1-4_1_S1-A7_1_4574.d.zip
15 Dec 2023 02:00:39,026 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/275bf1a3-e888-46a2-8c34-1164ed71a500_1692223535.mgf to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/275bf1a3-e888-46a2-8c34-1164ed71a500_1692223535.mgf
15 Dec 2023 02:00:39,027 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/RawFiles/275bf1a3-e888-46a2-8c34-1164ed71a500_1692223535.mgf targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/RawFiles/275bf1a3-e888-46a2-8c34-1164ed71a500_1692223535.mgf
15 Dec 2023 02:00:39,029 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 02:00:39,030 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 02:00:39,031 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42
15 Dec 2023 02:00:39,432 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.redundant.blib
15 Dec 2023 02:00:39,434 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.redundant.blib
15 Dec 2023 02:00:39,436 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/human.protdb
15 Dec 2023 02:00:39,437 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/human.protdb
15 Dec 2023 02:00:39,439 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/CSF_P017_F1.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/CSF_P017_F1.imsdb
15 Dec 2023 02:00:39,440 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/CSF_P017_F1.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/CSF_P017_F1.imsdb
15 Dec 2023 02:00:39,442 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyl
15 Dec 2023 02:00:39,443 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyl
15 Dec 2023 02:00:39,445 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky
15 Dec 2023 02:00:39,446 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky
15 Dec 2023 02:00:39,448 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.blib
15 Dec 2023 02:00:39,449 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.blib
15 Dec 2023 02:00:39,451 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky.view
15 Dec 2023 02:00:39,452 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.sky.view
15 Dec 2023 02:00:39,454 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd
15 Dec 2023 02:00:39,455 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd
15 Dec 2023 02:00:39,456 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48
15 Dec 2023 02:00:39,458 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/human.protdb
15 Dec 2023 02:00:39,459 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/human.protdb
15 Dec 2023 02:00:39,461 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.blib
15 Dec 2023 02:00:39,462 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.blib
15 Dec 2023 02:00:39,464 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.redundant.blib
15 Dec 2023 02:00:39,465 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.redundant.blib
15 Dec 2023 02:00:39,467 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky.view
15 Dec 2023 02:00:39,891 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky.view
15 Dec 2023 02:00:39,893 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky
15 Dec 2023 02:00:39,895 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.sky
15 Dec 2023 02:00:39,896 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/CSF_P017_F4.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/CSF_P017_F4.imsdb
15 Dec 2023 02:00:39,897 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/CSF_P017_F4.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/CSF_P017_F4.imsdb
15 Dec 2023 02:00:39,899 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd
15 Dec 2023 02:00:39,900 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd
15 Dec 2023 02:00:39,902 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyl
15 Dec 2023 02:00:39,903 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyl
15 Dec 2023 02:00:39,905 DEBUG: Directory created: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30
15 Dec 2023 02:00:39,907 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd
15 Dec 2023 02:00:39,908 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd
15 Dec 2023 02:00:39,909 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyl to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyl
15 Dec 2023 02:00:39,910 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyl targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyl
15 Dec 2023 02:00:39,912 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.blib
15 Dec 2023 02:00:39,913 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.blib
15 Dec 2023 02:00:39,915 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/CSF_P017_F3.imsdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/CSF_P017_F3.imsdb
15 Dec 2023 02:00:39,916 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/CSF_P017_F3.imsdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/CSF_P017_F3.imsdb
15 Dec 2023 02:00:39,918 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/human.protdb to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/human.protdb
15 Dec 2023 02:00:39,919 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/human.protdb targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/human.protdb
15 Dec 2023 02:00:39,920 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky
15 Dec 2023 02:00:39,923 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky
15 Dec 2023 02:00:39,924 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.redundant.blib to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.redundant.blib
15 Dec 2023 02:00:39,925 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.redundant.blib targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.redundant.blib
15 Dec 2023 02:00:39,927 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky.view to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky.view
15 Dec 2023 02:00:39,928 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky.view targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.sky.view
