View Settings
The number displayed on each peptide box is the rank
1112131415161718191
DIVMTQAVFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLLYQMSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGVYYCAHNLELP
1
101111
YTFGGGTKLEIKR
Features
DescriptionIg kappa chain V-II region 17S29.1
Gene name-
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P03976
KV2A5_MOUSE
none loaded none loaded GO:0003823
Display Chart Settings
 

Peak Areas

Retention Times