File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5
Decoy false
Note
Reproducibility Report
0102030405060708090
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQ
100110120130140150160170180190
KGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKI
200210220230240250260270280290
RTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
300310320330340350360370380390
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADF
400410420430440450460470480490
GLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEE
1
500510520
RPTFEYIQSVLDDFYTATESQYQQQP
DescriptionTyrosine-protein kinase HCK
Gene name(s)HCK
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001165600.1
NP_001165602.1
NP_002101.2
NP_001165604.1
NP_001165601.1
none loaded A8K1I1
B4DQB6
E1P5M2
P08631
Q29RX1
Q2VPE2
Q504R5
Q5T7K1
Q5T7K2
Q96CC0
Q9H5Y5
Q9NUA4
Q9UMJ5
HCK_HUMAN
ENST00000518730
ENST00000520553
ENST00000538448
none loaded GO:0002522
GO:0002758
GO:0004713
GO:0004715
GO:0005524
GO:0005634
GO:0005764
GO:0005794
GO:0005829
GO:0005856
GO:0005901
GO:0005925
GO:0006954
GO:0007155
GO:0007229
GO:0007498
GO:0008284
GO:0008360
GO:0016032
GO:0030133
GO:0030838
GO:0031234
GO:0031663
GO:0038096
GO:0042995
GO:0043066
GO:0043299
GO:0045728
GO:0046777
GO:0050690
GO:0050727
GO:0050764
GO:0051090
GO:0060333
GO:0071801
GO:2000251

Peak Areas

Retention Times