File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3
Decoy false
Note
Reproducibility Report
0102030405060708090
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFE
100110120130140150160170180190
DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWAC
200210220230240250260270280290
GVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
1
300310320330340350360370380390
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANT
400410420430440450460470480490
TIEDEDAKAPRVPDILSSVRRGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLSSPSPRISDILNSV
500510520530540550560570580590
RRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
600610620630640650660
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
DescriptionCalcium/calmodulin-dependent protein kinase type II subunit beta (short name: CaM kinase II subunit beta)
Gene name(s)CAMK2B
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_742076.1
NP_742079.1
NP_742081.1
NP_001211.3
NP_742077.1
XP_005249918.1
NP_742075.1
NP_742078.1
NP_742080.1
none loaded A4D2K0
A4D2K1
A4D2K2
A4D2K3
A4D2K4
A4D2K5
A4D2K6
O95437
O95438
O95599
Q13554
Q9UGH7
Q9UGH8
Q9UGH9
Q9UNX0
Q9UNX7
Q9UP00
Q9Y5N4
Q9Y6F4
KCC2B_HUMAN
ENST00000258682
ENST00000346990
ENST00000347193
ENST00000350811
ENST00000353625
ENST00000358707
ENST00000395747
ENST00000395749
ENST00000440254
ENST00000457475
none loaded GO:0000082
GO:0002030
GO:0004683
GO:0005524
GO:0005654
GO:0005815
GO:0005829
GO:0005886
GO:0006816
GO:0010976
GO:0014733
GO:0018105
GO:0030666
GO:0032222
GO:0033017
GO:0046686
GO:0046777
GO:0048169
GO:0050885
GO:0051233
GO:0051823
GO:0051924
GO:0060333
GO:0060466
GO:0061003
GO:0090129
GO:2001235

Peak Areas

Retention Times