220805_5x5_Day4_2023-04-06_16-41-23.sky.zip: /TAMADOR/UW Medicine - NIDDK U01 Diabetes Assays/Glucagon and Oxyntomodulin

220805_5x5_Day4_2023-04-06_16-41-23.sky.zip

Glucagon and Oxyntomodulin

Document Summary

220805_5x5_Day4_2023-04-06_16-41-23.sky.zip 1 version

4 molecule lists, 2 peptides, 5 small molecules, 9 precursors, 27 transitions - 37 replicates, 7 calibration curves - Skyline-daily (64-bit) 22.2.1.425 (6949da988)

Peptide Calibration Curves

Select All Select None Show Selected Show Unselected Show All	Peptide Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Slope Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Intercept Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Point Count Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Quadratic Coefficient Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	RSquared Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Error Message Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Protein / Label Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart
	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	Glucagon
	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	Oxyntomodulin

Molecule Calibration Curves

Select All Select None Show Selected Show Unselected Show All	Molecule Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Slope Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Intercept Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Point Count Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Quadratic Coefficient Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	RSquared Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Error Message Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Molecule List Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart
	1414.2011	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	FSP_IS_SystemControl
	Glu_b26Only_Endo	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	molecules1
	Glu_b26Only_IS	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	molecules1
	Ox_y11Only_Endo	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	molecules1
	Ox_y11Only_IS	0.0000E0	0.0000E0	0	0.0000E0		Unable to calculate curve, since there are no data points available	molecules1