File PRMassay_FLNc+phosphostandard_pepmap.sky.zip
Description TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1
Decoy false
Note
Reproducibility Report
0102030405060708090
MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQ
100110120130140150160170180190
LWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVI
200210220230240250260270280290
ACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRI
300310320330340350360370380390
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKE
400410420430440450460470480490
QRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYL
500510520530540550560570580590
VSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKS
600610620630640650660670680690
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLG
700710720730740750760770780790
SQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI
1
800810820830840850860870880890
DEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISRE
900910920930940950960970980990
GTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAA
1000101010201030104010501060107010801090
LFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVL
1100111011201130114011501160117011801190
VTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVE
1200121012201230124012501260127012801290
EGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEK
130013101320133013401350
AIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSMMNW
DescriptionTRAF2 and NCK-interacting protein kinase
Gene name(s)TNIK
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001155033.1
NP_001155036.1
NP_055843.1
NP_001155038.1
NP_001155035.1
NP_001155034.1
NP_001155032.1
NP_001155037.1
none loaded A7E2A3
A8K4U1
D3DNQ6
O60298
Q8WUY7
Q9UKD8
Q9UKD9
Q9UKE0
Q9UKE1
Q9UKE2
Q9UKE3
Q9UKE4
Q9UKE5
TNIK_HUMAN
ENST00000284483
ENST00000341852
ENST00000357327
ENST00000436636
ENST00000460047
ENST00000470834
ENST00000475336
ENST00000488470
none loaded GO:0004702
GO:0005083
GO:0005524
GO:0005634
GO:0005737
GO:0005856
GO:0007256
GO:0016055
GO:0031532
GO:0046777
GO:0048814
GO:0055037

Peak Areas

Retention Times