View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MRALGAVVTLLLWGQLFAVELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQV
1
101111121131141151161171181191
QRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVT
201211221231241251261271281291
ERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAF
301311321331341
AIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
Features
DescriptionHaptoglobin
Gene nameHp
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes Molecular Functions
NP_059066.1
none loaded Q61646
HPT_MOUSE
ENSMUST00000074898
none loaded GO:0001666
GO:0001889
GO:0002376
GO:0003824
GO:0005615
GO:0005783
GO:0005794
GO:0006953
GO:0007283
GO:0008152
GO:0009408
GO:0010165
GO:0010288
GO:0016209
GO:0031100
GO:0032026
GO:0032496
GO:0033590
GO:0033591
GO:0042493
GO:0042742
GO:0051384
Acute phase
Immunity
Antibiotic
Antimicrobial
Antioxidant
Serine protease homolog
Display Chart Settings
 

Peak Areas

Retention Times