MRM_HR_v3_yeast_new mProphet_0712_2015_v1_final_for Panorama_2015-07-17_11-11-41.sky.zip

Schilling - MRM_HR_TripleTOF_MS2_FullScanFiltering
MRM_HR_v3_yeast_new mProphet_0712_2015_v1_final_for Panorama_2015-07-17_11-11-41.sky.zip   1 version
 
127 proteins, 476 peptides, 504 precursors, 3,860 transitions  -  3 replicates  -  Skyline-daily (64-bit) 3.1.1.8663
 
sp|P38720|6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND1 PE=1 SV=1
SIIGATSIEDFISK
01479.7821 
SIIGATSIEDFISK
light2+740.89831479.78218
AGAPVDALINQIVPLLEK
01860.0720 
AGAPVDALINQIVPLLEK
light2+931.04331860.072010
GILFVGSGVSGGEEGAR
01590.8002 
GILFVGSGVSGGEEGAR
light2+796.40741590.80027
SDGEPCCEWVGPAGAGHYVK
02174.9150 
SDGEPCCEWVGPAGAGHYVK
light3+725.97892174.915010
WTAINALDLGMPVTLIGEAVFAR
02457.3090 
WTAINALDLGMPVTLIGEAVFAR
light3+820.11032457.30909
EEPDLENLLFNK
01459.7195 
EEPDLENLLFNK
light2+730.86701459.71958
FFADAVTK
0897.4596 
FFADAVTK
light2+449.7371897.45966
VLPECASDNLPVDK
01555.7552 
VLPECASDNLPVDK
light2+778.88491555.755210
sp|P31787|ACBP_YEAST Acyl-CoA-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACB1 PE=1 SV=3
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2
ILYGHLDDPHGQDIQR
01875.9228 
ILYGHLDDPHGQDIQR
light3+626.31491875.92288
EVYDFLASATAK
01313.6503 
EVYDFLASATAK
light2+657.83241313.65036
VGLIGSCTNSSYEDMSR
01874.8139 
VGLIGSCTNSSYEDMSR
light2+938.41421874.81398
NTIVSSYNR
01052.5251 
NTIVSSYNR
light2+527.26981052.52518
WVVIGDENFGEGSSR
01650.7638 
WVVIGDENFGEGSSR
light2+826.38921650.76389
FLGGFAIITK
01065.6223 
FLGGFAIITK
light2+533.81841065.62238
IDILGLAELAPGKPVTMR
01893.0758 
IDILGLAELAPGKPVTMR
light3+632.03251893.075810
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1
AGFAGDDAPR
0975.4410 
AGFAGDDAPR
light2+488.7278975.44109
DSYVGDEAQSK
01197.5150 
DSYVGDEAQSK
light2+599.76481197.51508
DLTDYLMK
0997.4790 
DLTDYLMK
light2+499.7468997.47905
SYELPDGQVITIGNER
01789.8846 
SYELPDGQVITIGNER
light2+895.94961789.88468
ELYGNIVMSGGTTMFPGIAER
02242.0762 
ELYGNIVMSGGTTMFPGIAER
light2+1122.04542242.07628
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5
ANELLINVK
01012.5917 
ANELLINVK
light2+507.30311012.59176
YSGVCHTDLHAWHGDWPLPVK
02474.1590 
YSGVCHTDLHAWHGDWPLPVK
light4+619.54702474.159010
LPLVGGHEGAGVVVGMGENVK
02018.0619 
LPLVGGHEGAGVVVGMGENVK
light3+673.69462018.061910
VLGIDGGEGK
0943.4975 
VLGIDGGEGK
light2+472.7560943.49757
VLGIDGGEGKEELFR
11617.8362 
VLGIDGGEGKEELFR
light2+809.92541617.836210
VLGIDGGEGKEELFR
11617.8362 
VLGIDGGEGKEELFR
light3+540.28601617.836210
SIGGEVFIDFTK
01311.6711 
SIGGEVFIDFTK
light2+656.84281311.67118
DIVGAVLK
0813.4960 
DIVGAVLK
light2+407.7553813.49607
ANGTTVLVGMPAGAK
01385.7337 
ANGTTVLVGMPAGAK
light2+693.87411385.73379
ANGTTVLVGMPAGAK
01401.7286 
ANGTTVLVGMPAGAK
light2+701.87161401.72869
EALDFFAR
0967.4763 
EALDFFAR
light2+484.7454967.47636
sp|Q04894|ADH6_YEAST NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1
sp|P47143|ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADO1 PE=1 SV=1
sp|P38013|AHP1_YEAST Peroxiredoxin type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHP1 PE=1 SV=4
FQYIAISQSDADSESCK
01947.8520 
FQYIAISQSDADSESCK
light2+974.93331947.85206
FQYIAISQSDADSESCK
01947.8520 
FQYIAISQSDADSESCK
light3+650.29131947.85208
VIITGAPAAFSPTCTVSHIPGYINYLDELVK
03345.7319 
VIITGAPAAFSPTCTVSHIPGYINYLDELVK
light3+1116.25123345.73199
VIITGAPAAFSPTCTVSHIPGYINYLDELVK
03345.7319 
VIITGAPAAFSPTCTVSHIPGYINYLDELVK
light4+837.44033345.731910
EKEVDQVIVVTVDNPFANQAWAK
12599.3282 
EKEVDQVIVVTVDNPFANQAWAK
light3+867.45002599.32828
EVDQVIVVTVDNPFANQAWAK
02342.1907 
EVDQVIVVTVDNPFANQAWAK
light2+1172.10262342.19075
EVDQVIVVTVDNPFANQAWAK
02342.1907 
EVDQVIVVTVDNPFANQAWAK
light3+781.73752342.19079
sp|A6ZR27|ALDH5_YEAS7 Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ALD5 PE=3 SV=1
sp|P54115|ALDH6_YEAST Magnesium-activated aldehyde dehydrogenase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD6 PE=1 SV=4
TYPVEDPSTENTVCEVSSATTEDVEYAIECADR
03736.5880 
TYPVEDPSTENTVCEVSSATTEDVEYAIECADR
light3+1246.53663736.58804
LADELESQIDLVSSIEALDNGK
02358.1802 
LADELESQIDLVSSIEALDNGK
light2+1180.09742358.18025
LADELESQIDLVSSIEALDNGK
02358.1802 
LADELESQIDLVSSIEALDNGK
light3+787.06732358.18028
VGIPAGVVNIVPGPGR
01500.8776 
VGIPAGVVNIVPGPGR
light2+751.44611500.877610
SVAVDSSESNLKK
11362.6991 
SVAVDSSESNLKK
light3+455.24031362.69919
AYLETEIK
0965.5070 
AYLETEIK
light2+483.7608965.50707
QQFDTIMNYIDIGK
01684.8131 
QQFDTIMNYIDIGK
light2+843.41381684.81317
AGTVWINTYNDFDSR
01757.8009 
AGTVWINTYNDFDSR
light2+879.90771757.80097