Protein / Label:sp|P04080|CYTB_HUMAN
Description:Cystatin-B OS=Homo sapiens GN=CSTB PE=1 SV=2
Decoy:false
Note: 
File:Set1_HL_Carolinas_ncomm_2018-03-26_14-30-21.sky.zip
0102030405060708090
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
1 1 1
DescriptionIPI:IPI00021828.1|SWISS-PROT:P04080|TREMBL:Q76LA1|ENSEMBL:ENSP00000291568|REFSEQ:NP_000091|H-INV:HIT000270566|VEGA:OTTHUMP00000109464 Tax_Id=9606 Gene_Symbol=CSTB Cystatin-B
Gene name(s)CSTB
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P04080
CYTB_HUMAN
none loaded none loaded none loaded

Peak Areas

Retention Times