View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDV
101111121131141151161171181191
LSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
1
2
201211221231241
FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Intensity
(Log 10 base)
Features
Description14-3-3 protein gamma
Gene namesYwhag, YWHAG
Organism Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_062249.1
none loaded A0JPM0
O70457
P35214
P61983
Q9UDP2
Q9UN99
P61981
P61982
A8IP69
1433G_RAT
1433G_HUMAN
1433G_MOUSE
A8IP69_MOUSE
ENSRNOT00000001954
none loaded GO:0003779
GO:0005080
GO:0005159
GO:0005737
GO:0006605
GO:0007165
GO:0030234
GO:0031988
GO:0032869
GO:0045664
GO:0048167
GO:0070062
Display Chart Settings
 

Peak Areas

Retention Times