File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description TANK-binding kinase 1-binding protein 1 OS=Homo sapiens GN=TBKBP1 PE=1 SV=1
Decoy false
Note
Reproducibility Report
0102030405060708090
MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLERENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLE
100110120130140150160170180190
VEKVSLQQRLNQFQHELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAFSNLSPPPAPAPPCTDLDLHY
200210220230240250260270280290
LALRGGSGLSHAGWPGSTPSVSDLERRRLEEALEAAQGEARGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTE
300310320330340350360370380390
LTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSPSPPARAAPPCPPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRS
1
400410420430440450460470480490
PVPPSCQSPSPQRRSPVPPSCPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPPWLQAEAATLPKPRAYGSELYGPG
500510520530540550560570580590
RPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTIRCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDD
600610
ALIKHIDSHLENSKI
DescriptionTANK-binding kinase 1-binding protein 1 (short name: TBK1-binding protein 1)
Gene name(s)TBKBP1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005257918.1
XP_005257919.1
XP_005257916.1
XP_005257917.1
NP_055541.1
none loaded A7MCY6
B2RZG6
O94873
Q14DW3
TBKB1_HUMAN
ENST00000361722
none loaded GO:0045087

Peak Areas

Retention Times