File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1
Decoy false
Note
Reproducibility Report
0102030405060708090
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEV
100110120130140150160170180190
IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVG
1
200210220230240250260270280290
CILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
300310320330340
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
DescriptionCyclin-dependent kinase 7
Gene name(s)CDK7
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001790.1
none loaded P50613
Q9BS60
Q9UE19
CDK7_HUMAN
ENST00000256443
ENST00000571640
none loaded GO:0000079
GO:0000082
GO:0000086
GO:0000718
GO:0003713
GO:0004693
GO:0005524
GO:0005675
GO:0005739
GO:0006283
GO:0006361
GO:0006362
GO:0006363
GO:0006367
GO:0006368
GO:0006370
GO:0007050
GO:0008094
GO:0008283
GO:0008353
GO:0016032
GO:0030521
GO:0045944
GO:0048471
GO:0050434
GO:0050681
GO:0051301

Peak Areas

Retention Times