0102030405060708090
MGPTSPAARGQGRRWRPPLPLLLPLSLLLLRAQLAVGNLAVGSPSAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLLDPQRVLEYCRQMYPE
100110120130140150160170180190
LHIARVEQAAQAIPMERWCGGTRSGRCAHPHHEVVPFHCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDR
200210220230240250260270280290
FRGVEYVCCPPPATPNPSGMAAGDPSTRSWPLGGRAEGGEDEEEVESFPQPVDDYFVEPPQAEEEEEEEEERAPPPSSHTPVMVSRVTPTPRPTDGVDVY
300310320330340350360370380390
FGMPGEIGEHEGFLRAKMDLEERRMRQINEVMREWAMADSQSKNLPKADRQALNEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLA
400410420430440450460470480490
ALQGDPPQAERVLMALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVQTHLQVIEERMNQSLGLLDQNPHLAQELRPQIQELLLAEHLGPSELDA
500510520530540550560570580590
SVPGSSSEDKGSLQPPESKDDPPVTLPKGSTDQESSSSGREKLTPLEQYEQKVNASAPRGFPFHSSDIQRDELAPSGTGVSREALSGLLIMGAGGGSLIV
1
600610620630640650
LSLLLLRKKKPYGTISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP
Features
DescriptionAmyloid-like protein 1 (APLP) (APLP-1) [Cleaved into: C30]
Gene name
Organism CLEAVED INTO:

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded Q03157
APLP1_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times