File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description C2 domain-containing protein 5 OS=Homo sapiens GN=C2CD5 PE=1 SV=1
Decoy false
Note
Reproducibility Report
0102030405060708090
MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEVDDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSE
100110120130140150160170180190
AATVISGWFPIYDTIHGIRGEINVVVKVDLFNDLNRFRQSSCGVKFFCTTSIPKCYRAVIIHGFVEELVVNEDPEYQWIDRIRTPRASNEARQRLISLMS
200210220230240250260270280290
GELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIGTACTLDKLSSPAAFLPACNSPSKEMKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
300310320330340350360370380390
SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFFTLTAFPPGFLVHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIK
1
400410420430440450460470480490
SHAKALGCHAVVGYSESTSICEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFCHIPYDELNMPFPAHLTYCYNCRKQKVPDVLFTTID
500510520530540550560570580590
LPTDATVIGKGCLIQARLCRLKKKAQAEANATAISNLLPFMEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLASATGVYLAALPTPGGIQIAGK
600610620630640650660670680690
TPNDGSYEQHISHMQKKINDTIAKNKELYEINPPEISEEIIGSPIPEPRQRSRLLRSQSESSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDVPP
700710720730740750760770780790
PSGFYSCNTEIMPGINNWTSEIQMFTSVRVIRLSSLNLTNQALNKNFNDLCENLLKSLYFKLRSMIPCCLCHVNFTVSLPEDELIQVTVTAVAITFDKNQ
800810820830840850860870880890
ALQTTKTPVEKSLQRASTDNEELLQFPLELCSDSLPSHPFPPAKAMTVEKASPVGDGNFRNRSAPPCANSTVGVVKMTPLSFIPGAKITKYLGIINMFFI
900910920930940950960970980990
RETTSLREEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYIMKQCVFMENPNKNQAQCLINVSGDAVVFVRESDLEVVSSQQPTTNCQSSCTEGEVTT
DescriptionC2 domain-containing protein 5
Gene name(s)C2CD5, KIAA0528
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001273102.1
NP_001273105.1
NP_001273104.1
NP_001273106.1
NP_055617.1
NP_001273103.1
none loaded O60280
Q17RY7
Q7Z619
Q86SU3
Q86YS7
C2CD5_HUMAN
K0528_HUMAN
ENST00000333957
ENST00000396028
none loaded GO:0005509
GO:0005544
GO:0005938
GO:0006906
GO:0010828
GO:0030659
GO:0031340
GO:0032587
GO:0038028
GO:0065002
GO:0072659
GO:0090314
GO:2001275

Peak Areas

Retention Times