View Settings
The number displayed on each peptide box is the rank
1112131415161718191
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVP
1
101111
PTFGGGTKLEIKR
Features
DescriptionIg kappa chain V-II region 26-10
Gene name-
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
none loaded none loaded P01631
KV2A7_MOUSE
none loaded none loaded GO:0003823
Monoclonal antibody
Display Chart Settings
 

Peak Areas

Retention Times