View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
101111121131141151161171181191
SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
1
Features
DescriptionInterleukin-18 (short name: IL-18)
Gene nameIL18
Organism Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_001230140.1
NP_001553.1
none loaded O75599
Q14116
Q6FGY3
Q6WWJ7
IL18_HUMAN
ENST00000280357
ENST00000524595
ENST00000528832
none loaded GO:0000165
GO:0001525
GO:0005125
GO:0005576
GO:0005615
GO:0005829
GO:0006954
GO:0007267
GO:0010628
GO:0030101
GO:0030155
GO:0030431
GO:0031663
GO:0032725
GO:0032729
GO:0032740
GO:0032819
GO:0034105
GO:0042033
GO:0042088
GO:0042092
GO:0042094
GO:0042095
GO:0042104
GO:0042231
GO:0042253
GO:0042346
GO:0050729
GO:0051142
GO:0071407
Cytokine
Display Chart Settings
 

Peak Areas

Retention Times