0102030405060708090
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
1
100110120130140150160170180190
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
200210220230240
AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Features
Description14-3-3 protein theta
Gene nameYwhaq
Organism Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_037185.1
none loaded P35216
P68255
P68254
1433T_RAT
1433T_MOUSE
ENSRNOT00000011501
none loaded GO:0005737
GO:0006605
GO:0007264
GO:0043234
GO:0045892
GO:0070062
Display Chart Settings
 

Peak Areas

Retention Times