startingMaterial_mouse_hearts_largeStudy_2021-07-19_12-36-47.sky.zip: /Panorama Public/2021/MacCoss - Age-Related Disruption of the Proteome and Acetylome in Mouse Hearts Correlates with Differential Loss of Function that is Attenuated by SS-31 and NMN

startingMaterial_mouse_hearts_largeStudy_2021-07-19_12-36-47.sky.zip

MacCoss - Age-Related Disruption of the Proteome and Acetylome in Mouse Hearts Correlates with Differential Loss of Function that is Attenuated by SS-31 and NMN

Document Summary

startingMaterial_mouse_hearts_largeStudy_2021-07-19_12-36-47.sky.zip 1 version

898 proteins, 6,265 peptides, 6,274 precursors, 89,163 transitions - 33 replicates, 6,265 calibration curves - Skyline-daily (64-bit) 21.1.1.160 (55b1a57db)

Peptide Calibration Curves

Peptide Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Slope Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Intercept Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Quadratic Coefficient Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Box & Whisker Quick Chart	Error Message Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart	Protein / Label Sort Ascending Sort Descending Clear Sort Filter... Clear Filter Remove Column Summary Statistics... Bar Chart Pie Chart Quick Chart
AAAHHYGAQC[+57.021464]DK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9DCJ5\|NDUA8_MOUSE
AAANEQLTR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|D3Z0L4\|D3Z0L4_MOUSE
AAATFNPELITHILDGSPENTR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9R0H0\|ACOX1_MOUSE
AAATLMTER	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P04919\|B3AT_MOUSE
AADAEAEVASLNR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P21107\|TPM3_MOUSE
AADAHVDAHYYEQNEQPTGTC[+57.021464]AAC[+57.021464]ITGGNR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P55264\|ADK_MOUSE
AADGNYYNAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8BH86\|CN159_MOUSE
AAEIQPLAQSHATK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P04247\|MYG_MOUSE
AAEMLLFGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9WUR2\|ECI2_MOUSE
AAEQMSTLPIDAPSPLENLEQK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P27546\|MAP4_MOUSE
AAESSAMAATEK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9Z1P6\|NDUA7_MOUSE
AAFDDAIAELDTLSEESYK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P62259\|1433E_MOUSE
AAFGLSEAGFNTAC[+57.021464]LTK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8K2B3\|SDHA_MOUSE
AAFQKVVAGVAAALAHKYH	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A8DUK4\|A8DUK4_MOUSE
AAFQLGSPWR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P47738\|ALDH2_MOUSE
AAGSLLTDEC[+57.021464]R	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q922B1\|MACD1_MOUSE
AAGTFTEIPASNIR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8BKZ9\|ODPX_MOUSE
AAGWSELSER	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9CZL5\|PHS2_MOUSE
AAHLPAEFTPAVHASLDK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|HBA_HUMAN\|
AAIDWFDGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P56959\|FUS_MOUSE
AAIISAEGDSK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P67778\|PHB_MOUSE
AALAHSEIATTQAASTK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9QXS1\|PLEC_MOUSE
AAMEPIVISAK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P26039\|TLN1_MOUSE
AAMIVNQLSK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q02257\|PLAK_MOUSE
AANLYASSPHSEFLDYVNAPIGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8R0N6\|HOT_MOUSE
AANNGALPPDLSYIVR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9D0M3\|CY1_MOUSE
AAPAAAAAMAPPGPR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8BMF4\|ODP2_MOUSE
AAPFTLEYR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9D819\|IPYR_MOUSE
AAPGYHMAK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8CI94\|PYGB_MOUSE
AAPGYHMAKMIIKLITAIGDVVNHDPAVGDR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9WUB3\|PYGM_MOUSE
AAPITQYLK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|O89020\|AFAM_MOUSE
AAPQLPMEELVSLSK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|O89020\|AFAM_MOUSE
AAQAAFQKVVAGVAAALAHKYH	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A8DUK4\|A8DUK4_MOUSE
AAQEEYIK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A6ZI46\|A6ZI46_MOUSE
AAQLC[+57.021464]GAGMAAVVEK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P17710\|HXK1_MOUSE
AAQSSVTASPQTEEFFDLIASSQSR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q6IR34\|GPSM1_MOUSE
AASDIAMTELPPTHPIR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P62259\|1433E_MOUSE
AASGRPEGTIASPLGSGAPDLQEAMQNLR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|E9QQ93\|E9QQ93_MOUSE
AASISAVSLEVAQPGPSSGPR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|B1B0C7\|B1B0C7_MOUSE
AASLHWTSER	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9CXV1\|DHSD_MOUSE
AASVLLYSLWAHTELHHAYK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|Q9CQ73\|Q9CQ73_MOUSE
AATAPLLEAVDNLSAFASNPEFSSVPAQISPEGR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P26039\|TLN1_MOUSE
AAVASLLQSVQVPEFTPK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q02053\|UBA1_MOUSE
AAVEQVPVEPYK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q6P3A8-2\|ODBB_MOUSE
AAVESLGFILFR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q3TXS7\|PSMD1_MOUSE
AAVEWFDGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q61545\|EWS_MOUSE
AAVFNHFISDGVK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P01027\|CO3_MOUSE
AAVLFGVVNTVAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9D1G3\|HHATL_MOUSE
AAVPSGASTGIYEALELR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P17182\|ENOA_MOUSE
AAVSAPLSHHR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|G5E8J6\|G5E8J6_MOUSE
AAVSC[+57.021464]LWGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P02088\|HBB1_MOUSE
AAWEVDSGR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P45952\|ACADM_MOUSE
AAYDAFNSWK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8BWF0\|SSDH_MOUSE
AAYVNNLNATEEK[+42.010565]YHEALAK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P09671\|SODM_MOUSE
AC[+57.021464]AHNPTGVDPRPEQWK[+42.010565]EIASVVK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P05202\|AATM_MOUSE
AC[+57.021464]ALSIAESC[+57.021464]RPGDKVPSIK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8K2B3\|SDHA_MOUSE
AC[+57.021464]ASTGVIM[+15.994915]SVNNSLYLGPILK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q07417\|ACADS_MOUSE
AC[+57.021464]C[+57.021464]GVPC[+57.021464]K	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|E9PWQ3\|E9PWQ3_MOUSE
AC[+57.021464]GANLPENFSISQIFSQAMAAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P34914\|HYES_MOUSE
AC[+57.021464]TGSLNMTLQR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8CI51\|PDLI5_MOUSE
ADAGEYSC[+57.021464]EAGGQK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|A2AAJ9\|OBSCN_MOUSE
ADAGGELNLAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9QYR9\|ACOT2_MOUSE
ADC[+57.021464]TITMADSDLLALMTGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P32020\|NLTP_MOUSE
ADDGRPFPQVIK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A6ZI46\|A6ZI46_MOUSE
ADEC[+57.021464]DTHTGAC[+57.021464]LGC[+57.021464]R	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q61292\|LAMB2_MOUSE
ADEDPIMGFHQMFLLK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P61971\|NTF2_MOUSE
ADEGISFR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P35700\|PRDX1_MOUSE
ADFQC[+57.021464]FQQAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|O35206\|COFA1_MOUSE
ADGPDMQSLFTQYFQSMTDYGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P09813\|APOA2_MOUSE
ADGTVMNTFAHK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P35385\|HSPB7_MOUSE
ADHQPLTEASYVNLPTIALC[+57.021464]NTDSPLR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P14206\|RSSA_MOUSE
ADIDVSGPK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|E9Q616\|E9Q616_MOUSE
ADIVENQVMDTR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P10649\|GSTM1_MOUSE
ADKDYSVTANSK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P16125\|LDHB_MOUSE
ADKLAEEHGS	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P56480\|ATPB_MOUSE
ADLAGHGQEVLIGLFK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P04247\|MYG_MOUSE
ADLEM[+15.994915]QIESLTEELAYLKK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|K1C10_HUMAN\|
ADLPGSSSTFTK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A0A0R4J1T1\|A0A0R4J1T1_MOUSE
ADLSNC[+57.021464]LYK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q0II04\|NEBL_MOUSE
ADNFEYSDPVDGSISK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9D0F9\|PGM1_MOUSE
ADNLATQMLMR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q7TQ48\|SRCA_MOUSE
ADPIK[+42.010565]VLMPSLSPTMEQGNIVK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8BKZ9\|ODPX_MOUSE
ADQPIEADVTVIGSGPGGYVAAIK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|O08749\|DLDH_MOUSE
ADQVDTQQLMR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9EQP2\|EHD4_MOUSE
ADSC[+57.021464]VSPNTVSQPLKR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P70670\|NACAM_MOUSE
ADWSSLSR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P19783\|COX41_MOUSE
AEAAAAPAPAAGPGQM[+15.994915]SFTFASPTQVFFDSANVK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q9D3D9\|ATPD_MOUSE
AEC[+57.021464]LNPAQPGR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P10493\|NID1_MOUSE
AEFVEVTK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|ALBU_BOVIN\|
AEGDGVYTLNDEK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q61646\|HPT_MOUSE
AEGLWNLFLPLETDPEK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|D3Z7X0\|D3Z7X0_MOUSE
AEGSDVANAVLDGADC[+57.021464]IMLSGETAK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P52480\|KPYM_MOUSE
AEILLSSC[+57.021464]KPVPK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|A0A0G2JDY6\|A0A0G2JDY6_MOUSE
AEILNLVK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|E9PWQ3\|E9PWQ3_MOUSE
AELNEFLTR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|P62908\|RS3_MOUSE
AENPTNPGPGGSGYWR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|E9PV24\|FIBA_MOUSE
AEQFYC[+57.021464]GDTEGK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q60597\|ODO1_MOUSE
AEQLVVTFVAGYIAGVFC[+57.021464]AIVSHPADSVVSVLNK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	sp\|Q8VEM8\|MPCP_MOUSE
AEQQTADQLLAR	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|F6SFQ3\|F6SFQ3_MOUSE
AESEVAPGAPK	0.0000E0	0.0000E0	0.0000E0	Unable to calculate curve, since there are no data points available	tr\|E9Q9T8\|E9Q9T8_MOUSE