File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3
Decoy false
Note
Reproducibility Report
0102030405060708090
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDD
100110120130140150160170180190
LSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHV
200210220230240250260270280290
KHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
300310320330340350360370380390
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGN
400410420430440450460470480490
GLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMI
1
500510520530
HCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
DescriptionTyrosine-protein kinase Fyn
Gene name(s)FYN
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005266949.1
NP_694593.1
NP_002028.1
XP_005266944.1
XP_005266946.1
XP_005266947.1
NP_694592.1
XP_005266945.1
none loaded B5BU57
E1P557
H0UI48
P06241
Q16248
Q5R3A6
Q5R3A7
Q8N5D7
FYN_HUMAN
ENST00000229471
ENST00000354650
ENST00000356013
ENST00000368667
ENST00000368678
ENST00000368682
ENST00000538466
none loaded GO:0001764
GO:0004715
GO:0005524
GO:0005634
GO:0005739
GO:0005768
GO:0005829
GO:0005886
GO:0006816
GO:0007173
GO:0007411
GO:0007612
GO:0007631
GO:0008360
GO:0008543
GO:0010629
GO:0010976
GO:0014069
GO:0016032
GO:0030168
GO:0030900
GO:0031295
GO:0038095
GO:0038096
GO:0042177
GO:0042493
GO:0045087
GO:0045471
GO:0046777
GO:0046872
GO:0048011
GO:0048015
GO:0048813
GO:0050690
GO:0050798
GO:0050852
GO:0050900
GO:0050966
GO:0071375
GO:1900182
GO:2001240

Peak Areas

Retention Times