File psb33_vs_WT_thylakoid_proteins_ratios.sky.zip   
Description | Symbols: PSBD | photosystem II reaction center protein D | chrC:32711-33772 FORWARD LENGTH=353
Decoy false
Accession P56761
Note
0102030405060708090
MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQG
100110120130140150160170180190
DFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMM
200210220230240250260270280290
GVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV
1 >>
300310320330340350
SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
> 1
1
1
Features
DescriptionPhotosystem II D2 protein (short name: PSII D2 protein)
Gene namepsbD
Organism Draba nemorosa

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes Molecular Functions
YP_001123545.1
none loaded A4QL14
PSBD_DRANE
none loaded none loaded GO:0005506
GO:0009523
GO:0009535
GO:0009772
GO:0016021
GO:0016491
GO:0045156
Electron transport
Photosynthesis
Transport
Oxidoreductase

Peak Areas

Retention Times