0102030405060708090
MGAGSSTEQRSPEQPAESDTPSELELSGHGPAAEASGAAGDPADADPATKLPQKNGQLSAVNGVAEQEDVHVQEESQDGQEEEVTVEDVGQRESEDVKEK
100110120130140150160170180190
DRAKEMAASSTVVEDITKDEQEETPEIIEQIPASESNVEEMAQAAESQANDVGFKKVFKFVGFKFTVKKDKNEKSDTVQLLTVKKDEGEGAEASVGAGDH
200210220230240250260270280290
QEPGVETVGESASKESELKQSTEKQEGTLKQAQSSTEIPLQAESGQGTEEEAAKDGEENREKEPTKPLESPTSPVSNETTSSFKKFFTHGWAGWRKKTSF
300310320330340350360370380390
KKPKEDDLETSEKRKEQEAEKVDEEEGEKTEPAPAEEQEPAEGTDQARLSADYEKVELPLEDQVGDLEALSEKCAPLATEVFDEKTEAHQEVVAEVHVST
400410420430440450460470480490
VEKMTKGQGGAEVEGDVVVEGSGESLPPEKLAETQEVPQEAEPVEELMKTKEVCVSGGDHTQLTDLSPEEKMLPKHPEGIVSEVEMLSSQERIKVQGSPL
500510520530540550560570580590
KKLFSSSGLKKLSGKKQKGKRGGGGGDEEPGEYQHIQTESPESADEQKGESSASSPEEPEEIACLEKGPSEAPQEAEAEEGATSDGEKKREGITPWASFK
600610620630640650660670680690
KMVTPKKRVRRPSESDKEEELDKVKSATLSSTESTASGMQDEVRAVGEEQRSEEPKRRVDTSVSWEALICVGSSKKRARKASSSDDEGGPRTLGGDGHRA
700710720730740750760770780790
EEASKDKEADALPASTQEQDQAHGSSSPEPAGSPSEGEGVSTWESFKRLVTPRKKSKSKLEERAEDSGAEQLASEIEPSREESWVSIKKFIPGRRKKRAD
800810820830840850860870880890
GKQEQAAVEDSGPGEINEDDPDVPAVVPLSEYDAVEREKLEAQRAQENVELPQLKGAVYVSEELSKTLVHTVSVAVIDGTRAVTSAEERSPSWISASMTE
1
900910920930940950960970980990
PLEHAEGVATPPVGEVTEKDITAEATPALAQTLPGGKDAHDDIVTSEVDFTSEAVTAAETTEALRAEELTEASGAEETTDMVSAVSQLSDSPDTTEEATP
1000101010201030104010501060107010801090
VQEVEGGMLDTEEQERQTQAVLQAVADKVEDSQVPATQTLQRAGPKALEKVEEVEEDSEVLATEKEKDVVPEGPVQEAETEHLAQGSETVQATPESLEV
1100111011201130114011501160117011801190
PEVTEDVDRATTCQVIKHQQLMEQAVAPESSETLTDSETNGSTPLADSDTPNGTQQDETVDSQDSNAIAAVKQSQVTEEEAAAAQTEGPSTPSSFPAQEE
1200121012201230124012501260127012801290
HREKPGRDVLEPTQALAAGAVPILAKAEVGQEGEAGQFDGEKVKDGQCVKELEVPVHTGPNSQKTADLTRDSEVMEVARCQETESNEEQSISPEKREMGT
1300131013201330134013501360137013801390
DVEKEETETKTEQASEEHEQETAAPEHEGTHPKPVLTADMPHSERGKALGSLEGSPSLPDQDKADCIEVQVQSSDTPVTQTTEAVKKVEETVATSEMDES
1400141014201430144014501460147014801490
LECAGAQSLPAEKLSETGGYGTLQHGEDTVPQGPESQAESIPIIVTPAPESILHSDLQREVSASQKQRSDEDNKPDAGPDAAGKESAAREKILRAEPEIL
1500151015201530154015501560157015801590
ELESKSNKIVQSVIQTAVDQFARTETAPETHASDLQNQVPVMQADSQGAQQMLDKDESDLQVSPQDGTLSAVAQEGLAVSDSSEGMSKASEMITTLAVES
160016101620163016401650166016701680
ASVKESVEKLPLQCKDEKEHAADGPQHQSLAKAEADASGNLTKESPDTNGPKLTEEGDALKEEMNKAQTEEDDLQEPKGDLTES
Features
DescriptionA-kinase anchor protein 12 (short name: AKAP-12)
Gene nameAkap12
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_112462.1
none loaded Q80SS4
Q810D4
Q8BPK4
Q99MP1
Q9WTQ5
AKA12_MOUSE
ENSMUST00000045730
none loaded GO:0005737
GO:0005856
GO:0005886
GO:0006605
GO:0007165
GO:0010739
GO:0030159
GO:0030819
GO:0090036
Display Chart Settings
 

Peak Areas

Retention Times