0102030405060708090
MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHN
100110120130140150160170180190
FVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELLTPQGPSPFTQQRDQEHFSFP
200210220230240250260270280290
APANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFSTDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYY
300310320330340350360370380390
WEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFD
400410420430440450460470480490
MVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYEL
1
500510520530540550560570580590
MTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAMRRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAA
600
RLVP
Features
DescriptionSerine/threonine-protein kinase A-Raf
Gene nameAraf
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_033833.1
NP_001153117.1
none loaded B1AUN9
P04627
Q99J44
Q9CTT5
Q9D6R6
Q9DBU7
ARAF_MOUSE
ENSMUST00000001155
none loaded GO:0004674
GO:0005057
GO:0005524
GO:0005739
GO:0032006
GO:0032434
GO:0033138
GO:0043066
GO:0046872
Kinase
Serine/threonine-protein kinase
Transferase
Display Chart Settings
 

Peak Areas

Retention Times