15 Dec 2023 02:00:39,929 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 02:00:39,930 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 02:00:39,933 DEBUG: Moved file /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip to /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 02:00:39,934 DEBUG: Created symlink /data/labkey/files/IRMB - PPC/SILK2/SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip targeting /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 02:00:39,935 INFO : Aligning data files urls in folder: /Panorama Public/2023/IRMB PPC - SILK_P017
15 Dec 2023 02:00:39,937 DEBUG: Setting filePathRoot on copied run: SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,939 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42.sky.zip
15 Dec 2023 02:00:39,941 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F1_a.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F1_a_2023-12-05_11-23-42/SILK_P017_CSF_F1_a.skyd
15 Dec 2023 02:00:39,943 DEBUG: Setting filePathRoot on copied run: SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,945 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F2_a.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34/SILK_P017_CSF_F2_a.skyd
15 Dec 2023 02:00:39,946 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F2_a_2023-12-05_11-46-34.sky.zip
15 Dec 2023 02:00:39,947 DEBUG: Setting filePathRoot on copied run: SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,949 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30.sky.zip
15 Dec 2023 02:00:39,951 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F3_a.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F3_a_2023-12-05_12-18-30/SILK_P017_CSF_F3_a.skyd
15 Dec 2023 02:00:39,952 DEBUG: Setting filePathRoot on copied run: SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,954 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48.sky.zip
15 Dec 2023 02:00:39,956 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F4_a.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F4_a_2023-12-05_12-53-48/SILK_P017_CSF_F4_a.skyd
15 Dec 2023 02:00:39,957 DEBUG: Setting filePathRoot on copied run: SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,959 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01.sky.zip
15 Dec 2023 02:00:39,961 DEBUG: Setting dataFileUri on copied data: SILK_P017_CSF_F5_a.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_CSF_F5_a_2023-12-05_14-40-01/SILK_P017_CSF_F5_a.skyd
15 Dec 2023 02:00:39,962 DEBUG: Setting filePathRoot on copied run: SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,963 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37.sky.zip
15 Dec 2023 02:00:39,965 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F1b.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F1b_2023-12-05_14-53-37/SILK_P017_Plasma_F1b.skyd
15 Dec 2023 02:00:39,966 DEBUG: Setting filePathRoot on copied run: SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,967 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F2b.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37/SILK_P017_Plasma_F2b.skyd
15 Dec 2023 02:00:39,969 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F2b_2023-12-11_07-23-37.sky.zip
15 Dec 2023 02:00:39,970 DEBUG: Setting filePathRoot on copied run: SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files
15 Dec 2023 02:00:39,972 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F3b.skyd to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49/SILK_P017_Plasma_F3b.skyd
15 Dec 2023 02:00:39,973 DEBUG: Setting dataFileUri on copied data: SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip to: /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/SILK_P017_Plasma_F3b_2023-12-11_07-46-49.sky.zip
15 Dec 2023 02:00:39,973 INFO : Importing files metadata.
15 Dec 2023 02:00:39,973 DEBUG: [/Panorama Public/2023/IRMB PPC - SILK_P017] Reading files metadata from /data/labkey/files/Panorama Public/2023/IRMB PPC - SILK_P017/@files/export
15 Dec 2023 02:00:39,974 INFO :
15 Dec 2023 02:00:39,975 INFO : Experiment import completed successfully.
15 Dec 2023 02:00:39,975 INFO : Successfully completed task 'org.labkey.panoramapublic.pipeline.ExperimentImportTask'
15 Dec 2023 02:13:21,929 INFO : Starting to run task 'org.labkey.panoramapublic.pipeline.CopyLibraryStateTask' at location 'webserver-high-priority'
15 Dec 2023 02:13:21,930 INFO :
15 Dec 2023 02:13:21,930 INFO : Checking for library folders.
15 Dec 2023 02:13:21,930 INFO : Successfully completed task 'org.labkey.panoramapublic.pipeline.CopyLibraryStateTask'
15 Dec 2023 02:14:55,957 INFO : Starting to run task 'org.labkey.panoramapublic.pipeline.CopyExperimentFinalTask' at location 'webserver-high-priority'
15 Dec 2023 02:14:55,958 INFO :
15 Dec 2023 02:14:55,958 INFO : Finishing up experiment copy.
15 Dec 2023 02:14:55,959 INFO : Updating TargetedMS experiment entry in target folder /Panorama Public/2023/IRMB PPC - SILK_P017
15 Dec 2023 02:14:55,960 INFO : Setting version on new experiment to 1
15 Dec 2023 02:14:55,965 INFO : Updating permanent link to point to the new copy of the data.
15 Dec 2023 02:14:55,997 INFO : Removing copy permissions given to Panorama Public
15 Dec 2023 02:14:55,999 INFO : Adding read permissions to all users that are folder admins in the source folder.
15 Dec 2023 02:14:56,000 INFO : Assigning ReaderRole to jerome_vialaret@yahoo.fr
15 Dec 2023 02:14:56,000 INFO : Assigning PanoramaPublicSubmitterRole to jerome_vialaret@yahoo.fr
15 Dec 2023 02:14:56,005 INFO : User jerome_vialaret@yahoo.fr is already a member of group Panorama Public Submitters
15 Dec 2023 02:14:56,005 INFO : Updating the 'Raw Data' tab configuration
15 Dec 2023 02:14:56,008 INFO : Creating a reviewer account.
15 Dec 2023 02:14:56,222 INFO : Created reviewer with email: User panorama+reviewer230@proteinms.net
15 Dec 2023 02:14:56,227 INFO : Adding user panorama+reviewer230@proteinms.net to group Reviewers
15 Dec 2023 02:14:56,229 INFO : Hiding the Data Pipeline tab.
15 Dec 2023 02:14:56,233 INFO : Updating Submission. Setting copiedExperimentId to 1743
15 Dec 2023 02:14:58,202 INFO : Assigning a ProteomeXchange ID.
15 Dec 2023 02:14:58,504 INFO : Assigned ProteomeXchange ID: PXD047851
15 Dec 2023 02:14:58,504 INFO : Assigning a DOI.
15 Dec 2023 02:14:59,986 INFO : Assigned DOI: 10.6069/npz5-gr54
15 Dec 2023 02:15:00,133 INFO : Successfully completed task 'org.labkey.panoramapublic.pipeline.CopyExperimentFinalTask'