View Settings
The number displayed on each peptide box is the rank
111213141516171
MPRQIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSKFLYTLVIADKEKAEKLKQSLPPGLAVKELKKYVRSKV
1
Description60S ribosomal protein L38
Gene name
Organism Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded none loaded G3NG58_GASAC
none loaded none loaded none loaded
Display Chart Settings
No data to show.

Peak Areas

Retention Times